3H4ZA

Crystal structure of an mbp-der p 7 fusion protein
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
568
structure length
568
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYAAGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSAVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAADPIHYDKITEEINKAVDEAVAAIEKSETFDPMKVPDHSDKFERHIGIIDLKGELDMRNIQVRGLKQMKRVGDANVKSEDGVVKAHLLVGVHDDVVSMEYDLAYKLGDLHPNTHVISDIQDFVVELSLEVSEEGNMTLTSFEVRQFANVVNHIGGLSILDPIFAVLSDVLTAIFQDTVRAEMTKVLAPAFKKELERNNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords Maltose-binding periplasmic protein fused with Allergen DERP
publication title The structure of the dust mite allergen Der p 7 reveals similarities to innate immune proteins.
pubmed doi rcsb
source organism Escherichia coli
total genus 167
structure length 568
sequence length 568
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF16984 Grp7_allergen Group 7 allergen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.50 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 3h4zA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3h4zA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3h4zA01
3TKDA 2GHBA 3LSFB 2DVCA 3T66A 4K3FA 4X1DA 5J1DA 1B3EA 3ODBA 4U21A 5H8HB 4FJPA 3MZBA 2NXOA 2P2AA 2RCBA 3UIFA 4OMBA 2I48A 4R9FA 4ZEFA 5BWJA 4G8MA 4I1DA 4HCYA 4GL8A 3WAFA 2O1LA 3UORA 1Y3PA 3OEKA 1SW4A 4IGTA 4DE8A 5KDTB 2QS4A 4YMAA 4C1UA 4YB7A 3B6QA 4M4GA 5H8FA 4RK9A 3K00A 3TMGA 1MQGA 1HSLA 4ZEKA 3U1OA 1XVXA 1IZ1A 3KSJA 3EF7A 4F29A 3T9XB 4IO4A 4NF6B 5I56A 1P1UA 3H06B 2NWJA 3PUYE 5DEXB 1LCFA 3CIJA 3IOUA 1URGA 5BUUA 3QUJA 1LBCA 3IJOB 2R9JA 2G93A 2GHAA 2HAUA 4YICA 1B5IA 5ITPA 4X1BA 5FHOA 3UGWA 2X7PA 3IL1B 3V5AA 3OO6A 2V3TA 2H99A 4G68A 1FQDA 1EU8A 1A55A 3IR1A 3MVYA 3Q27A 3RPWA 2O1MA 3G3HA 4AB5A 1NNFA 3MVXA 4R74A 2IEEA 1SQYA 1N7WA 2F7CA 4F1UA 2HAVA 3FGSA 5DVIA 4QFLA 5L9MA 2DWAA 3UK4A 1ZLQA 1MY3A 1A99A 3GBAA 3SEYA 2V84A 4H65A 3RTFB 2RF1A 5FTHA 3VLWA 5JTYB 3W9VA 