3H4ZA

Crystal structure of an mbp-der p 7 fusion protein
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
568
structure length
568
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYAAGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSAVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAADPIHYDKITEEINKAVDEAVAAIEKSETFDPMKVPDHSDKFERHIGIIDLKGELDMRNIQVRGLKQMKRVGDANVKSEDGVVKAHLLVGVHDDVVSMEYDLAYKLGDLHPNTHVISDIQDFVVELSLEVSEEGNMTLTSFEVRQFANVVNHIGGLSILDPIFAVLSDVLTAIFQDTVRAEMTKVLAPAFKKELERNNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein fused with Allergen DERP
publication title The structure of the dust mite allergen Der p 7 reveals similarities to innate immune proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Allergen
total genus 167
structure length 568
sequence length 568
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF16984 Grp7_allergen Group 7 allergen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.50 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 3h4zA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3h4zA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3h4zA01
1ZU0A 5AA1A 5CBSA 4HS7A 1II5A 1ANFA 4G68B 4M4GA 2FA7A 3KOSA 3JYRA 1P1OA 1LGBC 3D4GA 3QXMA 4LVQA 3RQTA 1DTZA 3KBRA 1N7XA 3OO8A 2Z8FA 1UTHA 4HTGA 2DVCA 3N6UA 2D21A 2I49A 4I9DA 4LZ7A 3E3KA 1Y1MA 1S9TA 4NF4A 4F1UA 1B6HA 1LB8A 1URSA 4OWDA 3GLBA 1PB8A 3G3IA 2B3BA 1EZOA 5CMMA 1PB9A 3RTFB 1NL5A 3PPNA 2H5YA 1TXFA 5BWJA 1A7LA 5DT6A 3Q25A 3IX1A 5IAIA 3FJGA 3MJNA 1BIYA 2F78A 3FXUA 2H98A 4BDMA 5KCJB 4IO2A 1OQGA 1D9YA 3RTWB 3MQ9A 3IJOB 1GGGA 1OVTA 3TTNA 1B0LA 3PUWE 3PGFA 3IAZA 4ZEKA 3FV2A 1M5EA 2IEEA 2HFBA 4NWCA 4EF1A 3TUSA 5AA3A 4R74A 2DXYA 1J1NA 1P1QA 3GBAA 2XXQA 3O28A 2AIXA 1RKMA 3OSRA 3L6GA 3OELA 1LAHE 2I4CA 3C31A 1IXCA 3S4UA 4YZZA 3SEUA 4KCDA 3HHFA 1L5TA 2DXRA 1B3GA 2I58A 1UTHB 4R2BA 5AA2A 1B3HA 5IKBA 4ZEFA 4DXBA 4NF4B 3C34A 3DELB 4GWOA 5KZTA 2PX1A 2REGA 4JSOA 3FVKA 1LLSA 4R9GA 3WAEA 4F22A 2QJEA 3DP4A 2NWJA 3VV5A 1P1UA 3OO9A 1B4HA 4Q8RA 1R6ZA 3HCQA 1Y3NA 4POXA 2Q2CA 4WEDA 3E4RA 2UVHA 1MM6A 4NMYA 1JEVA 4Q0CA 3CFXA 3O29A 1YPNA 2F7BA 2DOJA 1B3FA 3DP6A 3TEPA 3S9EA 1JQFA 3M3KA 3C33A 4GLIA 3N26A 4QFKA 4GXSB 2OWTA 1US4A 3IB2A 2Q9TA 4LQ2A 1I6BA 5DEXA 2PT1A 3O2AA 4RPNA 1ELJA 3RY3A 1IEJA 3CRBA 2FYIA 1H45A 4IB2A 1MH4A 5ITOA 3UGWA 3V5AA 4FECA 4ZZAA 4AB6A 1P1WA 3THIA 1MXXA 2H25A 4ZE8A 4ELPA 3CVGA 1MY0A 1QKBA 3PPOA 1RYXA 3LUYA 3OD7A 4P0GA 2OLBA 3KJTA 4GXAA 4OEVA 4NF8A 3IL1B 5AA2B 2DQVA 2HXWA 4IO4A 3K01A 5I84A 1Y4TA 3L6HA 2NUVA 2ZYNA 1JW1A 5ICTA 4MLQA 4ZEDA 1F9BA 1B0HA 4PE5B 2AL4A 3VE1B 1ZBMA 1XOCA 4NEDA 3IO4A 4EXLA 2PVUA 4I8CA 4QFPA 4Q5TA 2D3IA 2G29A 3TYHA 5AA2D 4DXCA 3TCHA 3GXAA 4Q30B 4G4PA 1B2HA 4QRZA 3HSTA 3Q28A 1M5BA 2HEUA 4GFRA 1ZJLA 4QFNA 3CG1A 2W7YA 3PUYE 4DXUA 1SW5A 3KOTA 1FQDA 2QMXA 3SESA 2E1SA 4TQUQ 2D5WA 3U1OA 5DEXB 5TPAA 2RCBA 4PP0A 1B05A 3FVOA 1PBQA 2XHDA 5I59A 4LP2B 4MH5A 1LSTA 1EZ9A 4XKNA 1TT1A 1FTMA 4N07A 3KEIA 3C35A 3LR1A 3W9VA 1O7TA 3H3GA 1JW4A 3S9MC 3IOWA 1GV8A 1ZKBA 3E9XA 2GHAA 1VR5A 4C1TA 3G3GA 4F29A 3S9NC 1FCKA 4FAJA 3ILUB 4BDLA 4GVOA 2VHAA 3PV0E 4DZ1A 3EQ1A 3TPAA 3HPIA 4NF8B 5JK4A 1FTLA 2UVJA 3MBPA 4ECFA 1H44A 1VSOA 1B46A 1DPEA 3OXNA 4R9FA 1IXGA 1JETA 1NH7A 1JW5A 2ZMBA 5FHNA 2ZYMA 1Y3QA 5H8SA 4JXIA 2NVUB 5EHMA 2WKYA 4H0WA 4PETA 2HQ0A 1I6AA 4H6DA 1DMBA 4QF9A 1SW1A 2Y7RA 2X7QA 4F3PA 4LATA 1B40A 4DCYA 2CMOA 1IUDA 4OVJA 4R72A 4M1VA 4NF6A 4NE4A 4ZS9A 4LZ5A 2UXAA 1B7ZA 4ESWA 5L8DA 5JEIA 2DYXA 3N94A 1WDNA 2HZKA 2RKMA 5H8HB 4F2QA 3V83A 3I5OA 4OHNA 3O66A 3MP8A 1AOVA 1IXHA 1FTJA 4RK9A 2ESNA 3K2DA 3IB0A 2A5SA 3O6HA 3H06B 4G68C 4H5FA 3P7IA 1MXUA 4WXJA 3FIRA 1VFDA 5I58A 5I59B 4N6PA 4F3GA 4U4XA 5K2XA 1JNFA 1XT8A 4RJZA 4RYAA 4O3BA 1H43A 3FGSA 3MVYA 4YICA 1FTKA 3ECRA 4P0IA 4U4SA 4F31B 3GBBA 1S50A 3C32A 4P11A 4EQBA 3PPQA 5CM6A 5L9MA 3M3FA 2I3VA 1AH5A 1QJMA 1B1HA 4THIA 3EF7A 4IO3A 3LSFB 1M5FA 3EHSA 3CIJA 4NF5A 4OETA 2VD3A 3LSXA 2R6GE 1FQCA 1Y1ZA 2CZLA 3I3VA 3PUVE 5AA4B 4UACA 3IOVA 1A8FA 3T9XB 1N3XA 1I69A 4YU0A 4PFWA 1SW2A 5AE4A 2LAOA 4RPOA 4ZEIA 4FJPA 5TU0A 2DS9A 2XX7A 2Z23A 3OOAA 3KJ7A 1EH3A 3O6IA 1OMPA 4NF6B 1H3DA 4OFOA 4QFOA 1FQBA 4R6KA 5H8FA 3TTKA 1UTBB 1N3WA 3VXBA 5FTIA 3G3JA 4QHQA 2XXTA 1DPPA 3CI8A 4U22A 3SEVA 2THIA 4MF3A 1LFIA 3G3FA 1LAFE 3EHUA 5DVJA 3A09A 2VP1A 3TODA 3BFTA 2GRVA 1MXYA 1MG1A 1QUJA 2AYSA 2RINA 1O64A 5I58B 4G2ZA 4U23A 1MY4A 4OYVA 1M5DA 1R9LA 5FTHA 1QULA 1IXIA 3QIMA 3B6TA 3TDJA 2V84A 5L9OA 1R9QA 3MZ9A 1MPDA 1OIBA 3UA8A 3U93A 3TFLA 4GF8A 1LBCA 4OFLA 1HSJA 3LSWA 1NNTA 4XKRA 4HCWA 4Z7EA 1B1XA 4X9TA 4OXVA 3M3LA 1I6QA 2OBGA 1CE2A 3FJ7A 3JZJA 2ANJA 1NNKA 3KSJA 3N6TA 1US5A 2XXPA 3U94A 3OO7A 1IQ7A 1MQJA 3TCFA 3T22A 3FD3A 3MVXA 1LFGA 5I56A 2Z8DA 4IGRA 4YKJA 1SYIA 2O84X 4XTCQ 4QSCA 4F19A 5J1DA 4GQOA 4TLLB 4POWA 4PQJA 3TELA 4XKQA 3K6VA 4KD5A 3UN6A 2DSFA 1A54A 4H5GA 2UVGA 3OENA 2Y7KA 1HSEA 3BFUA 5A5XA 1B4ZA 2O69A 5H8FB 1ZMGA 2NOOA 4AB5A 5FHOA 1OLCA 5FHMA 3PD9A 2ONSA 2ZNTA 1XVXA 3C9HA 3HHGA 3ODBA 1QKAA 3RGYA 3LBSA 3MAMA 3B7DA 3MVWA 4C1UA 3CG3A 2O1LA 3CSGA 2HZLA 1URGA 4F2OA 4BDOA 5LOMA 3I6VA 4IY5A 3RN8A 1NH8A 4G8HA 1UIUA 1XS5A 1D3KA 5DTBA 3V8XB 1VFEA 3VVDA 1SQYA 3SEXA 2DWIA 5K2YA 3F11A 4DE8A 2XXHA 4FIMA 2VD2A 2B65A 4GRKA 4L17A 4XXUA 4IY6A 1B5HA 1MY3A 3S2VA 3TCGA 4IO7A 1MPBA 1N84A 2GHBA 2ONRA 1ZIUA 1GTKA 1DOTA 3BKIB 3RUMA 3W9WA 1ATGA 1NFTA 1MQHA 4F1VA 1D9VA 2G93A 1AIVA 3EPEA 1DSNA 2XXWA 4GL8A 3BBRA 1PBPA 4LUBA 4JWYA 3U92A 1EZPA 1AMFA 2F6GA 4U2RA 1P99A 3TTRA 4KYSA 3O6GA 4NTLA 1FQAA 2OCUA 5I2NA 3B6QA 4TLMB 4ESXA 5HPQA 3FVNA 2O7IA 2ZYKA 3FASA 2V3UA 5H8NA 2XXUA 4LONB 4ZEBA 2Y7WA 1SVXB 5DVFA 2O68A 4WEPA 2UYEA 3MP6A 3MPKA 5CI5A 2R71A 2PYYA 5A5XB 2F7CA 1Y4CA 2F36A 3T93B 2OK2A 2ABHA 3SETA 2RC8A 2RC9A 1OVBA 1T0KA 2H9BA 1N76A 4JB7A 5EHSA 3SDFA 4ELRA 2I0CA 1SDXA 2X7PA 5ICQA 1VE4A 3KZGA 5M2VA 3H6VA 5CBRA 1KWHA 2PBWA 4PFUA 1MY2A 4QSDA 1B52A 4ND9A 4KYDA 4YAHX 5CMKA 3CR9A 1N0TA 4GOTA 4R2FA 2V3QA 2H99A 3MZ1A 4YB6A 3N5LA 3PMVA 1GR2A 4ZZEA 2XX9A 1BLFA 1NNPA 4R73A 4FORA 4OQOA 2GH9A 2Y7PA 1Q35A 3K02A 3ONMA 1P1NA 2DE4A 3OO6A 4ONYA 3MW0A 3U72A 4EQ9A 3VXCA 1YCJA 1XVYA 1POTA 1FW0A 3H6WA 4JWOA 2Y7IA 4G77A 3FV1A 2R9JA 2DWJA 1USYH 2A5TA 4BDQA 1NKXA 4KFQA 1WVJA 5CC2A 1SW4A 2F8DA 2ZYOA 1Y9UA 1XC1A 2I3WA 4O3AA 1IITA 2Q2AA 3V89B 3PPPA 1MQDA 2HCAA 3K1MA 3MVZA 2RF1A 2XXIA 4ISUA 4WKMA 3SERA 1LB9A 4RK2A 3C4MA 1D4NA 2O1MA 4HCYA 4O3CA 2YPNA 3HV1A 3EHTA 3IOTA 1BKAA 3JV9A 5TPAB 4F1YA 3HN0A 3OSQA 2QRYA 3KGCA 3C36A 2B3FA 3FUZA 5F7VA 4NWDA 4DLDA 2VOZA 4OERA 2DE2A 2QS3A 4DIGA 3Q26A 1LAXA 1NMUA 4YKIA 2RCAA 2XXRA 3B6WA 4C0RA 2Q8JA 1TFDA 5EYFA 1A99A 1Q1KA 3IO6A 2REJA 4MBPA 5CMCA 3KN3A 4BDNA 1FQFA 3AXFA 4LZ8A 3PPRA 1MDQA 3TQWA 1LCFA 2V3TA 1A55A 2UVIA 3KFMA 3H6UA 3QAXA 3TQLA 3TKDA 3OEKA 1LFHA 4YKPA 2XD3A 3E13X 4OENA 4KR5A 4FEBA 2ZNSA 2ALUA 4KCCA 1B58A 1Z7NE 3PUZE 4ELOA 2YJPA 1B7UA 3USDA 1IZ1A 3DP8A 2F35A 2ZXTA 1FTOA 2A5TB 4FATA 5H8QA 1O63A 5CRYA 2F5XA 3QYTA 3IJXB 1XHYA 3K00A 5ITPA 4LQ5A 5B70A 1FQEA 4KI0E 1USYE 4U1ZA 4FEDA 3M8UA 3KN7A 3KSXA 3PMXA 3VLWA 2DVZA 1B3LA 4PFTA 4LA9A 1IIWA 3UORA 3FJMA 3FATA 1GVCA 3VFJA 3D4CA 4U1OA 3TTMA 1MM7A 1TWYA 2PMSA 1MH3A 1ZTYA 2Z22A 2O6AA 3UIFA 2XXVA 4G8MA 3SEWA 1UIVA 4H8JA 4EDPA 3T96B 4X1BA 2DWHA 1Y3PA 4JDFA 2RC7A 4GIZA 3FZVA 3K6UA 4QFLA 2UYFA 3Q27A 3T9UA 4DDDA 3IK6B 4R6HA 4H1XA 4X48A 2ONKE 1HSLA 4OFJA 4NF5B 4PFYA 2P1SA 3KG2A 3O97A 4KQPA 2YLNA 3UK4A 2DWAA 3HO7A 2OJTA 3RPWA 4EUOA 5JTYA 3SEYA 4YB5A 3IOUA 3MC2A 5BUUA 2XXXA 4YKKA 5H8QB 1B9JA 3O9PA 3RT6B 3LC8A 4F3BA 3KN8A 2V25A 3MP1A 3VLVA 4R75A 2HAUA 4OESA 1LCTA 3FXRA 3K1NA 3G3HA 2BJJX 4ELQA 2DE3A 3PU5A 3MPLA 1SD3A 2F97A 3TTLA 3K4UA 4GL0A 1B51A 5ELVA 2GFEA 3QUFA 3DLNA 4ZE9A 4RA1A 3R26A 1PB7A 4RY1A 3QK6A 5I57A 2E0SA 4RNSA 4I1DA 5TP9A 1MQGA 3SKPA 4GD5A 1NNFA 4EF2A 1LBBA 2H4IA 3FVGA 2OWSA 4F3SA 3S9LC 1MPCA 1MXWA 4YMBA 1UQWA 4JWXA 1SYHA 4XKPA 4G8NA 3OEMA 2ZNUA 1ZLQA 3CFLA 1S7YA 1M5CA 3K6XA 1WODA 4H8IA 1B3EA 3R6UA 2Y84A 5I2KA 3ZKLA 1QW0A 2QS4A 3ZKKA 3CFZA 4F39A 1MRPA 3UV1A 3A3UA 1SI0A 4XIGQ 3MWBA 2Q89A 4OMBA 3PMWA 5I56B 4TOZA 5JTYB 4QSEA 2P0SA 4I62A 1SBPA 2I48A 2XXYA 1N04A 4JBZA 1N7WA 3R7XA 4E0XA 3H03A 3IB1A 2QMWA 3K1PA 2I0BA 3G3KA 1OLAA 5KDTA 3RNNA 4MLVA 1QUKA 3DM0A 5HM4B 4R6YA 2F6PA 2AL5A 2F7AA 4IO6A 4JSDA 2OZZA 4BDRA 3H7MA 3UP9A 5B7DA 1JVXA 1OQHA 3VLUA 3RLFE 2FNCA 5DVIA 4RXLA 4MFIA 1JEUA 3K6WA 1TFAA 3W15C 2F34A 3QSLA 2QSXA 1CB6A 4YB7A 5H8HA 5I57B 4OTEA 5TP9B 2VGQA 3U8QA 3T66A 4HW8A 1MY1A 3CSBA 1B7HA 5CMBA 3VVEA 1MXVA 2M8CA 3T9HB 4Z0IA 3PD8A 3H6TA 4OEUA 4KHZE 1H76A 3EN3A 1MXZA 1A8EA 4ZECA 1Z7ME 1A40A 3ILTB 1MDP1 4DCXA 4ZDMA 5I2KB 1YAEA 3IR1A 1MQIA 2X26A 4IGTA 4G68A 3MUQA 3PUXE 3Q29A 1YTVA 2Z8EA 1SI1A 1B32A 2XD2A 3ZSFA 4N13A 2PT2A 3TAJA 1R1NA 5I2NB 4AQ4A 1QUIA 1AL3A 3MZBA 2O51A 5AA4A 1JVYA 2DP8A 3T9VA 1Y20A 1QVSA 3ZS6A 1B5JA 1RYOA 5KDTB 1PDAA 3OMBA 3G7WA 5H8NB 1B5IA 5F1QA 3A3CA 4IO5A 1MS7A 2QPQA 4UA8A 5HBCA 2Q88A 2XX8A 1PC3A 4KYEA 2QS1A 3RT8A 5DYHA 3K0VA 2V93A 5KCJA 1LAGE 4F18A 4BLAA 4U21A 1DTGA 5L9SA 3VVFA 4H65A 2HAVA 2P2AA 2QS2A 3TMGA 1UTBA 4KPTA 2IA4A 4H67A 4EXKA 2I4BA 1URDA 3GZGA 2I6EA 2NXOA 1BP5A 3TZAA 3LSLA 1BTJA 3H4ZA 3FXQA 2O7UA 4OZ9A 4FE8A 2KLFA 3WAFA 3IORA 4EQ7A 2QL3A 5ISUA 4K3FA 4X1DA 3QUJA 1EU8A 4E0WA 1PEBA 3VDFA 4YMAA 1POY1
