1USUB

The structure of the complex between aha1 and hsp90
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
142
structure length
132
Chain Sequence
b'VDKNCIGWAKEYFKQKIVGVEAKKYAKIKSVSSIEGDCEVNQRGKVISLFDLKITVLIEGHVDSALPFEGSINVPEVAFDSEASSYQFDISIFKETSELSEAKPLIRSELLPKLRQIFQQFGKDLLATHGND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT SHOCK PROTEIN HSP82
publication title Structural Basis for Recruitment of the ATPase Activator Aha1 to the Hsp90 Chaperone Machinery.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 33
structure length 132
sequence length 142
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09229 Aha1_N Activator of Hsp90 ATPase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.20 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 1usuB00
1USVB 1USUB 3N72A
chains in the Genus database with same CATH superfamily
2RQFA 1BP1A 4G0SA 3N72A 3AOTA 2OBDA 3E8WA 1EWFA 3H4ZA 3A1ZA 1USVB 3AOSA 1USUB 3ZPMA 3L6IA 4F2AA 4M4DA 3E8TA 5I7KA 5I7JA 3UV1A 4KGHA 4KGOA 5I7LA 4EWSA 2RCKA
chains in the Genus database with same CATH topology
2RQFA 1BP1A 4G0SA 3N72A 3AOTA 2OBDA 3E8WA 1EWFA 3H4ZA 3A1ZA 1USVB 3AOSA 1USUB 3ZPMA 3L6IA 4F2AA 4M4DA 3E8TA 5I7KA 5I7JA 3UV1A 4KGHA 4KGOA 5I7LA 4EWSA 2RCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USV B;  1USU B;  3N72 A; 
#chains in the Genus database with same CATH topology
 2RQF A;  1BP1 A;  4G0S A;  3N72 A;  3AOT A;  2OBD A;  3E8W A;  1EWF A;  3H4Z A;  3A1Z A;  1USV B;  3AOS A;  1USU B;  3ZPM A;  3L6I A;  4F2A A;  4M4D A;  3E8T A;  5I7K A;  5I7J A;  3UV1 A;  4KGH A;  4KGO A;  5I7L A;  4EWS A;  2RCK A; 
#chains in the Genus database with same CATH homology
 2RQF A;  1BP1 A;  4G0S A;  3N72 A;  3AOT A;  2OBD A;  3E8W A;  1EWF A;  3H4Z A;  3A1Z A;  1USV B;  3AOS A;  1USU B;  3ZPM A;  3L6I A;  4F2A A;  4M4D A;  3E8T A;  5I7K A;  5I7J A;  3UV1 A;  4KGH A;  4KGO A;  5I7L A;  4EWS A;  2RCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...