4Q5TA 4F22A 2Y7RA 5DVFA 1OVTA 4R75A 3VXCA 1EZPA 5I84A 5CMMA 3U93A 1JVYA 1SW5A 4G68C 2XXTA 3EHSA 1R1NA 3ECRA 5I57A 4O3CA 3N26A 2RKMA 2REJA 4AQ4A 2ZYKA 1LSTA 5EHMA 3FATA 1D9VA 2XXHA 4YKKA 3O6HA 2DE3A 4UACA 3MVZA 1S9TA 1L5TA 3TDJA 3HV1A 3LSLA 4JBZA 2O6AA 2Q9TA 1FQBA 1GGGA 3T22A 1KWHA 4RNSA 2F6PA 3K1NA 2I3VA 3RGYA 1Y1MA 2QS2A 4L17A 4JWXA 4TOZA 1F9BA 1US4A 2NVUB 3EHTA 1P1NA 3G3IA 1MM6A 3VLVA 3K2DA 1AH5A 1MQDA 3ILTB 2DP8A 3H6TA 4HTGA 5H8NB 3GBBA 2DE2A 1FTOA 3V8XB 2QRYA 3QSLA 3S2VA 5H8SA 3H6UA 5L8DA 4MF3A 1MPCA 1FCKA 3T93B 1I6BA 4EXLA 3I5OA 4F19A 2O84X 3EPEA 4IO2A 1FQCA 3M3LA 1B32A 3FXUA 3OSRA 1JVXA 3LSXA 1D4NA 3HO7A 4OYVA 3RY3A 4QF9A 1B52A 1Q35A 1MS7A 1IXIA 3CR9A 3QYTA 3HCQA 4KFQA 5CRYA 1POTA 4QFNA 2F34A 1FW0A 2ONRA 2UVIA 4ZEIA 3PUVE 3TZAA 1JW1A 3PUZE 2DE4A 4LUBA 1AL3A 1LAXA 3HHFA 4DIGA 1PDAA 3MVWA 2I58A 4IB2A 1NL5A 3C32A 3KJ7A 3IOWA 4WEDA 3PD9A 4I9DA 3THIA 1LFGA 1PB8A 2Q2AA 3EN3A 4HCWA 1OIBA 3TEPA 1SDXA 2PX1A 1D3KA 4AB6A 4LZ7A 4F1VA 4OESA 3MP8A 4U22A 4G8HA 1QUJA 5KCJB 4NF8A 2Z23A 4BLAA 4FIMA 1Y3QA 3C31A 2VGQA 1A54A 3MBPA 1PBPA 3D4CA 1LLSA 1SYHA 4DZ1A 4DCXA 4RK2A 2ZNSA 2IA4A 3Q28A 1RYXA 1HSJA 1PB9A 2Y7WA 3PMWA 5I56B 4I62A 5I2KA 3N5LA 4F3GA 3C34A 4F1YA 2P0SA 3A3UA 5H8QA 3TCHA 2AYSA 1Y4CA 4ELPA 3BKIB 1B3FA 4KCCA 3OO8A 1OVBA 2F36A 2ZNTA 2OCUA 1N3XA 3K1MA 3TTKA 2QSXA 3N6TA 3QK6A 4G68B 1N3WA 2OZZA 4DXCA 3S4UA 1PBQA 5L9OA 3V89B 3IO6A 3C36A 2Y84A 2YJPA 3IB1A 3FV2A 3VV5A 3C4MA 4E0XA 3OELA 2HZLA 2HCAA 4ISUA 1CE2A 3KGCA 4N07A 1B5JA 3USDA 2XXYA 2OLBA 4H8IA 4OXVA 4RPOA 2PYYA 4OFOA 1ELJA 1O7TA 3BBRA 4RXLA 3MAMA 1MQHA 3E9XA 4BDNA 5CC2A 4Q30B 2RINA 4XKPA 1MXUA 4BDOA 4F39A 2GH9A 3K6UA 4H67A 1SVXB 2D3IA 4R73A 3U8QA 1OLCA 3QXMA 1J1NA 2Y7KA 3PPOA 3HPIA 3I3VA 5I57B 1AIVA 3DP6A 2Y7IA 1B3HA 2ZYNA 4ZE8A 2X26A 3A3CA 5K2XA 4E0WA 5DT6A 3R6UA 1LAHE 3FXRA 1FTJA 5M2VA 2DWIA 1QKBA 1Z7NE 2XX7A 1UIUA 3PUXE 1IXHA 2M8CA 4QHQA 3OXNA 1N7XA 3FVKA 3O2AA 3KJTA 1ZJLA 2A5TA 2KLFA 1FQEA 4KYEA 4HW8A 1I6AA 3KN7A 1H45A 4GIZA 1FQFA 4KR5A 4Q8RA 