chains in the Genus database with same CATH superfamily
1ZU0A 5AA1A 5CBSA 4HS7A 3BIHA 1II5A 4N17A 1RDXA 2WBBA 1ANFA 4G68B 4M4GA 2FA7A 3KOSA 3JYRA 1P1OA 1LGBC 3ROJA 2F3BA 3D4GA 3QXMA 4LVQA 3RQTA 1DTZA 4O7MA 3KBRA 2VT5A 1N7XA 3OO8A 2Z8FA 1UTHA 2QVVA 4HTGA 4EWSA 2DVCA 3N6UA 2D21A 4PBQA 2I49A 4I9DA 4LZ7A 3E3KA 1Y1MA 1S9TA 4NF4A 4F1UA 1B6HA 1LB8A 2XWIA 1URSA 4OWDA 3GLBA 1PB8A 3G3IA 1SPIA 2B3BA 1EZOA 5CMMA 1PB9A 3RTFB 1NL5A 3PPNA 2H5YA 1TXFA 5BWJA 1A7LA 5DT6A 3Q25A 3IX1A 5IAIA 3FJGA 3MJNA 1BIYA 2F78A 3FXUA 2H98A 4BDMA 5IZ3A 5FBPA 5KCJB 4IO2A 4NN3A 1OQGA 1D9YA 3RTWB 3MQ9A 4X04A 1IMCA 3IJOB 1GGGA 3PTYA 1OVTA 3TTNA 1B0LA 3PUWE 3FBPA 3PGFA 3IAZA 4ZEKA 5EQ9A 3FV2A 1KA1A 1M5EA 2IEEA 2HFBA 4NWCA 4EF1A 3TUSA 5AA3A 4JVCA 4R74A 2DXYA 1J1NA 1P1QA 3GBAA 4OA4A 2XXQA 3O28A 2AIXA 1RKMA 3OSRA 3L6GA 4I40A 3OELA 1LAHE 2I4CA 3C31A 1IXCA 3S4UA 4YZZA 3CHGA 4GX6A 3SEUA 4KCDA 3HHFA 1L5TA 2MKZA 2DXRA 4P1EA 1B3GA 2I58A 1UTHB 4PAFA 4R2BA 5AA2A 1FBGA 1B3HA 5IKBA 4ZEFA 4DXBA 4NF4B 3C34A 3DELB 4GWOA 5KZTA 2PX1A 5EQ7A 2REGA 4JSOA 3FVKA 1FBEA 1LLSA 4R9GA 2OWZA 3WAEA 4F22A 2QJEA 3DP4A 2NWJA 3VV5A 1P1UA 3OO9A 1B4HA 4Q8RA 3N72A 1R6ZA 3HCQA 1RDZA 1Y3NA 4POXA 2Q2CA 4WEDA 3E4RA 2UVHA 5IZ3B 1MM6A 4N91A 4NMYA 1JEVA 4Q0CA 3CFXA 3O29A 1YPNA 2F7BA 2DOJA 1B3FA 3DP6A 3TEPA 3S9EA 1JQFA 3M3KA 3C33A 4GLIA 3N26A 4OVRA 4H46A 4QFKA 4GXSB 2OWTA 1US4A 4GBVA 3IB2A 4MIJA 2Q9TA 4LQ2A 1I6BA 5DEXA 2PT1A 3O2AA 4RPNA 1ELJA 2HXRA 3RY3A 1IEJA 3CRBA 2FYIA 1H45A 4IB2A 1MH4A 2WX9A 1LBVA 1IMBA 5ITOA 4MNCA 3UGWA 3V5AA 4FECA 4ZZAA 4AS4A 4AB6A 1P1WA 2XA5A 3THIA 2CEXA 1MXXA 2H25A 4ZE8A 4ELPA 3CVGA 1MY0A 1QKBA 5ET5A 3PPOA 1RYXA 3LUYA 3OD7A 4N8YA 4P0GA 2OLBA 3KJTA 4UABA 2FVZA 4GXAA 4OEVA 4NF8A 1IMEA 2L5VA 4FBPA 3IL1B 5AA2B 2DQVA 2HXWA 4IO4A 3K01A 5I84A 1Y4TA 3L6HA 2NUVA 4N15A 2ZYNA 1JW1A 5ICTA 4MLQA 4ZEDA 1F9BA 1B0HA 4PE5B 2AL4A 3VE1B 1ZBMA 1XOCA 4NEDA 1NV7A 3IO4A 3EKIA 4EXLA 1LBZA 2PVUA 4I8CA 4QFPA 4Q5TA 2D3IA 3LUZA 4PCDA 2G29A 3TYHA 5AA2D 4DXCA 3TCHA 3GXAA 4Q30B 4G4PA 1B2HA 2V4CA 4QRZA 1FPGA 3HSTA 3Q28A 1M5BA 2HEUA 4GFRA 4KGHA 1ZJLA 4QFNA 3CG1A 2W7YA 3PUYE 4DXUA 1SW5A 3KOTA 3RPLA 1FQDA 2QMXA 3SESA 2E1SA 4TQUQ 2D5WA 2KR0A 3U1OA 5DEXB 5TPAA 3E78A 2RCBA 2WYKA 4PP0A 1B05A 4GWXA 3FVOA 1PBQA 2XHDA 5I59A 3A1ZA 4LP2B 4MH5A 1LSTA 1EZ9A 4XKNA 1TT1A 1FTMA 4N07A 3KEIA 3C35A 3RYDA 1AWBA 1EWFA 3LR1A 3W9VA 1O7TA 3H3GA 1YXIA 1JW4A 2DDKA 3S9MC 3IOWA 1GV8A 1ZKBA 3E9XA 2BJIA 2GHAA 4XFEA 1VR5A 4MJOA 4C1TA 3G3GA 4F29A 3S9NC 1FCKA 4FAJA 3ILUB 2CZIA 4BDLA 4GVOA 2VHAA 1FPIA 4KGOA 3PV0E 4DZ1A 3EQ1A 3TPAA 3HPIA 4NF8B 5JK4A 1FTLA 2UVJA 3MBPA 4ECFA 1H44A 1VSOA 1B46A 1DPEA 3OXNA 4R9FA 1IXGA 1DBZA 1JETA 1NH7A 1JW5A 2ZMBA 5FHNA 2ZYMA 1NV0A 1Y3QA 4MNIA 5H8SA 4JXIA 2NVUB 5EHMA 2WKYA 4H0WA 4PETA 4F2AA 2HQ0A 1I6AA 4H6DA 1DMBA 3T1BA 4QF9A 1SW1A 4AS5A 3B8BA 2Y7RA 2X7QA 4F3PA 4LATA 1B40A 4DCYA 2CMOA 1LEVA 1IUDA 4OVJA 2VPOA 4R72A 4M1VA 4NF6A 4NE4A 4ZS9A 4LZ5A 2UXAA 1B7ZA 4ESWA 5L8DA 5JEIA 2DYXA 3N94A 1WDNA 2HZKA 2RKMA 5H8HB 4F2QA 3V83A 4PF8A 3I5OA 4OHNA 3O66A 2FIXA 3MP8A 1AOVA 4KXPA 1IXHA 4PGNA 3RPLB 5I3SA 1FTJA 4RK9A 2ESNA 3K2DA 3IB0A 2A5SA 3O6HA 1QGXA 1K9ZA 3H06B 4G68C 4H5FA 3P7IA 1MXUA 4N8GA 4WXJA 3FIRA 1VFDA 5I58A 5I59B 4GWUA 4N6PA 4F3GA 4U4XA 5K2XA 1KZ8A 1JNFA 5LDZA 1XT8A 4RJZA 4RYAA 3SZPA 4O3BA 1H43A 3FGSA 3MVYA 4YICA 1FTKA 3ECRA 4P0IA 1G0IA 4U4SA 4F31B 3GBBA 1S50A 3C32A 4P11A 4EQBA 3PPQA 5CM6A 5L9MA 3M3FA 4O94A 2I3VA 1AH5A 1QJMA 1B1HA 4THIA 3EF7A 4IO3A 3LSFB 1M5FA 3EHSA 3CIJA 4NF5A 4OETA 2VD3A 3LSXA 2R6GE 1FQCA 1Y1ZA 2CZLA 3I3VA 3PUVE 5AA4B 4UACA 3IOVA 1A8FA 3T9XB 1N3XA 1I69A 4YU0A 4OVPA 4PFWA 1SW2A 5AE4A 2LAOA 4RPOA 4ZEIA 4FJPA 5TU0A 2PFZA 2DS9A 2XX7A 2Z23A 3OOAA 1FJ9A 3KJ7A 1EH3A 3O6IA 2HPGA 1OMPA 4NF6B 1FPKA 1H3DA 4OFOA 4QFOA 1FQBA 4HE2A 4R6KA 5H8FA 3MYUA 3TTKA 1UTBB 1N3WA 3VXBA 4GBWA 5FTIA 3G3JA 4QHQA 2XXTA 1DPPA 3CI8A 4U22A 3SEVA 4QBAA 2THIA 4MAGA 1LFIA 4MF3A 4P8BA 3G3FA 1LAFE 3EHUA 3A09A 5DVJA 2VP1A 3TODA 3BFTA 2GRVA 1MXYA 1MG1A 1QUJA 2AYSA 2RINA 1O64A 5I58B 4G2ZA 4U23A 1MY4A 4OYVA 1M5DA 2B4MA 1R9LA 5FTHA 1QULA 1FTAA 1IXIA 3QIMA 3B6TA 3TDJA 2V84A 5L9OA 1R9QA 3MZ9A 1NV5A 1MPDA 1OIBA 3UA8A 3U93A 3TFLA 4GF8A 1LBCA 4OFLA 1HSJA 3LSWA 1NNTA 4XKRA 4HCWA 5A5LA 4Z7EA 4JVIA 1B1XA 4X9TA 4OXVA 3M3LA 1I6QA 2OBGA 1CE2A 3FJ7A 3JZJA 2ANJA 1NNKA 1RDYA 3KSJA 3N6TA 1US5A 4PAIA 2XXPA 3U94A 3OO7A 1IQ7A 1MQJA 3TCFA 3T22A 3FD3A 4GWYA 1IMFA 3MVXA 4O8MA 1LFGA 5I56A 2Z8DA 1K9YA 4IGRA 4YKJA 1SYIA 2O84X 4XTCQ 5EQAA 4QSCA 4F19A 5J1DA 3U65A 5LTCA 4GQOA 4TLLB 4P1LA 4POWA 4PQJA 3TELA 4XKQA 3K6VA 4KD5A 1NUZA 3UN6A 1EYKA 2DSFA 1A54A 4H5GA 2UVGA 3OENA 2Y7KA 1HSEA 3BFUA 3T0JA 5A5XA 1B4ZA 2O69A 5H8FB 2Y5LA 3KC0A 1ZMGA 2NOOA 4AB5A 2XWOA 5FHOA 1DCUA 1OLCA 5FHMA 5IZ1A 3PD9A 2ONSA 2ZNTA 1XVXA 3C9HA 3HHGA 3ODBA 1QKAA 3RGYA 3LBSA 3MAMA 3B7DA 3MVWA 4DI4B 4C1UA 4MMPA 3CG3A 2O1LA 3CSGA 2HZLA 1URGA 4F2OA 4BDOA 5LOMA 3I6VA 4IY5A 3RN8A 1VDWA 1NH8A 4G8HA 1UIUA 1XS5A 1D3KA 5DTBA 3V8XB 1VFEA 3VVDA 1SQYA 3SEXA 2DWIA 5K2YA 3F11A 4DE8A 2XXHA 4FIMA 2VPNA 2VD2A 2B65A 5IM2A 4GRKA 4L17A 4XXUA 4IY6A 1B5HA 5ET7A 1MY3A 3S2VA 3TCGA 1G0HA 4IO7A 1LBYA 1MPBA 1N84A 2GHBA 2ONRA 1NV2A 1ZIUA 1GTKA 1DOTA 1NV6A 3BKIB 3RUMA 3W9WA 1ATGA 1NFTA 1MQHA 4F1VA 1D9VA 2G93A 1AIVA 3EPEA 1DSNA 2PCRA 2XXWA 4GL8A 3BBRA 1PBPA 4LUBA 4JWYA 3U92A 1EZPA 4NX1A 1AMFA 2F6GA 4NG7A 4U2RA 1P99A 4HXVA 3TTRA 4KYSA 3O6GA 4NTLA 1FQAA 2OCUA 5I2NA 3B6QA 4TLMB 2Q8MA 4H45A 4ESXA 5HPQA 4LN5A 2OX3A 3FVNA 2O7IA 5T3JA 2ZYKA 1FPFA 3FASA 2V3UA 4OVQA 5H8NA 4M4DA 2WEFA 2XXUA 4LONB 4ZEBA 2Y7WA 2RQFA 1SVXB 5DVFA 1LBXA 2O68A 4WEPA 2UYEA 3MP6A 3MPKA 5CI5A 2R71A 2PYYA 4N4UA 3E8WA 5A5XB 2F7CA 1Y4CA 2F36A 2QFLA 3T93B 2OK2A 2ABHA 4IR8A 2P3NA 3SETA 3AOTA 2RC8A 2RC9A 1OVBA 1T0KA 2H9BA 1N76A 4JB7A 5EHSA 3SDFA 4ELRA 2I0CA 1SDXA 2X7PA 1BK4A 5ICQA 1VE4A 3KZGA 5ESYA 5M2VA 5F24A 3H6VA 5CBRA 1KWHA 2PBWA 4PFUA 1MY2A 4QSDA 1B52A 4ND9A 4MEVA 4KYDA 4YAHX 5CMKA 3CR9A 1N0TA 4GOTA 4R2FA 2V3QA 2H99A 4HE1A 3MZ1A 4YB6A 3N5LA 3IFAA 3PMVA 3AOSA 1GR2A 5IGAA 2QVRA 4ZZEA 2XX9A 1BLFA 1NNPA 4R73A 4FORA 4OQOA 2GH9A 2Y7PA 1Q35A 1FBPA 4X8RA 3K02A 3ONMA 5EYGA 1P1NA 2DE4A 1Q9DA 2JJKA 4MCOA 1FPBA 3B50A 5EYHA 3OO6A 4ONYA 3FXBA 3MW0A 2OBDA 3U72A 4EQ9A 4GX4A 3VXCA 1YCJA 1XVYA 1POTA 1FW0A 3H6WA 4JWOA 2Y7IA 4G77A 3FV1A 2R9JA 2DWJA 1USYH 2A5TA 4NHBA 4BDQA 1NKXA 4KFQA 1WVJA 5CC2A 1FPDA 1SW4A 2F8DA 2ZYOA 1Y9UA 1XC1A 2I3WA 4O3AA 1IITA 2Q2AA 5ET8A 3V89B 2Y5KA 3PPPA 1MQDA 2HCAA 2R8TA 3K1MA 4MNPA 3MVZA 2RF1A 4PF6A 2XXIA 1FBDA 4ISUA 4WKMA 3SERA 2XWKA 1LB9A 4RK2A 3C4MA 1D4NA 2O1MA 4HCYA 4O3CA 2YPNA 3HV1A 3EHTA 1YZ0A 3IOTA 1BKAA 3JV9A 5TPAB 4F1YA 3HN0A 1DK4A 4PGPA 3OSQA 2QRYA 3D1RA 3KGCA 3C36A 2B3FA 3FUZA 5F7VA 4NWDA 4DLDA 2VOZA 4OERA 4PDHA 2DE2A 2QS3A 4DIGA 3Q26A 4P9KA 1LAXA 1NMUA 4YKIA 2RCAA 4P56A 2XXRA 3B6WA 2PFYA 4C0RA 2Q8JA 1TFDA 5EYFA 1A99A 1Q1KA 3IO6A 5I7LA 2REJA 4MBPA 5CMCA 3KN3A 4BDNA 1FQFA 3AXFA 1EYIA 4LZ8A 3PPRA 1MDQA 3TQWA 1LCFA 2V3TA 1A55A 2UVIA 4PE3A 1NV4A 3KFMA 2HHMA 1FPJA 3H6UA 3QAXA 3TQLA 3TKDA 3OEKA 2WBDA 1LFHA 1NV1A 4YKPA 2XD3A 3E13X 4OENA 4KR5A 4FEBA 2ZNSA 2ALUA 4NQ8A 4KCCA 1NI9A 1B58A 1Z7NE 3PUZE 4ELOA 2YJPA 1LBWA 1B7UA 1INPA 3USDA 1IZ1A 3DP8A 5I7IA 2FIEA 2F35A 2ZXTA 1FTOA 2A5TB 4FATA 5H8QA 1O63A 3BIGA 5CRYA 2F5XA 3QYTA 3IJXB 1XHYA 3K00A 4N6DA 5ITPA 1JP4A 4OVTA 5EQ8A 4LQ5A 5B70A 1FQEA 4KI0E 1USYE 2XXKA 4U1ZA 4FEDA 4PDDA 3M8UA 3KN7A 3KSXA 3PMXA 3VLWA 2DVZA 1B3LA 1FPEA 2ZZXA 4PFTA 4LA9A 1IIWA 3UORA 4GWSA 3FJMA 1XI6A 3FATA 1GVCA 3VFJA 1CNQA 1EYJA 3D4CA 4U1OA 5I5PA 3TTMA 1MM7A 3MSTA 1TWYA 2PMSA 1MH3A 1ZTYA 2Z22A 2O6AA 3UIFA 2XXVA 4G8MA 1NUXA 3SEWA 1UIVA 4H8JA 4EDPA 3T96B 4N81A 4MHFA 4X1BA 