1USUB

The structure of the complex between aha1 and hsp90
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
142
structure length
132
Chain Sequence
VDKNCIGWAKEYFKQKIVGVEAKKYAKIKSVSSIEGDCEVNQRGKVISLFDLKITVLIEGHVDSALPFEGSINVPEVAFDSEASSYQFDISIFKETSELSEAKPLIRSELLPKLRQIFQQFGKDLLATHGND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords HEAT SHOCK PROTEIN HSP82
publication title Structural Basis for Recruitment of the ATPase Activator Aha1 to the Hsp90 Chaperone Machinery.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 33
structure length 132
sequence length 142
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09229 Aha1_N Activator of Hsp90 ATPase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.20 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 1usuB00
3N72A 1USVB 1USUB
chains in the Genus database with same CATH superfamily
3A1ZA 4KGOA 5I7LA 3N72A 3AOSA 3E8WA 1EWFA 2OBDA 1BP1A 5I7JA 4M4DA 3UV1A 3E8TA 1USVB 4KGHA 3ZPMA 4G0SA 3L6IA 4F2AA 2RCKA 1USUB 3H4ZA 4EWSA 3AOTA 5I7KA 2RQFA
chains in the Genus database with same CATH topology
3A1ZA 4KGOA 5I7LA 3N72A 3AOSA 3E8WA 1EWFA 2OBDA 1BP1A 5I7JA 4M4DA 3UV1A 3E8TA 1USVB 4KGHA 3ZPMA 4G0SA 3L6IA 4F2AA 2RCKA 1USUB 3H4ZA 4EWSA 3AOTA 5I7KA 2RQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N72 A;  1USV B;  1USU B; 
#chains in the Genus database with same CATH topology
 3A1Z A;  4KGO A;  5I7L A;  3N72 A;  3AOS A;  3E8W A;  1EWF A;  2OBD A;  1BP1 A;  5I7J A;  4M4D A;  3UV1 A;  3E8T A;  1USV B;  4KGH A;  3ZPM A;  4G0S A;  3L6I A;  4F2A A;  2RCK A;  1USU B;  3H4Z A;  4EWS A;  3AOT A;  5I7K A;  2RQF A; 
#chains in the Genus database with same CATH homology
 3A1Z A;  4KGO A;  5I7L A;  3N72 A;  3AOS A;  3E8W A;  1EWF A;  2OBD A;  1BP1 A;  5I7J A;  4M4D A;  3UV1 A;  3E8T A;  1USV B;  4KGH A;  3ZPM A;  4G0S A;  3L6I A;  4F2A A;  2RCK A;  1USU B;  3H4Z A;  4EWS A;  3AOT A;  5I7K A;  2RQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...