1H3DA 4EF2A 3O66A 4EQ7A 1WODA 3PGFA 4ECFA 2ANJA 4ONYA 4FECA 1O63A 2F7AA 4GL0A 1MY4A 5A5XB 2QS3A 3VXBA 1B2HA 4G4PA 4OFJA 3SEWA 3M3FA 4O3BA 5TPAA 1ZTYA 4C0RA 1XOCA 1VSOA 1FTLA 1MQJA 4OERA 2QMWA 3QUFA 5L9SA 3MW0A 3IOVA 3GZGA 3O6IA 2B3FA 4QSCA 5DTBA 3W15C 5AA4A 3VLUA 2H9BA 3MPLA 5TP9A 5B70A 2HQ0A 2Q2CA 1CB6A 1XC1A 3N94A 4THIA 3JYRA 3RT8A 1II5A 5DYHA 4TQUQ 4ZZAA 2XXWA 4IO7A 1QUIA 4KD5A 3B7DA 4RJZA 4ZEDA 2ZYOA 1NMUA 2CMOA 3KG2A 4WKMA 1FQAA 2V25A 4R6YA 3IB0A 1MXWA 2B65A 3K6XA 4IY6A 4ND9A 4LZ5A 2RC8A 4FAJA 5CMCA 3FV1A 4FE8A 4OVJA 1FTMA 2DOJA 1B6HA 4IY5A 1H76A 2UVJA 2H4IA 3S9EA 4FATA 1US5A 3UN6A 3BFUA 3VVEA 4OZ9A 2Q8JA 3JZJA 2ESNA 3FUZA 1T0KA 1JW4A 1IUDA 3VFJA 5CMKA 3TTRA 1URSA 4NF8B 3TELA 4U23A 2E0SA 3DLNA 2PT1A 4XKQA 3TPAA 3G3JA 4U1ZA 3TCFA 1NNPA 2QJEA 3TTLA 1BLFA 3AXFA 3PPQA 3IOTA 2F35A 4JB7A 4QFPA 4GRKA 4RA1A 1VR5A 5I2KB 5I58A 1IXGA 2PMSA 4OETA 3N6UA 4Z7EA 3TTMA 5CBSA 2OWSA 4POXA 3MWBA 3MZ1A 4KQPA 1LFHA 4BDLA 1B4HA 4F3PA 4XIGQ 3SEUA 3SEVA 3RNNA 3IB2A 1O64A 2Z22A 2XXPA 3M3KA 2HZKA 1AMFA 1P1QA 3K6WA 4YKIA 1LB9A 1DPPA 2XD2A 1MH4A 3PPRA 2DVZA 4NWDA 4ESXA 1NH7A 4FEDA 3PPPA 4GQOA 4LONB 1XT8A 1FTKA 5H8HA 2PT2A 3RQTA 3HSTA 3O29A 3TYHA 1BIYA 2ONKE 4KCDA 3KSXA 1UTBA 4QSDA 2Z8EA 3K0VA 4I8CA 3UA8A 3K4UA 2VP1A 1LBBA 2V93A 4N6PA 1USYH 1URDA 3FVNA 4LATA 1USYE 3HHGA 4Z0IA 5KDTA 3MPKA 4X48A 1IITA 1B40A 3O6GA 1JEVA 4LQ5A 1OQHA 5AA1A 2F5XA 3FVGA 5TU0A 3RTWB 3T96B 2Z8FA 3FJ7A 1A40A 5DEXA 2RCAA 5AA3A 1A8FA 1GV8A 1Y9UA 3EHUA 2NOOA 5IKBA 4RYAA 3OO7A 4F2OA 3U94A 1R9LA 1BTJA 3UV1A 2REGA 4BDRA 3KZGA 3PUWE 2UYFA 5AE4A 2Q88A 4QSEA 3L6HA 3L6GA 3RLFE 4NTLA 1OLAA 4R6HA 3MC2A 3ZS6A 4HS7A 2O7UA 2DXYA 2WKYA 2I4CA 1ZKBA 1XS5A 4PETA 4H6DA 4ZE9A 5EHSA 1LGBC 5EYFA 5H8FB 5TPAB 3G3KA 2X7QA 3FJMA 4IGRA 4KPTA 1ANFA 5LOMA 4F3SA 4ELOA 3Q25A 2VD2A 4GWOA 4YMBA 2Y7PA 4WXJA 4UA8A 4U1OA 1EH3A 5AA4B 3JV9A 2G29A 5TP9B 4EUOA 3MUQA 1B46A 2O51A 3S9LC 5ITOA 1DOTA 1H44A 4MLQA 1YAEA 2VOZA 1S7YA 2UXAA 2I49A 3KFMA 1R9QA 2H5YA 2HFBA 3KN8A 1I69A 1MY1A 2HXWA 3LBSA 