2DWHA 4PFRA 1Y3PA 4JDFA 2RC7A 4GIZA 3FZVA 4PFBA 3K6UA 4QFLA 2UYFA 1YYZA 3Q27A 3T9UA 4DDDA 3IK6B 4R6HA 3QMFA 4H1XA 4X48A 2ONKE 1HSLA 4OFJA 2CEYA 4NF5B 4PFYA 2P1SA 3KG2A 1D9QA 3O97A 4KQPA 2YLNA 3UK4A 2DWAA 3HO7A 5I7KA 2OJTA 3RPWA 4EUOA 2B4LA 5JTYA 2ZZVA 3SEYA 4YB5A 3IOUA 3MC2A 4NGUA 5BUUA 2XXXA 4YKKA 2QVUA 5H8QB 1B9JA 4XF5A 3O9PA 3RT6B 3LC8A 4F3BA 3KN8A 2V25A 3MP1A 3VLVA 4PC9A 4R75A 1NV3A 3HFUA 2HAUA 4OESA 1LCTA 3FXRA 3K1NA 3G3HA 2BJJX 4ELQA 2DE3A 3PU5A 3MPLA 1SD3A 2F97A 3K4UA 4XEQA 4GL0A 1B51A 3TTLA 5ELVA 2GFEA 3QUFA 3DLNA 4ZE9A 4RA1A 3R26A 3L6IA 1PB7A 4RY1A 4GWZA 3QK6A 5I57A 2E0SA 4RNSA 4I1DA 5TP9A 4PFIA 1MQGA 3SKPA 4NAPA 4GD5A 4GX3A 1NNFA 4EF2A 1LBBA 2H4IA 3FVGA 2OWSA 4F3SA 3S9LC 1MPCA 2F3DA 5IZZA 1USVB 1MXWA 4YMBA 1UQWA 4JWXA 1SYHA 1FJ6A 4XKPA 4G8NA 3OEMA 2ZNUA 1ZLQA 3CFLA 1S7YA 1M5CA 3K6XA 1WODA 4H8IA 1B3EA 3R6UA 4N6KA 2Y84A 5I2KA 3ZKLA 1KA0A 4G61A 1IMAA 1QW0A 2QS4A 3LV0A 3ZKKA 3CFZA 3ZPMA 1FPLA 2Q74A 4P47A 4F39A 1MRPA 3UV1A 3A3UA 1SI0A 4XIGQ 3MWBA 2Q89A 4OMBA 3PMWA 5I56B 4TOZA 5JTYB 4QSEA 2P0SA 4I62A 1SBPA 2CZHA 2I48A 2XXYA 1N04A 4JBZA 1N7WA 3R7XA 4E0XA 3H03A 3IB1A 2QMWA 3K1PA 2I0BA 4I3EA 3G3KA 1OLAA 5KDTA 4OVSA 3RNNA 4MLVA 2GQ1A 1QUKA 1NUWA 3DM0A 5HM4B 4R6YA 2F6PA 2AL5A 2F7AA 4IO6A 4JSDA 4P3LA 4PAKA 2OZZA 4MX6A 4BDRA 2P3VA 1IMDA 3H7MA 3UP9A 3ISPA 5B7DA 1JVXA 1OQHA 3VLUA 3RLFE 2FNCA 5DVIA 4RXLA 3NOHA 4MFIA 1JEUA 3K6WA 1TFAA 3W15C 2F34A 5I7JA 1FRPA 3QSLA 4G0SA 2QSXA 1CB6A 4YB7A 5H8HA 5I57B 4OTEA 2ZZWA 5TP9B 2VGQA 3U8QA 3T66A 4HW8A 1MY1A 5DW8A 3CSBA 1B7HA 5CMBA 1MXVA 3VVEA 2M8CA 3T9HB 4Z0IA 3PD8A 1BP1A 3H6TA 4OEUA 4KHZE 4JVDA 1H76A 3EN3A 1MXZA 1A8EA 4ZECA 3KC1A 1Z7ME 1A40A 3ILTB 1FBHA 1MDP1 3E8TA 4GWWA 4DCXA 2CZKA 4ZDMA 5I2KB 1YAEA 3IR1A 2FBPA 1MQIA 2X26A 4IGTA 4G68A 3MUQA 3PUXE 3Q29A 1YTVA 2Z8EA 1SI1A 1B32A 1USUB 3IFCA 2XD2A 3ZSFA 4N13A 2PT2A 5ET6A 3E79A 3TAJA 1FSAA 4NF0A 1R1NA 5I2NB 4AQ4A 1QUIA 1AL3A 3MZBA 2O51A 5AA4A 1JVYA 2DP8A 3T9VA 1Y20A 1QVSA 2RCKA 4OANA 3ZS6A 1B5JA 1RYOA 5KDTB 1PDAA 3OMBA 4O7IA 3G7WA 5H8NB 1B5IA 2FHYA 5F1QA 3A3CA 4IO5A 1MS7A 2QPQA 2WYPA 2XWVA 4UA8A 5HBCA 2Q88A 2XX8A 4HE0A 1PC3A 4DI3D 4KYEA 2QS1A 3RT8A 5DYHA 3K0VA 2V93A 5KCJA 1FBCA 1LAGE 2KQZA 4F18A 4BLAA 4U21A 1DTGA 5L9SA 3VVFA 4H65A 2HAVA 1NUYA 3A29A 2P2AA 2QS2A 3TMGA 5J16A 4I3YA 1UTBA 4KPTA 4PBHA 2IA4A 4H67A 4EXKA 2I4BA 1FBFA 1URDA 3GZGA 2I6EA 2NXOA 1BP5A 3TZAA 3LSLA 1BTJA 3H4ZA 3FXQA 3GYYA 2O7UA 4OZ9A 4FE8A 3KBZA 2KLFA 3WAFA 3IORA 4EQ7A 2QL3A 5ISUA 4K3FA 4X1DA 3QUJA 1EU8A 4QXDA 4E0WA 1PEBA 3VDFA 4PTKA 4YMAA 1POY1
chains in the Genus database with same CATH topology
1ZU0A 5AA1A 5CBSA 4HS7A 1II5A 1ANFA 4G68B 4M4GA 2FA7A 3KOSA 3JYRA 1P1OA 1LGBC 3D4GA 3QXMA 4LVQA 3RQTA 1DTZA 3KBRA 1N7XA 3OO8A 2Z8FA 1UTHA 4HTGA 4EWSA 2DVCA 3N6UA 2D21A 2I49A 4I9DA 4LZ7A 3E3KA 1Y1MA 1S9TA 4NF4A 4F1UA 1B6HA 1LB8A 1URSA 4OWDA 3GLBA 1PB8A 3G3IA 2B3BA 1EZOA 5CMMA 1PB9A 3RTFB 1NL5A 3PPNA 2H5YA 1TXFA 5BWJA 1A7LA 5DT6A 3Q25A 3IX1A 5IAIA 3FJGA 3MJNA 1BIYA 2F78A 3FXUA 2H98A 4BDMA 5KCJB 4IO2A 1OQGA 1D9YA 3RTWB 3MQ9A 3IJOB 1GGGA 1OVTA 3TTNA 1B0LA 3PUWE 3PGFA 3IAZA 4ZEKA 3FV2A 1M5EA 2IEEA 2HFBA 4NWCA 4EF1A 3TUSA 5AA3A 4R74A 2DXYA 1J1NA 1P1QA 3GBAA 2XXQA 3O28A 2AIXA 1RKMA 3OSRA 3L6GA 3OELA 1LAHE 2I4CA 3C31A 1IXCA 3S4UA 4YZZA 3SEUA 4KCDA 3HHFA 1L5TA 2DXRA 1B3GA 2I58A 1UTHB 4R2BA 5AA2A 1B3HA 5IKBA 4ZEFA 4DXBA 4NF4B 3C34A 3DELB 4GWOA 5KZTA 2PX1A 2REGA 4JSOA 3FVKA 1LLSA 4R9GA 3WAEA 4F22A 2QJEA 3DP4A 2NWJA 3VV5A 1P1UA 3OO9A 1B4HA 4Q8RA 3N72A 1R6ZA 3HCQA 1Y3NA 4POXA 2Q2CA 4WEDA 3E4RA 2UVHA 1MM6A 4NMYA 1JEVA 4Q0CA 3CFXA 3O29A 1YPNA 2F7BA 2DOJA 1B3FA 3DP6A 3TEPA 3S9EA 1JQFA 3M3KA 3C33A 4GLIA 3N26A 4QFKA 4GXSB 2OWTA 1US4A 3IB2A 2Q9TA 4LQ2A 1I6BA 5DEXA 2PT1A 3O2AA 4RPNA 1ELJA 3RY3A 1IEJA 3CRBA 2FYIA 1H45A 4IB2A 1MH4A 5ITOA 3UGWA 3V5AA 4FECA 4ZZAA 4AB6A 1P1WA 3THIA 1MXXA 2H25A 4ZE8A 4ELPA 3CVGA 1MY0A 1QKBA 3PPOA 1RYXA 3LUYA 3OD7A 4P0GA 2OLBA 3KJTA 4GXAA 4OEVA 4NF8A 3IL1B 5AA2B 2DQVA 2HXWA 4IO4A 3K01A 5I84A 1Y4TA 3L6HA 2NUVA 2ZYNA 1JW1A 5ICTA 4MLQA 4ZEDA 1F9BA 1B0HA 4PE5B 2AL4A 3VE1B 1ZBMA 1XOCA 4NEDA 3IO4A 4EXLA 2PVUA 4I8CA 4QFPA 4Q5TA 2D3IA 2G29A 3TYHA 5AA2D 4DXCA 3TCHA 3GXAA 4Q30B 4G4PA 1B2HA 4QRZA 3HSTA 3Q28A 1M5BA 2HEUA 4GFRA 4KGHA 1ZJLA 4QFNA 3CG1A 2W7YA 3PUYE 4DXUA 1SW5A 3KOTA 1FQDA 2QMXA 3SESA 2E1SA 4TQUQ 2D5WA 3U1OA 5DEXB 5TPAA 2RCBA 4PP0A 1B05A 3FVOA 1PBQA 2XHDA 5I59A 3A1ZA 4LP2B 4MH5A 1LSTA 1EZ9A 4XKNA 1TT1A 1FTMA 4N07A 3KEIA 3C35A 1EWFA 3LR1A 3W9VA 1O7TA 3H3GA 1JW4A 3S9MC 3IOWA 1GV8A 1ZKBA 3E9XA 2GHAA 1VR5A 4C1TA 3G3GA 4F29A 3S9NC 1FCKA 4FAJA 3ILUB 4BDLA 4GVOA 2VHAA 4KGOA 3PV0E 4DZ1A 3EQ1A 3TPAA 3HPIA 4NF8B 5JK4A 1FTLA 2UVJA 3MBPA 4ECFA 1H44A 1VSOA 1B46A 1DPEA 3OXNA 4R9FA 1IXGA 1JETA 1NH7A 1JW5A 2ZMBA 5FHNA 2ZYMA 1Y3QA 5H8SA 4JXIA 2NVUB 5EHMA 2WKYA 4H0WA 4PETA 4F2AA 2HQ0A 1I6AA 4H6DA 1DMBA 4QF9A 1SW1A 2Y7RA 2X7QA 4F3PA 4LATA 1B40A 4DCYA 2CMOA 1IUDA 4OVJA 4R72A 4M1VA 4NF6A 4NE4A 4ZS9A 4LZ5A 2UXAA 1B7ZA 4ESWA 5L8DA 5JEIA 2DYXA 3N94A 1WDNA 2HZKA 2RKMA 5H8HB 4F2QA 3V83A 3I5OA 4OHNA 3O66A 3MP8A 1AOVA 1IXHA 1FTJA 4RK9A 2ESNA 3K2DA 3IB0A 2A5SA 3O6HA 3H06B 4G68C 4H5FA 3P7IA 1MXUA 4WXJA 3FIRA 1VFDA 5I58A 5I59B 4N6PA 4F3GA 4U4XA 5K2XA 1JNFA 1XT8A 4RJZA 4RYAA 4O3BA 1H43A 3FGSA 3MVYA 4YICA 1FTKA 3ECRA 4P0IA 4U4SA 4F31B 3GBBA 1S50A 3C32A 4P11A 4EQBA 3PPQA 5CM6A 5L9MA 3M3FA 2I3VA 1AH5A 1QJMA 1B1HA 4THIA 3EF7A 4IO3A 3LSFB 1M5FA 3EHSA 3CIJA 4NF5A 4OETA 2VD3A 3LSXA 2R6GE 1FQCA 1Y1ZA 2CZLA 3I3VA 3PUVE 5AA4B 4UACA 3IOVA 1A8FA 3T9XB 1N3XA 1I69A 4YU0A 4PFWA 1SW2A 5AE4A 2LAOA 4RPOA 4ZEIA 4FJPA 5TU0A 2DS9A 2XX7A 2Z23A 3OOAA 3KJ7A 1EH3A 3O6IA 1OMPA 4NF6B 1H3DA 4OFOA 4QFOA 1FQBA 4R6KA 5H8FA 3TTKA 1UTBB 1N3WA 3VXBA 5FTIA 3G3JA 4QHQA 2XXTA 1DPPA 3CI8A 4U22A 3SEVA 2THIA 4MF3A 1LFIA 3G3FA 1LAFE 3EHUA 5DVJA 3A09A 2VP1A 3TODA 3BFTA 2GRVA 1MXYA 1MG1A 1QUJA 2AYSA 2RINA 1O64A 5I58B 4G2ZA 4U23A 1MY4A 4OYVA 1M5DA 1R9LA 5FTHA 1QULA 1IXIA 3QIMA 3B6TA 3TDJA 2V84A 5L9OA 1R9QA 3MZ9A 1MPDA 1OIBA 3UA8A 3U93A 3TFLA 4GF8A 1LBCA 4OFLA 1HSJA 3LSWA 1NNTA 4XKRA 4HCWA 4Z7EA 1B1XA 4X9TA 4OXVA 3M3LA 1I6QA 2OBGA 1CE2A 3FJ7A 3JZJA 2ANJA 1NNKA 3KSJA 3N6TA 1US5A 2XXPA 3U94A 3OO7A 1IQ7A 1MQJA 3TCFA 3T22A 3FD3A 3MVXA 1LFGA 5I56A 2Z8DA 4IGRA 4YKJA 1SYIA 2O84X 4XTCQ 4QSCA 4F19A 5J1DA 4GQOA 4TLLB 4POWA 4PQJA 3TELA 4XKQA 3K6VA 4KD5A 3UN6A 2DSFA 1A54A 4H5GA 2UVGA 3OENA 2Y7KA 1HSEA 3BFUA 5A5XA 1B4ZA 2O69A 5H8FB 1ZMGA 2NOOA 4AB5A 5FHOA 1OLCA 5FHMA 3PD9A 2ONSA 2ZNTA 1XVXA 3C9HA 3HHGA 3ODBA 1QKAA 3RGYA 3LBSA 3MAMA 3B7DA 3MVWA 4C1UA 3CG3A 2O1LA 3CSGA 2HZLA 1URGA 4F2OA 4BDOA 5LOMA 3I6VA 4IY5A 3RN8A 1NH8A 4G8HA 1UIUA 1XS5A 1D3KA 5DTBA 3V8XB 1VFEA 3VVDA 1SQYA 3SEXA 2DWIA 5K2YA 3F11A 4DE8A 2XXHA 4FIMA 2VD2A 2B65A 4GRKA 4L17A 4XXUA 4IY6A 1B5HA 1MY3A 3S2VA 3TCGA 4IO7A 1MPBA 1N84A 2GHBA 2ONRA 1ZIUA 1GTKA 1DOTA 3BKIB 3RUMA 3W9WA 1ATGA 1NFTA 1MQHA 4F1VA 1D9VA 2G93A 1AIVA 3EPEA 1DSNA 2XXWA 4GL8A 3BBRA 1PBPA 4LUBA 4JWYA 3U92A 1EZPA 1AMFA 2F6GA 4U2RA 1P99A 3TTRA 4KYSA 3O6GA 4NTLA 1FQAA 2OCUA 5I2NA 3B6QA 4TLMB 4ESXA 5HPQA 3FVNA 2O7IA 2ZYKA 3FASA 2V3UA 5H8NA 4M4DA 2XXUA 4LONB 4ZEBA 2Y7WA 2RQFA 1SVXB 5DVFA 2O68A 4WEPA 2UYEA 3MP6A 3MPKA 5CI5A 2R71A 2PYYA 3E8WA 5A5XB 2F7CA 1Y4CA 2F36A 3T93B 2OK2A 2ABHA 3SETA 3AOTA 2RC8A 2RC9A 1OVBA 1T0KA 2H9BA 1N76A 4JB7A 5EHSA 3SDFA 4ELRA 2I0CA 1SDXA 2X7PA 5ICQA 1VE4A 3KZGA 5M2VA 3H6VA 5CBRA 1KWHA 2PBWA 4PFUA 1MY2A 4QSDA 1B52A 4ND9A 4KYDA 4YAHX 5CMKA 3CR9A 1N0TA 4GOTA 4R2FA 2V3QA 2H99A 3MZ1A 4YB6A 3N5LA 3PMVA 3AOSA 1GR2A 4ZZEA 2XX9A 1BLFA 1NNPA 4R73A 4FORA 4OQOA 2GH9A 2Y7PA 1Q35A 3K02A 3ONMA 1P1NA 2DE4A 3OO6A 4ONYA 3MW0A 2OBDA 3U72A 4EQ9A 3VXCA 1YCJA 1XVYA 1POTA 1FW0A 3H6WA 4JWOA 2Y7IA 4G77A 3FV1A 2R9JA 2DWJA 1USYH 2A5TA 4BDQA 1NKXA 4KFQA 1WVJA 5CC2A 1SW4A 2F8DA 2ZYOA 1Y9UA 1XC1A 2I3WA 4O3AA 1IITA 2Q2AA 3V89B 3PPPA 1MQDA 2HCAA 3K1MA 3MVZA 2RF1A 2XXIA 4ISUA 4WKMA 3SERA 1LB9A 4RK2A 3C4MA 1D4NA 2O1MA 4HCYA 4O3CA 2YPNA 3HV1A 3EHTA 3IOTA 1BKAA 3JV9A 5TPAB 4F1YA 3HN0A 3OSQA 2QRYA 3KGCA 3C36A 2B3FA 3FUZA 5F7VA 4NWDA 4DLDA 2VOZA 4OERA 2DE2A 2QS3A 4DIGA 3Q26A 1LAXA 1NMUA 4YKIA 2RCAA 2XXRA 3B6WA 4C0RA 2Q8JA 1TFDA 5EYFA 1A99A 1Q1KA 3IO6A 5I7LA 2REJA 4MBPA 5CMCA 3KN3A 4BDNA 1FQFA 3AXFA 4LZ8A 3PPRA 1MDQA 3TQWA 1LCFA 2V3TA 1A55A 2UVIA 3KFMA 3H6UA 3QAXA 3TQLA 3TKDA 3OEKA 1LFHA 4YKPA 2XD3A 3E13X 4OENA 4KR5A 4FEBA 2ZNSA 2ALUA 4KCCA 1B58A 1Z7NE 3PUZE 4ELOA 2YJPA 1B7UA 3USDA 1IZ1A 3DP8A 2F35A 2ZXTA 1FTOA 2A5TB 4FATA 5H8QA 1O63A 5CRYA 2F5XA 3QYTA 3IJXB 1XHYA 3K00A 5ITPA 4LQ5A 5B70A 1FQEA 4KI0E 1USYE 4U1ZA 4FEDA 3M8UA 3KN7A 3KSXA 3PMXA 3VLWA 2DVZA 1B3LA 4PFTA 4LA9A 1IIWA 3UORA 3FJMA 3FATA 1GVCA 3VFJA 3D4CA 4U1OA 3TTMA 1MM7A 1TWYA 2PMSA 1MH3A 1ZTYA 2Z22A 2O6AA 3UIFA 2XXVA 4G8MA 3SEWA 1UIVA 4H8JA 4EDPA 3T96B 4X1BA 2DWHA 1Y3PA 4JDFA 2RC7A 4GIZA 3FZVA 3K6UA 4QFLA 2UYFA 3Q27A 3T9UA 4DDDA 3IK6B 4R6HA 4H1XA 4X48A 2ONKE 1HSLA 4OFJA 4NF5B 4PFYA 2P1SA 3KG2A 3O97A 4KQPA 2YLNA 3UK4A 2DWAA 3HO7A 5I7KA 2OJTA 3RPWA 4EUOA 5JTYA 3SEYA 4YB5A 3IOUA 3MC2A 5BUUA 2XXXA 4YKKA 5H8QB 1B9JA 3O9PA 3RT6B 3LC8A 4F3BA 3KN8A 2V25A 3MP1A 3VLVA 4R75A 2HAUA 4OESA 1LCTA 3FXRA 3K1NA 3G3HA 2BJJX 4ELQA 2DE3A 3PU5A 3MPLA 1SD3A 2F97A 3TTLA 3K4UA 4GL0A 1B51A 5ELVA 2GFEA 3QUFA 3DLNA 4ZE9A 4RA1A 3R26A 3L6IA 1PB7A 4RY1A 3QK6A 5I57A 2E0SA 4RNSA 4I1DA 5TP9A 1MQGA 3SKPA 4GD5A 1NNFA 4EF2A 1LBBA 2H4IA 3FVGA 2OWSA 4F3SA 3S9LC 1MPCA 1USVB 1MXWA 4YMBA 1UQWA 4JWXA 1SYHA 4XKPA 4G8NA 3OEMA 2ZNUA 1ZLQA 3CFLA 1S7YA 1M5CA 3K6XA 1WODA 4H8IA 1B3EA 3R6UA 2Y84A 5I2KA 3ZKLA 1QW0A 2QS4A 3ZKKA 3CFZA 3ZPMA 4F39A 1MRPA 3UV1A 3A3UA 1SI0A 4XIGQ 3MWBA 2Q89A 4OMBA 3PMWA 5I56B 4TOZA 5JTYB 4QSEA 2P0SA 4I62A 1SBPA 2I48A 2XXYA 1N04A 4JBZA 1N7WA 3R7XA 4E0XA 3H03A 3IB1A 2QMWA 3K1PA 2I0BA 3G3KA 1OLAA 5KDTA 3RNNA 4MLVA 1QUKA 3DM0A 5HM4B 4R6YA 2F6PA 2AL5A 2F7AA 4IO6A 4JSDA 2OZZA 4BDRA 3H7MA 3UP9A 5B7DA 1JVXA 1OQHA 3VLUA 3RLFE 2FNCA 5DVIA 4RXLA 4MFIA 1JEUA 3K6WA 1TFAA 3W15C 2F34A 5I7JA 3QSLA 4G0SA 2QSXA 1CB6A 4YB7A 5H8HA 5I57B 4OTEA 5TP9B 2VGQA 3U8QA 3T66A 4HW8A 1MY1A 3CSBA 1B7HA 5CMBA 3VVEA 1MXVA 2M8CA 3T9HB 4Z0IA 3PD8A 1BP1A 3H6TA 4OEUA 4KHZE 1H76A 3EN3A 1MXZA 1A8EA 4ZECA 1Z7ME 1A40A 3ILTB 1MDP1 3E8TA 4DCXA 4ZDMA 5I2KB 1YAEA 3IR1A 1MQIA 2X26A 4IGTA 4G68A 3MUQA 3PUXE 3Q29A 1YTVA 2Z8EA 1SI1A 1B32A 1USUB 2XD2A 3ZSFA 4N13A 2PT2A 3TAJA 1R1NA 5I2NB 4AQ4A 1QUIA 1AL3A 3MZBA 2O51A 5AA4A 1JVYA 2DP8A 3T9VA 1Y20A 1QVSA 2RCKA 3ZS6A 1B5JA 1RYOA 5KDTB 1PDAA 3OMBA 3G7WA 5H8NB 1B5IA 5F1QA 3A3CA 4IO5A 1MS7A 2QPQA 4UA8A 5HBCA 2Q88A 2XX8A 1PC3A 4KYEA 2QS1A 3RT8A 5DYHA 3K0VA 2V93A 5KCJA 1LAGE 4F18A 4BLAA 4U21A 1DTGA 5L9SA 3VVFA 4H65A 2HAVA 2P2AA 2QS2A 3TMGA 1UTBA 4KPTA 2IA4A 4H67A 4EXKA 2I4BA 1URDA 3GZGA 2I6EA 2NXOA 1BP5A 3TZAA 3LSLA 1BTJA 3H4ZA 3FXQA 2O7UA 4OZ9A 4FE8A 2KLFA 3WAFA 3IORA 4EQ7A 2QL3A 5ISUA 4K3FA 4X1DA 3QUJA 1EU8A 4E0WA 1PEBA 3VDFA 4YMAA 1POY1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZU0 A;  5AA1 A;  5CBS A;  4HS7 A;  1II5 A;  1ANF A;  4G68 B;  4M4G A;  2FA7 A;  3KOS A;  3JYR A;  1P1O A;  1LGB C;  3D4G A;  3QXM A;  4LVQ A;  3RQT A;  1DTZ A;  3KBR A;  1N7X A;  3OO8 A;  2Z8F A;  1UTH A;  4HTG A;  2DVC A;  3N6U A;  2D21 A;  2I49 A;  4I9D A;  4LZ7 A;  3E3K A;  1Y1M A;  1S9T A;  4NF4 A;  4F1U A;  1B6H A;  1LB8 A;  1URS A;  4OWD A;  3GLB A;  1PB8 A;  3G3I A;  2B3B A;  1EZO A;  5CMM A;  1PB9 A;  3RTF B;  1NL5 A;  3PPN A;  2H5Y A;  1TXF A;  5BWJ A;  1A7L A;  5DT6 A;  3Q25 A;  3IX1 A;  5IAI A;  3FJG A;  3MJN A;  1BIY A;  2F78 A;  3FXU A;  2H98 A;  4BDM A;  5KCJ B;  4IO2 A;  1OQG A;  1D9Y A;  3RTW B;  3MQ9 A;  3IJO B;  1GGG A;  1OVT A;  3TTN A;  1B0L A;  3PUW E;  3PGF A;  3IAZ A;  4ZEK A;  3FV2 A;  1M5E A;  2IEE A;  2HFB A;  4NWC A;  4EF1 A;  3TUS A;  5AA3 A;  4R74 A;  2DXY A;  1J1N A;  1P1Q A;  3GBA A;  2XXQ A;  3O28 A;  2AIX A;  1RKM A;  3OSR A;  3L6G A;  3OEL A;  1LAH E;  2I4C A;  3C31 A;  1IXC A;  3S4U A;  4YZZ A;  3SEU A;  4KCD A;  3HHF A;  1L5T A;  2DXR A;  1B3G A;  2I58 A;  1UTH B;  4R2B A;  5AA2 A;  1B3H A;  5IKB A;  4ZEF A;  4DXB A;  4NF4 B;  3C34 A;  3DEL B;  4GWO A;  5KZT A;  2PX1 A;  2REG A;  4JSO A;  3FVK A;  1LLS A;  4R9G A;  3WAE A;  4F22 A;  2QJE A;  3DP4 A;  2NWJ A;  3VV5 A;  1P1U A;  3OO9 A;  1B4H A;  4Q8R A;  1R6Z A;  3HCQ A;  1Y3N A;  4POX A;  2Q2C A;  4WED A;  3E4R A;  2UVH A;  1MM6 A;  4NMY A;  1JEV A;  4Q0C A;  3CFX A;  3O29 A;  1YPN A;  2F7B A;  2DOJ A;  1B3F A;  3DP6 A;  3TEP A;  3S9E A;  1JQF A;  3M3K A;  3C33 A;  4GLI A;  3N26 A;  4QFK A;  4GXS B;  2OWT A;  1US4 A;  3IB2 A;  2Q9T A;  4LQ2 A;  1I6B A;  5DEX A;  2PT1 A;  3O2A A;  4RPN A;  1ELJ A;  3RY3 A;  1IEJ A;  3CRB A;  2FYI A;  1H45 A;  4IB2 A;  1MH4 A;  5ITO A;  3UGW A;  3V5A A;  4FEC A;  4ZZA A;  4AB6 A;  1P1W A;  3THI A;  1MXX A;  2H25 A;  4ZE8 A;  4ELP A;  3CVG A;  1MY0 A;  1QKB A;  3PPO A;  1RYX A;  3LUY A;  3OD7 A;  4P0G A;  2OLB A;  3KJT A;  4GXA A;  4OEV A;  4NF8 A;  3IL1 B;  5AA2 B;  2DQV A;  2HXW A;  4IO4 A;  3K01 A;  5I84 A;  1Y4T A;  3L6H A;  2NUV A;  2ZYN A;  1JW1 A;  5ICT A;  4MLQ A;  4ZED A;  1F9B A;  1B0H A;  4PE5 B;  2AL4 A;  3VE1 B;  1ZBM A;  1XOC A;  4NED A;  3IO4 A;  4EXL A;  2PVU A;  4I8C A;  4QFP A;  4Q5T A;  2D3I A;  2G29 A;  3TYH A;  5AA2 D;  4DXC A;  3TCH A;  3GXA A;  4Q30 B;  4G4P A;  1B2H A;  4QRZ A;  3HST A;  3Q28 A;  1M5B A;  2HEU A;  4GFR A;  1ZJL A;  4QFN A;  3CG1 A;  2W7Y A;  3PUY E;  4DXU A;  1SW5 A;  3KOT A;  1FQD A;  2QMX A;  3SES A;  2E1S A;  4TQU Q;  2D5W A;  3U1O A;  5DEX B;  5TPA A;  2RCB A;  4PP0 A;  1B05 A;  3FVO A;  1PBQ A;  2XHD A;  5I59 A;  4LP2 B;  4MH5 A;  1LST A;  1EZ9 A;  4XKN A;  1TT1 A;  1FTM A;  4N07 A;  3KEI A;  3C35 A;  3LR1 A;  3W9V A;  1O7T A;  3H3G A;  1JW4 A;  3S9M C;  3IOW A;  1GV8 A;  1ZKB A;  3E9X A;  2GHA A;  1VR5 A;  4C1T A;  3G3G A;  4F29 A;  3S9N C;  1FCK A;  4FAJ A;  3ILU B;  4BDL A;  4GVO A;  2VHA A;  3PV0 E;  4DZ1 A;  3EQ1 A;  3TPA A;  3HPI A;  4NF8 B;  5JK4 A;  1FTL A;  2UVJ A;  3MBP A;  4ECF A;  1H44 A;  1VSO A;  1B46 A;  1DPE A;  3OXN A;  4R9F A;  1IXG A;  1JET A;  1NH7 A;  1JW5 A;  2ZMB A;  5FHN A;  2ZYM A;  1Y3Q A;  5H8S A;  4JXI A;  2NVU B;  5EHM A;  2WKY A;  4H0W A;  4PET A;  2HQ0 A;  1I6A A;  4H6D A;  1DMB A;  4QF9 A;  1SW1 A;  2Y7R A;  2X7Q A;  4F3P A;  4LAT A;  1B40 A;  4DCY A;  2CMO A;  1IUD A;  4OVJ A;  4R72 A;  4M1V A;  4NF6 A;  4NE4 A;  4ZS9 A;  4LZ5 A;  2UXA A;  1B7Z A;  4ESW A;  5L8D A;  5JEI A;  2DYX A;  3N94 A;  1WDN A;  2HZK A;  2RKM A;  5H8H B;  4F2Q A;  3V83 A;  3I5O A;  4OHN A;  3O66 A;  3MP8 A;  1AOV A;  1IXH A;  1FTJ A;  4RK9 A;  2ESN A;  3K2D A;  3IB0 A;  2A5S A;  3O6H A;  3H06 B;  4G68 C;  4H5F A;  3P7I A;  1MXU A;  4WXJ A;  3FIR A;  1VFD A;  5I58 A;  5I59 B;  4N6P A;  4F3G A;  4U4X A;  5K2X A;  1JNF A;  1XT8 A;  4RJZ A;  4RYA A;  4O3B A;  1H43 A;  3FGS A;  3MVY A;  4YIC A;  1FTK A;  3ECR A;  4P0I A;  4U4S A;  4F31 B;  3GBB A;  1S50 A;  3C32 A;  4P11 A;  4EQB A;  3PPQ A;  5CM6 A;  5L9M A;  3M3F A;  2I3V A;  1AH5 A;  1QJM A;  1B1H A;  4THI A;  3EF7 A;  4IO3 A;  3LSF B;  1M5F A;  3EHS A;  3CIJ A;  4NF5 A;  4OET A;  2VD3 A;  3LSX A;  2R6G E;  1FQC A;  1Y1Z A;  2CZL A;  3I3V A;  3PUV E;  5AA4 B;  4UAC A;  3IOV A;  1A8F A;  3T9X B;  1N3X A;  1I69 A;  4YU0 A;  4PFW A;  1SW2 A;  5AE4 A;  2LAO A;  4RPO A;  4ZEI A;  4FJP A;  5TU0 A;  2DS9 A;  2XX7 A;  2Z23 A;  3OOA A;  3KJ7 A;  1EH3 A;  3O6I A;  1OMP A;  4NF6 B;  1H3D A;  4OFO A;  4QFO A;  1FQB A;  4R6K A;  5H8F A;  3TTK A;  1UTB B;  1N3W A;  3VXB A;  5FTI A;  3G3J A;  4QHQ A;  2XXT A;  1DPP A;  3CI8 A;  4U22 A;  3SEV A;  2THI A;  4MF3 A;  1LFI A;  3G3F A;  1LAF E;  3EHU A;  5DVJ A;  3A09 A;  2VP1 A;  3TOD A;  3BFT A;  2GRV A;  1MXY A;  1MG1 A;  1QUJ A;  2AYS A;  2RIN A;  1O64 A;  5I58 B;  4G2Z A;  4U23 A;  1MY4 A;  4OYV A;  1M5D A;  1R9L A;  5FTH A;  1QUL A;  1IXI A;  3QIM A;  3B6T A;  3TDJ A;  2V84 A;  5L9O A;  1R9Q A;  3MZ9 A;  1MPD A;  1OIB A;  3UA8 A;  3U93 A;  3TFL A;  4GF8 A;  1LBC A;  4OFL A;  1HSJ A;  3LSW A;  1NNT A;  4XKR A;  4HCW A;  4Z7E A;  1B1X A;  4X9T A;  4OXV A;  3M3L A;  1I6Q A;  2OBG A;  1CE2 A;  3FJ7 A;  3JZJ A;  2ANJ A;  1NNK A;  3KSJ A;  3N6T A;  1US5 A;  2XXP A;  3U94 A;  3OO7 A;  1IQ7 A;  1MQJ A;  3TCF A;  3T22 A;  3FD3 A;  3MVX A;  1LFG A;  5I56 A;  2Z8D A;  4IGR A;  4YKJ A;  1SYI A;  2O84 X;  4XTC Q;  4QSC A;  4F19 A;  5J1D A;  4GQO A;  4TLL B;  4POW A;  4PQJ A;  3TEL A;  4XKQ A;  3K6V A;  4KD5 A;  3UN6 A;  2DSF A;  1A54 A;  4H5G A;  2UVG A;  3OEN A;  2Y7K A;  1HSE A;  3BFU A;  5A5X A;  1B4Z A;  2O69 A;  5H8F B;  1ZMG A;  2NOO A;  4AB5 A;  5FHO A;  1OLC A;  5FHM A;  3PD9 A;  2ONS A;  2ZNT A;  1XVX A;  3C9H A;  3HHG A;  3ODB A;  1QKA A;  3RGY A;  3LBS A;  3MAM A;  3B7D A;  3MVW A;  4C1U A;  3CG3 A;  2O1L A;  3CSG A;  2HZL A;  1URG A;  4F2O A;  4BDO A;  5LOM A;  3I6V A;  4IY5 A;  3RN8 A;  1NH8 A;  4G8H A;  1UIU A;  1XS5 A;  1D3K A;  5DTB A;  3V8X B;  1VFE A;  3VVD A;  1SQY A;  