2H25A 2F7BA 3PMXA 3KN3A 3OEMA 1VFDA 5HM4B 2XX9A 5KZTA 2XXVA 3SEXA 1NFTA 2NUVA 4GOTA 4ZEBA 4MH5A 2O68A 2XXRA 2YPNA 5FHNA 3CFLA 3H6VA 4LP2B 2FYIA 1B05A 2UYEA 4IO5A 3SETA 3E3KA 3RUMA 2O7IA 5AA2A 1IIWA 1I6QA 2QMXA 1B51A 3K6VA 1MH3A 4XKRA 5CM6A 2A5SA 3TFLA 1MRPA 3ILUB 4KI0E 1Q1KA 4NEDA 4R6KA 2QL3A 5FHMA 2ONSA 1JNFA 1B9JA 4JWOA 4C1TA 4PFWA 1M5FA 1R6ZA 1N76A 2YLNA 2OJTA 2ALUA 3Q29A 1D9YA 2BJJX 2DSFA 1MDQA 3MJNA 3EQ1A 1TWYA 1SYIA 5I58B 4TLMB 1RYOA 2I4BA 4H5GA 1JQFA 1LAGE 1ATGA 2XD3A 2HEUA 1B1HA 4ZZEA 4G2ZA 1IQ7A 1OMPA 4QFKA 3B6WA 1B0LA 4F2QA 3H4ZA 4OFLA 3FZVA 3LSWA 1Z7ME 3DP4A 4R2BA 5I59A 2F8DA 4P11A 3O97A 3BFTA 3ZKKA 3F11A 1DMBA 2VHAA 1TFAA 4IO6A 4EXKA 2P1SA 4YU0A 3T9UA 2PVUA 2V3QA 2XX8A 3IORA 4IO3A 4R72A 1MY0A 1TFDA 1UTBB 1UTHA 4LA9A 3GLBA 5CMBA 4EQBA 5I2NA 5KCJA 4MFIA 1TXFA 2Q89A 1XVYA 1B7HA 3IAZA 3CG3A 1HSEA 4PE5B 1P1WA 2ZXTA 3LC8A 3I6VA 3FVOA 1BKAA 1M5BA 2I3WA 4H1XA 5ICTA 3RN8A 4X9TA 2XXQA 1MPDA 1MPBA 1B7UA 1YTVA 1MXXA 4PP0A 2GRVA 2LAOA 4QFOA 1PB7A 1DSNA 3E4RA 1Y1ZA 1N0TA 5HPQA 4NWCA 2XXXA 4GVOA 4DXBA 3OO9A 4POWA 3P7IA 2B3BA 2O69A 4G77A 2H98A 1NH8A 3MP1A 2XXUA 1ZBMA 4BDQA 3UP9A 2AL4A 5FTIA 4GF8A 3TQWA 3OMBA 3U92A 2I0CA 1JEUA 3CVGA 2OK2A 1SI0A 4F31B 2ZMBA 4QRZA 3PD8A 1QULA 4GXSB 1YCJA 3TODA 4P0GA 3LR1A 2OBGA 1N84A 3FD3A 4NF4A 3DELB 4KYDA 3PU5A 2ZYMA 2F78A 2V3UA 4ELQA 4P0IA 1SD3A 4PQJA 1UIVA 1SW1A 2FA7A 1SBPA 2RC7A 3H3GA 1Y3NA 3HN0A 2AL5A 1MXZA 3H7MA 3U72A 4NF5A 1NKXA 4NMYA 4H5FA 4JDFA 4FEBA 4PFUA 5ELVA 3PPNA 2RC9A 4MBPA 3TCGA 5H8QB 4R9GA 4LQ2A 4F18A 2DYXA 3C33A 3OSQA 1M5EA 2FNCA 1EZ9A 4OEVA 3K01A 3SESA 2DQVA 1MXYA 3SDFA 1Y4TA 2D21A 4JSOA 5JK4A 1ZMGA 4MLVA 3TTNA 3S9NC 4ESWA 1GR2A 4GD5A 2R6GE 4YB6A 1SW2A 1POY1 5IAIA 1B3LA 1VFEA 5AA2B 3WAEA 1MG1A 1QW0A 3OD7A 3T9VA 2E1SA 4OHNA 1TT1A 3FASA 3VVFA 4ZDMA 1SI1A 3KOTA 3D4GA 1AOVA 1GTKA 5A5XA 2W7YA 1B0HA 2QPQA 4DCYA 4YZZA 4KHZE 2DXRA 4KYSA 4U4XA 3MP6A 3PV0E 1VE4A 4XKNA 4OWDA 5CBRA 3T9HB 1EZOA 1H43A 3G3FA 3B6TA 4NF6A 3Q26A 4YB5A 3DM0A 4EQ9A 1DTGA 4F3BA 2AIXA 