3SEX A;  2DWI A;  5K2Y A;  3F11 A;  4DE8 A;  2XXH A;  4FIM A;  2VD2 A;  2B65 A;  4GRK A;  4L17 A;  4XXU A;  4IY6 A;  1B5H A;  1MY3 A;  3S2V A;  3TCG A;  4IO7 A;  1MPB A;  1N84 A;  2GHB A;  2ONR A;  1ZIU A;  1GTK A;  1DOT A;  3BKI B;  3RUM A;  3W9W A;  1ATG A;  1NFT A;  1MQH A;  4F1V A;  1D9V A;  2G93 A;  1AIV A;  3EPE A;  1DSN A;  2XXW A;  4GL8 A;  3BBR A;  1PBP A;  4LUB A;  4JWY A;  3U92 A;  1EZP A;  1AMF A;  2F6G A;  4U2R A;  1P99 A;  3TTR A;  4KYS A;  3O6G A;  4NTL A;  1FQA A;  2OCU A;  5I2N A;  3B6Q A;  4TLM B;  4ESX A;  5HPQ A;  3FVN A;  2O7I A;  2ZYK A;  3FAS A;  2V3U A;  5H8N A;  2XXU A;  4LON B;  4ZEB A;  2Y7W A;  1SVX B;  5DVF A;  2O68 A;  4WEP A;  2UYE A;  3MP6 A;  3MPK A;  5CI5 A;  2R71 A;  2PYY A;  5A5X B;  2F7C A;  1Y4C A;  2F36 A;  3T93 B;  2OK2 A;  2ABH A;  3SET A;  2RC8 A;  2RC9 A;  1OVB A;  1T0K A;  2H9B A;  1N76 A;  4JB7 A;  5EHS A;  3SDF A;  4ELR A;  2I0C A;  1SDX A;  2X7P A;  5ICQ A;  1VE4 A;  3KZG A;  5M2V A;  3H6V A;  5CBR A;  1KWH A;  2PBW A;  4PFU A;  1MY2 A;  4QSD A;  1B52 A;  4ND9 A;  4KYD A;  4YAH X;  5CMK A;  3CR9 A;  1N0T A;  4GOT A;  4R2F A;  2V3Q A;  2H99 A;  3MZ1 A;  4YB6 A;  3N5L A;  3PMV A;  1GR2 A;  4ZZE A;  2XX9 A;  1BLF A;  1NNP A;  4R73 A;  4FOR A;  4OQO A;  2GH9 A;  2Y7P A;  1Q35 A;  3K02 A;  3ONM A;  1P1N A;  2DE4 A;  3OO6 A;  4ONY A;  3MW0 A;  3U72 A;  4EQ9 A;  3VXC A;  1YCJ A;  1XVY A;  1POT A;  1FW0 A;  3H6W A;  4JWO A;  2Y7I A;  4G77 A;  3FV1 A;  2R9J A;  2DWJ A;  1USY H;  2A5T A;  4BDQ A;  1NKX A;  4KFQ A;  1WVJ A;  5CC2 A;  1SW4 A;  2F8D A;  2ZYO A;  1Y9U A;  1XC1 A;  2I3W A;  4O3A A;  1IIT A;  2Q2A A;  3V89 B;  3PPP A;  1MQD A;  2HCA A;  3K1M A;  3MVZ A;  2RF1 A;  2XXI A;  4ISU A;  4WKM A;  3SER A;  1LB9 A;  4RK2 A;  3C4M A;  1D4N A;  2O1M A;  4HCY A;  4O3C A;  2YPN A;  3HV1 A;  3EHT A;  3IOT A;  1BKA A;  3JV9 A;  5TPA B;  4F1Y A;  3HN0 A;  3OSQ A;  2QRY A;  3KGC A;  3C36 A;  2B3F A;  3FUZ A;  5F7V A;  4NWD A;  4DLD A;  2VOZ A;  4OER A;  2DE2 A;  2QS3 A;  4DIG A;  3Q26 A;  1LAX A;  1NMU A;  4YKI A;  2RCA A;  2XXR A;  3B6W A;  4C0R A;  2Q8J A;  1TFD A;  5EYF A;  1A99 A;  1Q1K A;  3IO6 A;  2REJ A;  4MBP A;  5CMC A;  3KN3 A;  4BDN A;  1FQF A;  3AXF A;  4LZ8 A;  3PPR A;  1MDQ A;  3TQW A;  1LCF A;  2V3T A;  1A55 A;  2UVI A;  3KFM A;  3H6U A;  3QAX A;  3TQL A;  3TKD A;  3OEK A;  1LFH A;  4YKP A;  2XD3 A;  3E13 X;  4OEN A;  4KR5 A;  4FEB A;  2ZNS A;  2ALU A;  4KCC A;  1B58 A;  1Z7N E;  3PUZ E;  4ELO A;  2YJP A;  1B7U A;  3USD A;  1IZ1 A;  3DP8 A;  2F35 A;  2ZXT A;  1FTO A;  2A5T B;  4FAT A;  5H8Q A;  1O63 A;  5CRY A;  2F5X A;  3QYT A;  3IJX B;  1XHY A;  3K00 A;  5ITP A;  4LQ5 A;  5B70 A;  1FQE A;  4KI0 E;  1USY E;  4U1Z A;  4FED A;  3M8U A;  3KN7 A;  3KSX A;  3PMX A;  3VLW A;  2DVZ A;  1B3L A;  4PFT A;  4LA9 A;  1IIW A;  3UOR A;  3FJM A;  3FAT A;  1GVC A;  3VFJ A;  3D4C A;  4U1O A;  3TTM A;  1MM7 A;  1TWY A;  2PMS A;  1MH3 A;  1ZTY A;  2Z22 A;  2O6A A;  3UIF A;  2XXV A;  4G8M A;  3SEW A;  1UIV A;  4H8J A;  4EDP A;  3T96 B;  4X1B A;  2DWH A;  1Y3P A;  4JDF A;  2RC7 A;  4GIZ A;  3FZV A;  3K6U A;  4QFL A;  2UYF A;  3Q27 A;  3T9U A;  4DDD A;  3IK6 B;  4R6H A;  4H1X A;  4X48 A;  2ONK E;  1HSL A;  4OFJ A;  4NF5 B;  4PFY A;  2P1S A;  3KG2 A;  3O97 A;  4KQP A;  2YLN A;  3UK4 A;  2DWA A;  3HO7 A;  2OJT A;  3RPW A;  4EUO A;  5JTY A;  3SEY A;  4YB5 A;  3IOU A;  3MC2 A;  5BUU A;  2XXX A;  4YKK A;  5H8Q B;  1B9J A;  3O9P A;  3RT6 B;  3LC8 A;  4F3B A;  3KN8 A;  2V25 A;  3MP1 A;  3VLV A;  4R75 A;  2HAU A;  4OES A;  1LCT A;  3FXR A;  3K1N A;  3G3H A;  2BJJ X;  4ELQ A;  2DE3 A;  3PU5 A;  3MPL A;  1SD3 A;  2F97 A;  3TTL A;  3K4U A;  4GL0 A;  1B51 A;  5ELV A;  2GFE A;  3QUF A;  3DLN A;  4ZE9 A;  4RA1 A;  3R26 A;  1PB7 A;  4RY1 A;  3QK6 A;  5I57 A;  2E0S A;  4RNS A;  4I1D A;  5TP9 A;  1MQG A;  3SKP A;  4GD5 A;  1NNF A;  4EF2 A;  1LBB A;  2H4I A;  3FVG A;  2OWS A;  4F3S A;  3S9L C;  1MPC A;  1MXW A;  4YMB A;  1UQW A;  4JWX A;  1SYH A;  4XKP A;  4G8N A;  3OEM A;  2ZNU A;  1ZLQ A;  3CFL A;  1S7Y A;  1M5C A;  3K6X A;  1WOD A;  4H8I A;  1B3E A;  3R6U A;  2Y84 A;  5I2K A;  3ZKL A;  1QW0 A;  2QS4 A;  3ZKK A;  3CFZ A;  4F39 A;  1MRP A;  3UV1 A;  3A3U A;  1SI0 A;  4XIG Q;  3MWB A;  2Q89 A;  4OMB A;  3PMW A;  5I56 B;  4TOZ A;  5JTY B;  4QSE A;  2P0S A;  4I62 A;  1SBP A;  2I48 A;  2XXY A;  1N04 A;  4JBZ A;  1N7W A;  3R7X A;  4E0X A;  3H03 A;  3IB1 A;  2QMW A;  3K1P A;  2I0B A;  3G3K A;  1OLA A;  5KDT A;  3RNN A;  4MLV A;  1QUK A;  3DM0 A;  5HM4 B;  4R6Y A;  2F6P A;  2AL5 A;  2F7A A;  4IO6 A;  4JSD A;  2OZZ A;  4BDR A;  3H7M A;  3UP9 A;  5B7D A;  1JVX A;  1OQH A;  3VLU A;  3RLF E;  2FNC A;  5DVI A;  4RXL A;  4MFI A;  1JEU A;  3K6W A;  1TFA A;  3W15 C;  2F34 A;  3QSL A;  2QSX A;  1CB6 A;  4YB7 A;  5H8H A;  5I57 B;  4OTE A;  5TP9 B;  2VGQ A;  3U8Q A;  3T66 A;  4HW8 A;  1MY1 A;  3CSB A;  1B7H A;  5CMB A;  3VVE A;  1MXV A;  2M8C A;  3T9H B;  4Z0I A;  3PD8 A;  3H6T A;  4OEU A;  4KHZ E;  1H76 A;  3EN3 A;  1MXZ A;  1A8E A;  4ZEC A;  1Z7M E;  1A40 A;  3ILT B;  1MDP 1;  4DCX A;  4ZDM A;  5I2K B;  1YAE A;  3IR1 A;  1MQI A;  2X26 A;  4IGT A;  4G68 A;  3MUQ A;  3PUX E;  3Q29 A;  1YTV A;  2Z8E A;  1SI1 A;  1B32 A;  2XD2 A;  3ZSF A;  4N13 A;  2PT2 A;  3TAJ A;  1R1N A;  5I2N B;  4AQ4 A;  1QUI A;  1AL3 A;  3MZB A;  2O51 A;  5AA4 A;  1JVY A;  2DP8 A;  3T9V A;  1Y20 A;  1QVS A;  3ZS6 A;  1B5J A;  1RYO A;  5KDT B;  1PDA A;  3OMB A;  3G7W A;  5H8N B;  1B5I A;  5F1Q A;  3A3C A;  4IO5 A;  1MS7 A;  2QPQ A;  4UA8 A;  5HBC A;  2Q88 A;  2XX8 A;  1PC3 A;  4KYE A;  2QS1 A;  3RT8 A;  5DYH A;  3K0V A;  2V93 A;  5KCJ A;  1LAG E;  4F18 A;  4BLA A;  4U21 A;  1DTG A;  5L9S A;  3VVF A;  4H65 A;  2HAV A;  2P2A A;  2QS2 A;  3TMG A;  1UTB A;  4KPT A;  2IA4 A;  4H67 A;  4EXK A;  2I4B A;  1URD A;  3GZG A;  2I6E A;  2NXO A;  1BP5 A;  3TZA A;  3LSL A;  1BTJ A;  3H4Z A;  3FXQ A;  2O7U A;  4OZ9 A;  4FE8 A;  2KLF A;  3WAF A;  3IOR A;  4EQ7 A;  2QL3 A;  5ISU A;  4K3F A;  4X1D A;  3QUJ A;  1EU8 A;  4E0W A;  1PEB A;  3VDF A;  4YMA A;  1POY 1; 
#chains in the Genus database with same CATH topology
 1ZU0 A;  5AA1 A;  5CBS A;  4HS7 A;  3BIH A;  1II5 A;  4N17 A;  1RDX A;  2WBB A;  1ANF A;  4G68 B;  4M4G A;  2FA7 A;  3KOS A;  3JYR A;  1P1O A;  1LGB C;  3ROJ A;  2F3B A;  3D4G A;  3QXM A;  4LVQ A;  3RQT A;  1DTZ A;  4O7M A;  3KBR A;  2VT5 A;  1N7X A;  3OO8 A;  2Z8F A;  1UTH A;  2QVV A;  4HTG A;  4EWS A;  2DVC A;  3N6U A;  2D21 A;  4PBQ A;  2I49 A;  4I9D A;  4LZ7 A;  3E3K A;  1Y1M A;  1S9T A;  4NF4 A;  4F1U A;  1B6H A;  1LB8 A;  2XWI A;  1URS A;  4OWD A;  3GLB A;  1PB8 A;  3G3I A;  1SPI A;  2B3B A;  1EZO A;  5CMM A;  1PB9 A;  3RTF B;  1NL5 A;  3PPN A;  2H5Y A;  1TXF A;  5BWJ A;  1A7L A;  5DT6 A;  3Q25 A;  3IX1 A;  5IAI A;  3FJG A;  3MJN A;  1BIY A;  2F78 A;  3FXU A;  2H98 A;  4BDM A;  5IZ3 A;  5FBP A;  5KCJ B;  4IO2 A;  4NN3 A;  1OQG A;  1D9Y A;  3RTW B;  3MQ9 A;  4X04 A;  1IMC A;  3IJO B;  1GGG A;  3PTY A;  1OVT A;  3TTN A;  1B0L A;  3PUW E;  3FBP A;  3PGF A;  3IAZ A;  4ZEK A;  5EQ9 A;  3FV2 A;  1KA1 A;  1M5E A;  2IEE A;  2HFB A;  4NWC A;  4EF1 A;  3TUS A;  5AA3 A;  4JVC A;  4R74 A;  2DXY A;  1J1N A;  1P1Q A;  3GBA A;  4OA4 A;  2XXQ A;  3O28 A;  2AIX A;  1RKM A;  3OSR A;  3L6G A;  4I40 A;  3OEL A;  1LAH E;  2I4C A;  3C31 A;  1IXC A;  3S4U A;  4YZZ A;  3CHG A;  4GX6 A;  3SEU A;  4KCD A;  3HHF A;  1L5T A;  2MKZ A;  2DXR A;  4P1E A;  1B3G A;  2I58 A;  1UTH B;  4PAF A;  4R2B A;  5AA2 A;  1FBG A;  1B3H A;  5IKB A;  4ZEF A;  4DXB A;  4NF4 B;  3C34 A;  3DEL B;  4GWO A;  5KZT A;  2PX1 A;  5EQ7 A;  2REG A;  4JSO A;  3FVK A;  1FBE A;  1LLS A;  4R9G A;  2OWZ A;  3WAE A;  4F22 A;  2QJE A;  3DP4 A;  2NWJ A;  3VV5 A;  1P1U A;  3OO9 A;  1B4H A;  4Q8R A;  3N72 A;  1R6Z A;  3HCQ A;  1RDZ A;  1Y3N A;  4POX A;  2Q2C A;  4WED A;  3E4R A;  2UVH A;  5IZ3 B;  1MM6 A;  4N91 A;  4NMY A;  1JEV A;  4Q0C A;  3CFX A;  3O29 A;  1YPN A;  2F7B A;  2DOJ A;  1B3F A;  3DP6 A;  3TEP A;  3S9E A;  1JQF A;  3M3K A;  3C33 A;  4GLI A;  3N26 A;  4OVR A;  4H46 A;  4QFK A;  4GXS B;  2OWT A;  1US4 A;  4GBV A;  3IB2 A;  4MIJ A;  2Q9T A;  4LQ2 A;  1I6B A;  5DEX A;  2PT1 A;  3O2A A;  4RPN A;  1ELJ A;  2HXR A;  3RY3 A;  1IEJ A;  3CRB A;  2FYI A;  1H45 A;  4IB2 A;  1MH4 A;  2WX9 A;  1LBV A;  1IMB A;  5ITO A;  4MNC A;  3UGW A;  3V5A A;  4FEC A;  4ZZA A;  4AS4 A;  4AB6 A;  1P1W A;  2XA5 A;  3THI A;  2CEX A;  1MXX A;  2H25 A;  4ZE8 A;  4ELP A;  3CVG A;  1MY0 A;  1QKB A;  5ET5 A;  3PPO A;  1RYX A;  3LUY A;  3OD7 A;  4N8Y A;  4P0G A;  2OLB A;  3KJT A;  4UAB A;  2FVZ A;  4GXA A;  4OEV A;  4NF8 A;  1IME A;  2L5V A;  4FBP A;  3IL1 B;  5AA2 B;  2DQV A;  2HXW A;  4IO4 A;  3K01 A;  5I84 A;  1Y4T A;  3L6H A;  2NUV A;  4N15 A;  2ZYN A;  1JW1 A;  5ICT A;  4MLQ A;  4ZED A;  1F9B A;  1B0H A;  4PE5 B;  2AL4 A;  3VE1 B;  1ZBM A;  1XOC A;  4NED A;  1NV7 A;  3IO4 A;  3EKI A;  4EXL A;  1LBZ A;  2PVU A;  4I8C A;  4QFP A;  4Q5T A;  2D3I A;  3LUZ A;  4PCD A;  2G29 A;  3TYH A;  5AA2 D;  4DXC A;  3TCH A;  3GXA A;  4Q30 B;  4G4P A;  1B2H A;  2V4C A;  4QRZ A;  1FPG A;  3HST A;  3Q28 A;  1M5B A;  2HEU A;  4GFR A;  4KGH A;  1ZJL A;  4QFN A;  3CG1 A;  2W7Y A;  3PUY E;  4DXU A;  1SW5 A;  3KOT A;  3RPL A;  1FQD A;  2QMX A;  3SES A;  2E1S A;  4TQU Q;  2D5W A;  2KR0 A;  3U1O A;  5DEX B;  5TPA A;  3E78 A;  2RCB A;  2WYK A;  4PP0 A;  1B05 A;  4GWX A;  3FVO A;  1PBQ A;  2XHD A;  5I59 A;  3A1Z A;  4LP2 B;  4MH5 A;  1LST A;  1EZ9 A;  4XKN A;  1TT1 A;  1FTM A;  4N07 A;  3KEI A;  3C35 A;  3RYD A;  1AWB A;  1EWF A;  3LR1 A;  3W9V A;  1O7T A;  3H3G A;  1YXI A;  1JW4 A;  2DDK A;  3S9M C;  3IOW A;  1GV8 A;  1ZKB A;  3E9X A;  2BJI A;  2GHA A;  4XFE A;  1VR5 A;  4MJO A;  4C1T A;  3G3G A;  4F29 A;  3S9N C;  1FCK A;  4FAJ A;  3ILU B;  2CZI A;  4BDL A;  4GVO A;  2VHA A;  1FPI A;  4KGO A;  3PV0 E;  4DZ1 A;  3EQ1 A;  3TPA A;  3HPI A;  4NF8 B;  5JK4 A;  1FTL A;  2UVJ A;  3MBP A;  4ECF A;  1H44 A;  1VSO A;  1B46 A;  1DPE A;  3OXN A;  4R9F A;  1IXG A;  1DBZ A;  1JET A;  1NH7 A;  1JW5 A;  2ZMB A;  5FHN A;  2ZYM A;  1NV0 A;  1Y3Q A;  4MNI A;  5H8S A;  4JXI A;  2NVU B;  5EHM A;  2WKY A;  4H0W A;  4PET A;  4F2A A;  2HQ0 A;  1I6A A;  4H6D A;  1DMB A;  3T1B A;  4QF9 A;  1SW1 A;  4AS5 A;  3B8B A;  2Y7R A;  2X7Q A;  4F3P A;  4LAT A;  1B40 A;  4DCY A;  2CMO A;  1LEV A;  1IUD A;  4OVJ A;  2VPO A;  4R72 A;  4M1V A;  4NF6 A;  4NE4 A;  4ZS9 A;  4LZ5 A;  2UXA A;  1B7Z A;  4ESW A;  5L8D A;  5JEI A;  2DYX A;  3N94 A;  1WDN A;  2HZK A;  2RKM A;  5H8H B;  4F2Q A;  3V83 A;  4PF8 A;  3I5O A;  4OHN A;  3O66 A;  2FIX A;  3MP8 A;  1AOV A;  4KXP A;  1IXH A;  4PGN A;  3RPL B;  5I3S A;  1FTJ A;  4RK9 A;  2ESN A;  3K2D A;  3IB0 A;  2A5S A;  3O6H A;  1QGX A;  1K9Z A;  3H06 B;  4G68 C;  4H5F A;  3P7I A;  1MXU A;  4N8G A;  4WXJ A;  3FIR A;  1VFD A;  5I58 A;  5I59 B;  4GWU A;  4N6P A;  4F3G A;  4U4X A;  5K2X A;  1KZ8 A;  1JNF A;  5LDZ A;  1XT8 A;  4RJZ A;  4RYA A;  3SZP A;  4O3B A;  1H43 A;  3FGS A;  3MVY A;  4YIC A;  1FTK A;  3ECR A;  4P0I A;  1G0I A;  4U4S A;  4F31 B;  3GBB A;  1S50 A;  3C32 A;  4P11 A;  4EQB A;  3PPQ A;  5CM6 A;  5L9M A;  3M3F A;  4O94 A;  2I3V A;  1AH5 A;  1QJM A;  1B1H A;  4THI A;  3EF7 A;  4IO3 A;  3LSF B;  1M5F A;  3EHS A;  3CIJ A;  4NF5 A;  4OET A;  2VD3 A;  3LSX A;  2R6G E;  1FQC A;  1Y1Z A;  2CZL A;  3I3V A;  3PUV E;  5AA4 B;  4UAC A;  3IOV A;  1A8F A;  3T9X B;  1N3X A;  1I69 A;  4YU0 A;  4OVP A;  4PFW A;  1SW2 A;  5AE4 A;  2LAO A;  4RPO A;  4ZEI A;  4FJP A;  5TU0 A;  2PFZ A;  2DS9 A;  2XX7 A;  2Z23 A;  3OOA A;  1FJ9 A;  3KJ7 A;  1EH3 A;  3O6I A;  2HPG A;  1OMP A;  4NF6 B;  1FPK A;  1H3D A;  4OFO A;  4QFO A;  1FQB A;  4HE2 A;  4R6K A;  5H8F A;  3MYU A;  3TTK A;  1UTB B;  1N3W A;  3VXB A;  4GBW A;  5FTI A;  3G3J A;  4QHQ A;  2XXT A;  1DPP A;  3CI8 A;  4U22 A;  3SEV A;  4QBA A;  2THI A;  4MAG A;  1LFI A;  4MF3 A;  4P8B A;  3G3F A;  1LAF E;  3EHU A;  3A09 A;  5DVJ A;  2VP1 A;  3TOD A;  3BFT A;  2GRV A;  1MXY A;  1MG1 A;  1QUJ A;  2AYS A;  2RIN A;  1O64 A;  5I58 B;  4G2Z A;  4U23 A;  1MY4 A;  4OYV A;  1M5D A;  2B4M A;  1R9L A;  5FTH A;  1QUL A;  1FTA A;  1IXI A;  3QIM A;  3B6T A;  3TDJ A;  2V84 A;  5L9O A;  1R9Q A;  3MZ9 A;  1NV5 A;  1MPD A;  1OIB A;  3UA8 A;  3U93 A;  3TFL A;  4GF8 A;  1LBC A;  4OFL A;  1HSJ A;  3LSW A;  1NNT A;  4XKR A;  4HCW A;  5A5L A;  4Z7E A;  4JVI A;  1B1X A;  4X9T A;  4OXV A;  3M3L A;  1I6Q A;  2OBG A;  1CE2 A;  3FJ7 A;  3JZJ A;  2ANJ A;  1NNK A;  1RDY A;  3KSJ A;  3N6T A;  1US5 A;  4PAI A;  2XXP A;  3U94 A;  3OO7 A;  1IQ7 A;  1MQJ A;  3TCF A;  3T22 A;  3FD3 A;  4GWY A;  1IMF A;  3MVX A;  4O8M A;  1LFG A;  5I56 A;  2Z8D A;  1K9Y A;  4IGR A;  4YKJ A;  1SYI A;  2O84 X;  4XTC Q;  5EQA A;  4QSC A;  4F19 A;  5J1D A;  3U65 A;  5LTC A;  4GQO A;  4TLL B;  4P1L A;  4POW A;  4PQJ A;  3TEL A;  4XKQ A;  3K6V A;  4KD5 A;  1NUZ A;  3UN6 A;  1EYK A;  2DSF A;  1A54 A;  4H5G A;  2UVG A;  3OEN A;  2Y7K A;  1HSE A;  3BFU A;  3T0J A;  5A5X A;  1B4Z A;  2O69 A;  5H8F B;  2Y5L A;  3KC0 A;  1ZMG A;  2NOO A;  4AB5 A;  2XWO A;  5FHO A;  1DCU A;  1OLC A;  5FHM A;  5IZ1 A;  3PD9 A;  2ONS A;  2ZNT A;  1XVX A;  3C9H A;  3HHG A;  3ODB A;  1QKA A;  3RGY A;  3LBS A;  3MAM A;  3B7D A;  3MVW A;  4DI4 B;  4C1U A;  4MMP A;  3CG3 A;  2O1L A;  3CSG A;  2HZL A;  1URG A;  4F2O A;  4BDO A;  5LOM A;  3I6V A;  4IY5 A;  3RN8 A;  1VDW A;  1NH8 A;  4G8H A;  1UIU A;  1XS5 A;  1D3K A;  5DTB A;  3V8X B;  1VFE A;  3VVD A;  1SQY A;  3SEX A;  2DWI A;  5K2Y A;  3F11 A;  4DE8 A;  2XXH A;  4FIM A;  2VPN A;  2VD2 A;  2B65 A;  5IM2 A;  4GRK A;  4L17 A;  4XXU A;  4IY6 A;  1B5H A;  5ET7 A;  1MY3 A;  3S2V A;  3TCG A;  1G0H A;  4IO7 A;  1LBY A;  1MPB A;  1N84 A;  2GHB A;  2ONR A;  1NV2 A;  1ZIU A;  1GTK A;  1DOT A;  1NV6 A;  3BKI B;  3RUM A;  3W9W A;  1ATG A;  1NFT A;  1MQH A;  4F1V A;  1D9V A;  2G93 A;  1AIV A;  3EPE A;  1DSN A;  2PCR A;  2XXW A;  4GL8 A;  3BBR A;  1PBP A;  4LUB A;  4JWY A;  3U92 A;  1EZP A;  4NX1 A;  1AMF A;  2F6G A;  4NG7 A;  4U2R A;  1P99 A;  4HXV A;  3TTR A;  4KYS A;  3O6G A;  4NTL A;  1FQA A;  2OCU A;  5I2N A;  3B6Q A;  4TLM B;  2Q8M A;  4H45 A;  4ESX A;  5HPQ A;  4LN5 A;  2OX3 A;  3FVN A;  2O7I A;  5T3J A;  2ZYK A;  1FPF A;  3FAS A;  2V3U A;  4OVQ A;  5H8N A;  4M4D A;  2WEF A;  2XXU A;  4LON B;  4ZEB A;  2Y7W A;  2RQF A;  1SVX B;  5DVF A;  1LBX A;  2O68 A;  4WEP A;  2UYE A;  3MP6 A;  3MPK A;  5CI5 A;  2R71 A;  2PYY A;  4N4U A;  3E8W A;  5A5X B;  2F7C A;  1Y4C A;  2F36 A;  2QFL A;  3T93 B;  2OK2 A;  2ABH A;  4IR8 A;  2P3N A;  3SET A;  3AOT A;  2RC8 A;  2RC9 A;  1OVB A;  1T0K A;  2H9B A;  1N76 A;  4JB7 A;  5EHS A;  3SDF A;  4ELR A;  2I0C A;  1SDX A;  2X7P A;  1BK4 A;  5ICQ A;  1VE4 A;  3KZG A;  5ESY A;  5M2V A;  5F24 A;  3H6V A;  5CBR A;  1KWH A;  2PBW A;  4PFU A;  1MY2 A;  4QSD A;  1B52 A;  4ND9 A;  4MEV A;  4KYD A;  4YAH X;  5CMK A;  3CR9 A;  1N0T A;  4GOT A;  4R2F A;  2V3Q A;  2H99 A;  4HE1 A;  3MZ1 A;  4YB6 A;  3N5L A;  3IFA A;  3PMV A;  3AOS A;  1GR2 A;  5IGA A;  2QVR A;  4ZZE A;  2XX9 A;  1BLF A;  1NNP A;  4R73 A;  4FOR A;  4OQO A;  2GH9 A;  2Y7P A;  1Q35 A;  1FBP A;  4X8R A;  3K02 A;  3ONM A;  5EYG A;  1P1N A;  2DE4 A;  1Q9D A;  2JJK A;  4MCO A;  1FPB A;  3B50 A;  5EYH A;  3OO6 A;  4ONY A;  3FXB A;  3MW0 A;  2OBD A;  3U72 A;  4EQ9 A;  4GX4 A;  3VXC A;  1YCJ A;  1XVY A;  1POT A;  1FW0 A;  3H6W A;  4JWO A;  2Y7I A;  4G77 A;  3FV1 A;  2R9J A;  2DWJ A;  1USY H;  2A5T A;  4NHB A;  4BDQ A;  1NKX A;  4KFQ A;  1WVJ A;  5CC2 A;  1FPD A;  1SW4 A;  2F8D A;  2ZYO A;  1Y9U A;  1XC1 A;  2I3W A;  4O3A A;  1IIT A;  2Q2A A;  5ET8 A;  3V89 B;  2Y5K A;  3PPP A;  1MQD A;  2HCA A;  2R8T A;  3K1M A;  4MNP A;  3MVZ A;  2RF1 A;  4PF6 A;  2XXI A;  1FBD A;  4ISU A;  4WKM A;  3SER A;  2XWK A;  1LB9 A;  4RK2 A;  3C4M A;  1D4N A;  2O1M A;  4HCY A;  4O3C A;  2YPN A;  3HV1 A;  3EHT A;  1YZ0 A;  3IOT A;  1BKA A;  3JV9 A;  5TPA B;  4F1Y A;  3HN0 A;  1DK4 A;  4PGP A;  3OSQ A;  2QRY A;  3D1R A;  3KGC A;  3C36 A;  2B3F A;  3FUZ A;  5F7V A;  4NWD A;  4DLD A;  2VOZ A;  4OER A;  4PDH A;  2DE2 A;  2QS3 A;  4DIG A;  3Q26 A;  4P9K A;  1LAX A;  1NMU A;  4YKI A;  2RCA A;  4P56 A;  2XXR A;  3B6W A;  2PFY A;  4C0R A;  2Q8J A;  1TFD A;  5EYF A;  1A99 A;  1Q1K A;  3IO6 A;  5I7L A;  2REJ A;  4MBP A;  5CMC A;  3KN3 A;  4BDN A;  1FQF A;  3AXF A;  1EYI A;  4LZ8 A;  3PPR A;  1MDQ A;  3TQW A;  1LCF A;  2V3T A;  1A55 A;  2UVI A;  4PE3 A;  1NV4 A;  3KFM A;  2HHM A;  1FPJ A;  3H6U A;  3QAX A;  3TQL A;  3TKD A;  3OEK A;  2WBD A;  1LFH A;  1NV1 A;  4YKP A;  2XD3 A;  3E13 X;  4OEN A;  4KR5 A;  4FEB A;  2ZNS A;  2ALU A;  4NQ8 A;  4KCC A;  1NI9 A;  1B58 A;  1Z7N E;  3PUZ E;  4ELO A;  2YJP A;  1LBW A;  1B7U A;  1INP A;  3USD A;  1IZ1 A;  3DP8 A;  5I7I A;  2FIE A;  2F35 A;  2ZXT A;  1FTO A;  2A5T B;  4FAT A;  5H8Q A;  1O63 A;  3BIG A;  5CRY A;  2F5X A;  3QYT A;  3IJX B;  1XHY A;  3K00 A;  4N6D A;  5ITP A;  1JP4 A;  4OVT A;  5EQ8 A;  4LQ5 A;  5B70 A;  1FQE A;  4KI0 E;  1USY E;  2XXK A;  4U1Z A;  4FED A;  4PDD A;  3M8U A;  3KN7 A;  3KSX A;  3PMX A;  3VLW A;  2DVZ A;  1B3L A;  1FPE A;  2ZZX A;  4PFT A;  4LA9 A;  1IIW A;  3UOR A;  4GWS A;  3FJM A;  1XI6 A;  3FAT A;  1GVC A;  3VFJ A;  1CNQ A;  1EYJ A;  3D4C A;  4U1O A;  5I5P A;  3TTM A;  1MM7 A;  3MST A;  1TWY A;  2PMS A;  1MH3 A;  1ZTY A;  2Z22 A;  2O6A A;  3UIF A;  2XXV A;  4G8M A;  1NUX A;  3SEW A;  1UIV A;  4H8J A;  4EDP A;  3T96 B;  4N81 A;  4MHF A;  4X1B A;  2DWH A;  4PFR A;  1Y3P A;  4JDF A;  2RC7 A;  4GIZ A;  3FZV A;  4PFB A;  3K6U A;  4QFL A;  2UYF A;  1YYZ A;  3Q27 A;  3T9U A;  4DDD A;  3IK6 B;  4R6H A;  3QMF A;  4H1X A;  4X48 A;  2ONK E;  1HSL A;  4OFJ A;  2CEY A;  4NF5 B;  4PFY A;  2P1S A;  3KG2 A;  1D9Q A;  3O97 A;  4KQP A;  2YLN A;  3UK4 A;  2DWA A;  3HO7 A;  5I7K A;  2OJT A;  3RPW A;  4EUO A;  2B4L A;  5JTY A;  2ZZV A;  3SEY A;  4YB5 A;  3IOU A;  3MC2 A;  4NGU A;  5BUU A;  2XXX A;  4YKK A;  2QVU A;  5H8Q B;  1B9J A;  4XF5 A;  3O9P A;  3RT6 B;  3LC8 A;  4F3B A;  3KN8 A;  2V25 A;  3MP1 A;  3VLV A;  4PC9 A;  4R75 A;  1NV3 A;  3HFU A;  2HAU A;  4OES A;  1LCT A;  3FXR A;  3K1N A;  3G3H A;  2BJJ X;  4ELQ A;  2DE3 A;  3PU5 A;  3MPL A;  1SD3 A;  2F97 A;  3K4U A;  4XEQ A;  4GL0 A;  1B51 A;  3TTL A;  5ELV A;  2GFE A;  3QUF A;  3DLN A;  4ZE9 A;  4RA1 A;  3R26 A;  3L6I A;  1PB7 A;  4RY1 A;  4GWZ A;  3QK6 A;  5I57 A;  2E0S A;  4RNS A;  4I1D A;  5TP9 A;  4PFI A;  1MQG A;  3SKP A;  4NAP A;  4GD5 A;  4GX3 A;  1NNF A;  4EF2 A;  1LBB A;  2H4I A;  3FVG A;  2OWS A;  4F3S A;  3S9L C;  1MPC A;  2F3D A;  5IZZ A;  1USV B;  1MXW A;  4YMB A;  1UQW A;  4JWX A;  1SYH A;  1FJ6 A;  4XKP A;  4G8N A;  3OEM A;  2ZNU A;  1ZLQ A;  3CFL A;  1S7Y A;  1M5C A;  3K6X A;  1WOD A;  4H8I A;  1B3E A;  3R6U A;  4N6K A;  2Y84 A;  5I2K A;  3ZKL A;  1KA0 A;  4G61 A;  1IMA A;  1QW0 A;  2QS4 A;  3LV0 A;  3ZKK A;  3CFZ A;  3ZPM A;  1FPL A;  2Q74 A;  4P47 A;  4F39 A;  1MRP A;  3UV1 A;  3A3U A;  1SI0 A;  4XIG Q;  3MWB A;  2Q89 A;  4OMB A;  3PMW A;  5I56 B;  4TOZ A;  5JTY B;  4QSE A;  2P0S A;  4I62 A;  1SBP A;  2CZH A;  2I48 A;  2XXY A;  1N04 A;  4JBZ A;  1N7W A;  3R7X A;  4E0X A;  3H03 A;  3IB1 A;  2QMW A;  3K1P A;  2I0B A;  4I3E A;  3G3K A;  1OLA A;  5KDT A;  4OVS A;  3RNN A;  4MLV A;  2GQ1 A;  1QUK A;  1NUW A;  3DM0 A;  5HM4 B;  4R6Y A;  2F6P A;  2AL5 A;  2F7A A;  4IO6 A;  4JSD A;  4P3L A;  4PAK A;  2OZZ A;  4MX6 A;  4BDR A;  2P3V A;  1IMD A;  3H7M A;  3UP9 A;  3ISP A;  5B7D A;  1JVX A;  1OQH A;  3VLU A;  3RLF E;  2FNC A;  5DVI A;  4RXL A;  3NOH A;  4MFI A;  1JEU A;  3K6W A;  1TFA A;  3W15 C;  2F34 A;  5I7J A;  1FRP A;  3QSL A;  4G0S A;  2QSX A;  1CB6 A;  4YB7 A;  5H8H A;  5I57 B;  4OTE A;  2ZZW A;  5TP9 B;  2VGQ A;  3U8Q A;  3T66 A;  4HW8 A;  1MY1 A;  5DW8 A;  3CSB A;  1B7H A;  5CMB A;  1MXV A;  3VVE A;  2M8C A;  3T9H B;  4Z0I A;  3PD8 A;  1BP1 A;  3H6T A;  4OEU A;  4KHZ E;  4JVD A;  1H76 A;  3EN3 A;  1MXZ A;  1A8E A;  4ZEC A;  3KC1 A;  1Z7M E;  1A40 A;  3ILT B;  1FBH A;  1MDP 1;  3E8T A;  4GWW A;  4DCX A;  2CZK A;  4ZDM A;  5I2K B;  1YAE A;  3IR1 A;  2FBP A;  1MQI A;  2X26 A;  4IGT A;  4G68 A;  3MUQ A;  3PUX E;  3Q29 A;  1YTV A;  2Z8E A;  1SI1 A;  1B32 A;  1USU B;  3IFC A;  2XD2 A;  3ZSF A;  4N13 A;  2PT2 A;  5ET6 A;  3E79 A;  3TAJ A;  1FSA A;  4NF0 A;  1R1N A;  5I2N B;  4AQ4 A;  1QUI A;  1AL3 A;  3MZB A;  2O51 A;  5AA4 A;  1JVY A;  2DP8 A;  3T9V A;  1Y20 A;  1QVS A;  2RCK A;  4OAN A;  3ZS6 A;  1B5J A;  1RYO A;  5KDT B;  1PDA A;  3OMB A;  4O7I A;  3G7W A;  5H8N B;  1B5I A;  2FHY A;  5F1Q A;  3A3C A;  4IO5 A;  1MS7 A;  2QPQ A;  2WYP A;  2XWV A;  4UA8 A;  5HBC A;  2Q88 A;  2XX8 A;  4HE0 A;  1PC3 A;  4DI3 D;  4KYE A;  2QS1 A;  3RT8 A;  5DYH A;  3K0V A;  2V93 A;  5KCJ A;  1FBC A;  1LAG E;  2KQZ A;  4F18 A;  4BLA A;  4U21 A;  1DTG A;  5L9S A;  3VVF A;  4H65 A;  2HAV A;  1NUY A;  3A29 A;  2P2A A;  2QS2 A;  3TMG A;  5J16 A;  4I3Y A;  1UTB A;  4KPT A;  4PBH A;  2IA4 A;  4H67 A;  4EXK A;  2I4B A;  1FBF A;  1URD A;  3GZG A;  2I6E A;  2NXO A;  1BP5 A;  3TZA A;  3LSL A;  1BTJ A;  3H4Z A;  3FXQ A;  3GYY A;  2O7U A;  4OZ9 A;  4FE8 A;  3KBZ A;  2KLF A;  3WAF A;  3IOR A;  4EQ7 A;  2QL3 A;  5ISU A;  4K3F A;  4X1D A;  3QUJ A;  1EU8 A;  4QXD A;  4E0W A;  1PEB A;  3VDF A;  4PTK A;  4YMA A;  1POY 1; 
#chains in the Genus database with same CATH homology
 1ZU0 A;  5AA1 A;  5CBS A;  4HS7 A;  1II5 A;  1ANF A;  4G68 B;  4M4G A;  2FA7 A;  3KOS A;  3JYR A;  1P1O A;  1LGB C;  3D4G A;  3QXM A;  4LVQ A;  3RQT A;  1DTZ A;  3KBR A;  1N7X A;  3OO8 A;  2Z8F A;  1UTH A;  4HTG A;  4EWS A;  2DVC A;  3N6U A;  2D21 A;  2I49 A;  4I9D A;  4LZ7 A;  3E3K A;  1Y1M A;  1S9T A;  4NF4 A;  4F1U A;  1B6H A;  1LB8 A;  1URS A;  4OWD A;  3GLB A;  1PB8 A;  3G3I A;  2B3B A;  1EZO A;  5CMM A;  1PB9 A;  3RTF B;  1NL5 A;  3PPN A;  2H5Y A;  1TXF A;  5BWJ A;  1A7L A;  5DT6 A;  3Q25 A;  3IX1 A;  5IAI A;  3FJG A;  3MJN A;  1BIY A;  2F78 A;  3FXU A;  2H98 A;  4BDM A;  5KCJ B;  4IO2 A;  1OQG A;  1D9Y A;  3RTW B;  3MQ9 A;  3IJO B;  1GGG A;  1OVT A;  3TTN A;  1B0L A;  3PUW E;  3PGF A;  3IAZ A;  4ZEK A;  3FV2 A;  1M5E A;  2IEE A;  2HFB A;  4NWC A;  4EF1 A;  3TUS A;  5AA3 A;  4R74 A;  2DXY A;  1J1N A;  1P1Q A;  3GBA A;  2XXQ A;  3O28 A;  2AIX A;  1RKM A;  3OSR A;  3L6G A;  3OEL A;  1LAH E;  2I4C A;  3C31 A;  1IXC A;  3S4U A;  4YZZ A;  3SEU A;  4KCD A;  3HHF A;  1L5T A;  2DXR A;  1B3G A;  2I58 A;  1UTH B;  4R2B A;  5AA2 A;  1B3H A;  5IKB A;  4ZEF A;  4DXB A;  4NF4 B;  3C34 A;  3DEL B;  4GWO A;  5KZT A;  2PX1 A;  2REG A;  4JSO A;  3FVK A;  1LLS A;  4R9G A;  3WAE A;  4F22 A;  2QJE A;  3DP4 A;  2NWJ A;  3VV5 A;  1P1U A;  3OO9 A;  1B4H A;  4Q8R A;  3N72 A;  1R6Z A;  3HCQ A;  1Y3N A;  4POX A;  2Q2C A;  4WED A;  3E4R A;  2UVH A;  1MM6 A;  4NMY A;  1JEV A;  4Q0C A;  3CFX A;  3O29 A;  1YPN A;  2F7B A;  2DOJ A;  1B3F A;  3DP6 A;  3TEP A;  3S9E A;  1JQF A;  3M3K A;  3C33 A;  4GLI A;  3N26 A;  4QFK A;  4GXS B;  2OWT A;  1US4 A;  3IB2 A;  2Q9T A;  4LQ2 A;  1I6B A;  5DEX A;  2PT1 A;  3O2A A;  4RPN A;  1ELJ A;  3RY3 A;  1IEJ A;  3CRB A;  2FYI A;  1H45 A;  4IB2 A;  1MH4 A;  5ITO A;  3UGW A;  3V5A A;  4FEC A;  4ZZA A;  4AB6 A;  1P1W A;  3THI A;  1MXX A;  2H25 A;  4ZE8 A;  4ELP A;  3CVG A;  1MY0 A;  1QKB A;  3PPO A;  1RYX A;  3LUY A;  3OD7 A;  4P0G A;  2OLB A;  3KJT A;  4GXA A;  4OEV A;  4NF8 A;  3IL1 B;  5AA2 B;  2DQV A;  2HXW A;  4IO4 A;  3K01 A;  5I84 A;  1Y4T A;  3L6H A;  2NUV A;  2ZYN A;  1JW1 A;  5ICT A;  4MLQ A;  4ZED A;  1F9B A;  1B0H A;  4PE5 B;  2AL4 A;  3VE1 B;  1ZBM A;  1XOC A;  4NED A;  3IO4 A;  4EXL A;  2PVU A;  4I8C A;  4QFP A;  4Q5T A;  2D3I A;  2G29 A;  3TYH A;  5AA2 D;  4DXC A;  3TCH A;  3GXA A;  4Q30 B;  4G4P A;  1B2H A;  4QRZ A;  3HST A;  3Q28 A;  1M5B A;  2HEU A;  4GFR A;  4KGH A;  1ZJL A;  4QFN A;  3CG1 A;  2W7Y A;  3PUY E;  4DXU A;  1SW5 A;  3KOT A;  1FQD A;  2QMX A;  3SES A;  2E1S A;  4TQU Q;  2D5W A;  3U1O A;  5DEX B;  5TPA A;  2RCB A;  4PP0 A;  1B05 A;  3FVO A;  1PBQ A;  2XHD A;  5I59 A;  3A1Z A;  4LP2 B;  4MH5 A;  1LST A;  1EZ9 A;  4XKN A;  1TT1 A;  1FTM A;  4N07 A;  3KEI A;  3C35 A;  1EWF A;  3LR1 A;  3W9V A;  1O7T A;  3H3G A;  1JW4 A;  3S9M C;  3IOW A;  1GV8 A;  1ZKB A;  3E9X A;  2GHA A;  1VR5 A;  4C1T A;  3G3G A;  4F29 A;  3S9N C;  1FCK A;  4FAJ A;  3ILU B;  4BDL A;  4GVO A;  2VHA A;  4KGO A;  3PV0 E;  4DZ1 A;  3EQ1 A;  3TPA A;  3HPI A;  4NF8 B;  5JK4 A;  1FTL A;  2UVJ A;  3MBP A;  4ECF A;  1H44 A;  1VSO A;  1B46 A;  1DPE A;  3OXN A;  4R9F A;  1IXG A;  1JET A;  1NH7 A;  1JW5 A;  2ZMB A;  5FHN A;  2ZYM A;  1Y3Q A;  5H8S A;  4JXI A;  2NVU B;  5EHM A;  2WKY A;  4H0W A;  4PET A;  4F2A A;  2HQ0 A;  1I6A A;  4H6D A;  1DMB A;  4QF9 A;  1SW1 A;  2Y7R A;  2X7Q A;  4F3P A;  4LAT A;  1B40 A;  4DCY A;  2CMO A;  1IUD A;  4OVJ A;  4R72 A;  4M1V A;  4NF6 A;  4NE4 A;  4ZS9 A;  4LZ5 A;  2UXA A;  1B7Z A;  4ESW A;  5L8D A;  5JEI A;  2DYX A;  3N94 A;  1WDN A;  2HZK A;  2RKM A;  5H8H B;  4F2Q A;  3V83 A;  3I5O A;  4OHN A;  3O66 A;  3MP8 A;  1AOV A;  1IXH A;  1FTJ A;  4RK9 A;  2ESN A;  3K2D A;  3IB0 A;  2A5S A;  3O6H A;  3H06 B;  4G68 C;  4H5F A;  3P7I A;  1MXU A;  4WXJ A;  3FIR A;  1VFD A;  5I58 A;  5I59 B;  4N6P A;  4F3G A;  4U4X A;  5K2X A;  1JNF A;  1XT8 A;  4RJZ A;  4RYA A;  4O3B A;  1H43 A;  3FGS A;  3MVY A;  4YIC A;  1FTK A;  3ECR A;  4P0I A;  4U4S A;  4F31 B;  3GBB A;  1S50 A;  3C32 A;  4P11 A;  4EQB A;  3PPQ A;  5CM6 A;  5L9M A;  3M3F A;  2I3V A;  1AH5 A;  1QJM A;  1B1H A;  4THI A;  3EF7 A;  4IO3 A;  3LSF B;  1M5F A;  3EHS A;  3CIJ A;  4NF5 A;  4OET A;  2VD3 A;  3LSX A;  2R6G E;  1FQC A;  1Y1Z A;  2CZL A;  3I3V A;  3PUV E;  5AA4 B;  4UAC A;  3IOV A;  1A8F A;  3T9X B;  1N3X A;  1I69 A;  4YU0 A;  4PFW A;  1SW2 A;  5AE4 A;  2LAO A;  4RPO A;  4ZEI A;  4FJP A;  5TU0 A;  2DS9 A;  2XX7 A;  2Z23 A;  3OOA A;  3KJ7 A;  1EH3 A;  3O6I A;  1OMP A;  4NF6 B;  1H3D A;  4OFO A;  4QFO A;  1FQB A;  4R6K A;  5H8F A;  3TTK A;  1UTB B;  1N3W A;  3VXB A;  5FTI A;  3G3J A;  4QHQ A;  2XXT A;  1DPP A;  3CI8 A;  4U22 A;  3SEV A;  2THI A;  4MF3 A;  1LFI A;  3G3F A;  1LAF E;  3EHU A;  5DVJ A;  3A09 A;  2VP1 A;  3TOD A;  3BFT A;  2GRV A;  1MXY A;  1MG1 A;  1QUJ A;  2AYS A;  2RIN A;  1O64 A;  5I58 B;  4G2Z A;  4U23 A;  1MY4 A;  4OYV A;  1M5D A;  1R9L A;  5FTH A;  1QUL A;  1IXI A;  3QIM A;  3B6T A;  3TDJ A;  2V84 A;  5L9O A;  1R9Q A;  3MZ9 A;  1MPD A;  1OIB A;  3UA8 A;  3U93 A;  3TFL A;  4GF8 A;  1LBC A;  4OFL A;  1HSJ A;  3LSW A;  1NNT A;  4XKR A;  4HCW A;  4Z7E A;  1B1X A;  4X9T A;  4OXV A;  3M3L A;  1I6Q A;  2OBG A;  1CE2 A;  3FJ7 A;  3JZJ A;  2ANJ A;  1NNK A;  3KSJ A;  3N6T A;  1US5 A;  2XXP A;  3U94 A;  3OO7 A;  1IQ7 A;  1MQJ A;  3TCF A;  3T22 A;  3FD3 A;  3MVX A;  1LFG A;  5I56 A;  2Z8D A;  4IGR A;  4YKJ A;  1SYI A;  2O84 X;  4XTC Q;  4QSC A;  4F19 A;  5J1D A;  4GQO A;  4TLL B;  4POW A;  4PQJ A;  3TEL A;  4XKQ A;  3K6V A;  4KD5 A;  3UN6 A;  2DSF A;  1A54 A;  4H5G A;  2UVG A;  3OEN A;  2Y7K A;  1HSE A;  3BFU A;  5A5X A;  1B4Z A;  2O69 A;  5H8F B;  1ZMG A;  2NOO A;  4AB5 A;  5FHO A;  1OLC A;  5FHM A;  3PD9 A;  2ONS A;  2ZNT A;  1XVX A;  3C9H A;  3HHG A;  3ODB A;  1QKA A;  3RGY A;  3LBS A;  3MAM A;  3B7D A;  3MVW A;  4C1U A;  3CG3 A;  2O1L A;  3CSG A;  2HZL A;  1URG A;  4F2O A;  4BDO A;  5LOM A;  3I6V A;  4IY5 A;  3RN8 A;  1NH8 A;  4G8H A;  1UIU A;  1XS5 A;  1D3K A;  5DTB A;  3V8X B;  1VFE A;  3VVD A;  1SQY A;  3SEX A;  2DWI A;  5K2Y A;  3F11 A;  4DE8 A;  2XXH A;  4FIM A;  2VD2 A;  2B65 A;  4GRK A;  4L17 A;  4XXU A;  4IY6 A;  1B5H A;  1MY3 A;  3S2V A;  3TCG A;  4IO7 A;  1MPB A;  1N84 A;  2GHB A;  2ONR A;  1ZIU A;  1GTK A;  1DOT A;  3BKI B;  3RUM A;  3W9W A;  1ATG A;  1NFT A;  1MQH A;  4F1V A;  1D9V A;  2G93 A;  1AIV A;  3EPE A;  1DSN A;  2XXW A;  4GL8 A;  3BBR A;  1PBP A;  4LUB A;  4JWY A;  3U92 A;  1EZP A;  1AMF A;  2F6G A;  4U2R A;  1P99 A;  3TTR A;  4KYS A;  3O6G A;  4NTL A;  1FQA A;  2OCU A;  5I2N A;  3B6Q A;  4TLM B;  4ESX A;  5HPQ A;  3FVN A;  2O7I A;  2ZYK A;  3FAS A;  2V3U A;  5H8N A;  4M4D A;  2XXU A;  4LON B;  4ZEB A;  2Y7W A;  2RQF A;  1SVX B;  5DVF A;  2O68 A;  4WEP A;  2UYE A;  3MP6 A;  3MPK A;  5CI5 A;  2R71 A;  2PYY A;  3E8W A;  5A5X B;  2F7C A;  1Y4C A;  2F36 A;  3T93 B;  2OK2 A;  2ABH A;  3SET A;  3AOT A;  2RC8 A;  2RC9 A;  1OVB A;  1T0K A;  2H9B A;  1N76 A;  4JB7 A;  5EHS A;  3SDF A;  4ELR A;  2I0C A;  1SDX A;  2X7P A;  5ICQ A;  1VE4 A;  3KZG A;  5M2V A;  3H6V A;  5CBR A;  1KWH A;  2PBW A;  4PFU A;  1MY2 A;  4QSD A;  1B52 A;  4ND9 A;  4KYD A;  4YAH X;  5CMK A;  3CR9 A;  1N0T A;  4GOT A;  4R2F A;  2V3Q A;  2H99 A;  3MZ1 A;  4YB6 A;  3N5L A;  3PMV A;  3AOS A;  1GR2 A;  4ZZE A;  2XX9 A;  1BLF A;  1NNP A;  4R73 A;  4FOR A;  4OQO A;  2GH9 A;  2Y7P A;  1Q35 A;  3K02 A;  3ONM A;  1P1N A;  2DE4 A;  3OO6 A;  4ONY A;  3MW0 A;  2OBD A;  3U72 A;  4EQ9 A;  3VXC A;  1YCJ A;  1XVY A;  1POT A;  1FW0 A;  3H6W A;  4JWO A;  2Y7I A;  4G77 A;  3FV1 A;  2R9J A;  2DWJ A;  1USY H;  2A5T A;  4BDQ A;  1NKX A;  4KFQ A;  1WVJ A;  5CC2 A;  1SW4 A;  2F8D A;  2ZYO A;  1Y9U A;  1XC1 A;  2I3W A;  4O3A A;  1IIT A;  2Q2A A;  3V89 B;  3PPP A;  1MQD A;  2HCA A;  3K1M A;  3MVZ A;  2RF1 A;  2XXI A;  4ISU A;  4WKM A;  3SER A;  1LB9 A;  4RK2 A;  3C4M A;  1D4N A;  2O1M A;  4HCY A;  4O3C A;  2YPN A;  3HV1 A;  3EHT A;  3IOT A;  1BKA A;  3JV9 A;  5TPA B;  4F1Y A;  3HN0 A;  3OSQ A;  2QRY A;  3KGC A;  3C36 A;  2B3F A;  3FUZ A;  5F7V A;  4NWD A;  4DLD A;  2VOZ A;  4OER A;  2DE2 A;  2QS3 A;  4DIG A;  3Q26 A;  1LAX A;  1NMU A;  4YKI A;  2RCA A;  2XXR A;  3B6W A;  4C0R A;  2Q8J A;  1TFD A;  5EYF A;  1A99 A;  1Q1K A;  3IO6 A;  5I7L A;  2REJ A;  4MBP A;  5CMC A;  3KN3 A;  4BDN A;  1FQF A;  3AXF A;  4LZ8 A;  3PPR A;  1MDQ A;  3TQW A;  1LCF A;  2V3T A;  1A55 A;  2UVI A;  3KFM A;  3H6U A;  3QAX A;  3TQL A;  3TKD A;  3OEK A;  1LFH A;  4YKP A;  2XD3 A;  3E13 X;  4OEN A;  4KR5 A;  4FEB A;  2ZNS A;  2ALU A;  4KCC A;  1B58 A;  1Z7N E;  3PUZ E;  4ELO A;  2YJP A;  1B7U A;  3USD A;  1IZ1 A;  3DP8 A;  2F35 A;  2ZXT A;  1FTO A;  2A5T B;  4FAT A;  5H8Q A;  1O63 A;  5CRY A;  2F5X A;  3QYT A;  3IJX B;  1XHY A;  3K00 A;  5ITP A;  4LQ5 A;  5B70 A;  1FQE A;  4KI0 E;  1USY E;  4U1Z A;  4FED A;  3M8U A;  3KN7 A;  3KSX A;  3PMX A;  3VLW A;  2DVZ A;  1B3L A;  4PFT A;  4LA9 A;  1IIW A;  3UOR A;  3FJM A;  3FAT A;  1GVC A;  3VFJ A;  3D4C A;  4U1O A;  3TTM A;  1MM7 A;  1TWY A;  2PMS A;  1MH3 A;  1ZTY A;  2Z22 A;  2O6A A;  3UIF A;  2XXV A;  4G8M A;  3SEW A;  1UIV A;  4H8J A;  4EDP A;  3T96 B;  4X1B A;  2DWH A;  1Y3P A;  4JDF A;  2RC7 A;  4GIZ A;  3FZV A;  3K6U A;  4QFL A;  2UYF A;  3Q27 A;  3T9U A;  4DDD A;  3IK6 B;  4R6H A;  4H1X A;  4X48 A;  2ONK E;  1HSL A;  4OFJ A;  4NF5 B;  4PFY A;  2P1S A;  3KG2 A;  3O97 A;  4KQP A;  2YLN A;  3UK4 A;  2DWA A;  3HO7 A;  5I7K A;  2OJT A;  3RPW A;  4EUO A;  5JTY A;  3SEY A;  4YB5 A;  3IOU A;  3MC2 A;  5BUU A;  2XXX A;  4YKK A;  5H8Q B;  1B9J A;  3O9P A;  3RT6 B;  3LC8 A;  4F3B A;  3KN8 A;  2V25 A;  3MP1 A;  3VLV A;  4R75 A;  2HAU A;  4OES A;  1LCT A;  3FXR A;  3K1N A;  3G3H A;  2BJJ X;  4ELQ A;  2DE3 A;  3PU5 A;  3MPL A;  1SD3 A;  2F97 A;  3TTL A;  3K4U A;  4GL0 A;  1B51 A;  5ELV A;  2GFE A;  3QUF A;  3DLN A;  4ZE9 A;  4RA1 A;  3R26 A;  3L6I A;  1PB7 A;  4RY1 A;  3QK6 A;  5I57 A;  2E0S A;  4RNS A;  4I1D A;  5TP9 A;  1MQG A;  3SKP A;  4GD5 A;  1NNF A;  4EF2 A;  1LBB A;  2H4I A;  3FVG A;  2OWS A;  4F3S A;  3S9L C;  1MPC A;  1USV B;  1MXW A;  4YMB A;  1UQW A;  4JWX A;  1SYH A;  4XKP A;  4G8N A;  3OEM A;  2ZNU A;  1ZLQ A;  3CFL A;  1S7Y A;  1M5C A;  3K6X A;  1WOD A;  4H8I A;  1B3E A;  3R6U A;  2Y84 A;  5I2K A;  3ZKL A;  1QW0 A;  2QS4 A;  3ZKK A;  3CFZ A;  3ZPM A;  4F39 A;  1MRP A;  3UV1 A;  3A3U A;  1SI0 A;  4XIG Q;  3MWB A;  2Q89 A;  4OMB A;  3PMW A;  5I56 B;  4TOZ A;  5JTY B;  4QSE A;  2P0S A;  4I62 A;  1SBP A;  2I48 A;  2XXY A;  1N04 A;  4JBZ A;  1N7W A;  3R7X A;  4E0X A;  3H03 A;  3IB1 A;  2QMW A;  3K1P A;  2I0B A;  3G3K A;  1OLA A;  5KDT A;  3RNN A;  4MLV A;  1QUK A;  3DM0 A;  5HM4 B;  4R6Y A;  2F6P A;  2AL5 A;  2F7A A;  4IO6 A;  4JSD A;  2OZZ A;  4BDR A;  3H7M A;  3UP9 A;  5B7D A;  1JVX A;  1OQH A;  3VLU A;  3RLF E;  2FNC A;  5DVI A;  4RXL A;  4MFI A;  1JEU A;  3K6W A;  1TFA A;  3W15 C;  2F34 A;  5I7J A;  3QSL A;  4G0S A;  2QSX A;  1CB6 A;  4YB7 A;  5H8H A;  5I57 B;  4OTE A;  5TP9 B;  2VGQ A;  3U8Q A;  3T66 A;  4HW8 A;  1MY1 A;  3CSB A;  1B7H A;  5CMB A;  3VVE A;  1MXV A;  2M8C A;  3T9H B;  4Z0I A;  3PD8 A;  1BP1 A;  3H6T A;  4OEU A;  4KHZ E;  1H76 A;  3EN3 A;  1MXZ A;  1A8E A;  4ZEC A;  1Z7M E;  1A40 A;  3ILT B;  1MDP 1;  3E8T A;  4DCX A;  4ZDM A;  5I2K B;  1YAE A;  3IR1 A;  1MQI A;  2X26 A;  4IGT A;  4G68 A;  3MUQ A;  3PUX E;  3Q29 A;  1YTV A;  2Z8E A;  1SI1 A;  1B32 A;  1USU B;  2XD2 A;  3ZSF A;  4N13 A;  2PT2 A;  3TAJ A;  1R1N A;  5I2N B;  4AQ4 A;  1QUI A;  1AL3 A;  3MZB A;  2O51 A;  5AA4 A;  1JVY A;  2DP8 A;  3T9V A;  1Y20 A;  1QVS A;  2RCK A;  3ZS6 A;  1B5J A;  1RYO A;  5KDT B;  1PDA A;  3OMB A;  3G7W A;  5H8N B;  1B5I A;  5F1Q A;  3A3C A;  4IO5 A;  1MS7 A;  2QPQ A;  4UA8 A;  5HBC A;  2Q88 A;  2XX8 A;  1PC3 A;  4KYE A;  2QS1 A;  3RT8 A;  5DYH A;  3K0V A;  2V93 A;  5KCJ A;  1LAG E;  4F18 A;  4BLA A;  4U21 A;  1DTG A;  5L9S A;  3VVF A;  4H65 A;  2HAV A;  2P2A A;  2QS2 A;  3TMG A;  1UTB A;  4KPT A;  2IA4 A;  4H67 A;  4EXK A;  2I4B A;  1URD A;  3GZG A;  2I6E A;  2NXO A;  1BP5 A;  3TZA A;  3LSL A;  1BTJ A;  3H4Z A;  3FXQ A;  2O7U A;  4OZ9 A;  4FE8 A;  2KLF A;  3WAF A;  3IOR A;  4EQ7 A;  2QL3 A;  5ISU A;  4K3F A;  4X1D A;  3QUJ A;  1EU8 A;  4E0W A;  1PEB A;  3VDF A;  4YMA A;  1POY 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...