3CRBA 2UVHA 2F97A 1B7ZA 1B1XA 4FORA 4RY1A 3ZKLA 3K02A 4YAHX 2Z8DA 3GXAA 3A09A 3R7XA 3W9WA 4JXIA 1LCTA 3SERA 4DXUA 2CZLA 2XHDA 1IEJA 1WDNA 4GXAA 1JW5A 2R71A 2A5TB 4JWYA 3PMVA 3CFXA 3O9PA 5I59B 1LB8A 3FXQA 5F7VA 5ISUA 5B7DA 3QIMA 3SKPA 3QAXA 1P99A 3CI8A 2QS1A 3DP8A 5F1QA 4PFTA 3G3GA 4YKPA 4R2FA 1S50A 1WVJA 3M8UA 2ABHA 1PC3A 3OENA 4LVQA 3H03A 3C35A 4U4SA 4EDPA 2DWJA 5JTYA 1UTHB 3V83A 4YKJA 3KBRA 4GFRA 1DTZA 1ZIUA 1NNTA 5I2NB 4ZS9A 5HBCA 5DVJA 1XHYA 3VVDA 3OOAA 2THIA 1LAFE 1QUKA 4TLLB 3FJGA 3KEIA 3O28A 4WEPA 3CSBA 4NE4A 4DLDA 3LUYA 2OWTA 3CFZA 4N13A 1MY2A 3IO4A 1NNKA 1IXCA 1M5DA 4BDMA 1M5CA 1P1OA 2XXIA 1JETA 3G7WA 1QKAA 1YPNA 3ZSFA 5AA2D 1OQGA 1A7LA 3CG1A 1A8EA 3ONMA 1ZU0A 3CSGA 4H8JA 4JSDA 4O3AA 3TAJA 4OENA 3S9MC 5K2YA 4H0WA 1BP5A 1DPEA 4U2RA 3C9HA 5ICQA 4G8NA 2DS9A 4PFYA 4Q0CA 1MQIA 2PBWA 4NF4B 4OTEA 3RT6B 5CI5A 1MM7A 1RKMA 5H8NA 3TQLA 4DDDA 1Y20A 4OQOA 4XXUA 1UQWA 1B3GA 1GVCA 2F6GA 4GLIA 1MDP1 1LFIA 1N04A 3VE1B 3IK6B 4RPNA 4M1VA 2D5WA 4NF5B 4EF1A 5JEIA 4LZ8A 2VD3A 3KOSA 3VDFA 4ZECA 3K1PA 3MQ9A 3H6WA 2I6EA 3TUSA 4OEUA 4ELRA 1B4ZA 2GFEA 2I0BA 2DWHA 1B58A 3MZ9A 3IJXB 4XTCQ 2UVGA 3FIRA 1QJMA 1PEBA 3E13X 1MXVA 3R26A 1QVSA 2ZNUA 1B5HA 3IX1A
chains in the Genus database with same CATH superfamily
3TKDA 2GHBA 3LSFB 2DVCA 3T66A 4K3FA 4X1DA 5J1DA 4IR8A 5ET6A 1B3EA 3ODBA 5ET7A 4U21A 5H8HB 4PFIA 3EKIA 4FJPA 3MZBA 1EYIA 2NXOA 2P2AA 1XI6A 5LDZA 2RCBA 3UIFA 4OMBA 2I48A 4MMPA 4R9FA 4ZEFA 5BWJA 4G8MA 4I1DA 4HCYA 4GL8A 3WAFA 2O1LA 3UORA 3U65A 1Y3PA 3OEKA 1SW4A 4IGTA 4JVIA 4DE8A 5KDTB 2QS4A 4YMAA 4C1UA 4YB7A 3B6QA 4M4GA 5H8FA 5IZ1A 4RK9A 3K00A 3TMGA 4F2AA 1MQGA 1HSLA 4ZEKA 3U1OA 1XVXA 1IZ1A 3KSJA 3EF7A 4F29A 3T9XB 4IO4A 4NF6B 5I56A 1P1UA 3H06B 2NWJA 3PUYE 5DEXB 4GWZA 1LBZA 4XF5A 1LCFA 3CIJA 3IOUA 5EQ7A 1URGA 5BUUA 3QUJA 1LBCA 3IJOB 2R9JA 2G93A 2GHAA 2HAUA 4YICA 1B5IA 5ITPA 4X1BA 5FHOA 3UGWA 2VPOA 2X7PA 3IL1B 3V5AA 3OO6A 2V3TA 2H99A 1LBVA 4G68A 1FQDA 1EU8A 1A55A 3IR1A 3MVYA 3Q27A 2FHYA 3RPWA 2O1MA 3G3HA 4AB5A 1NNFA 3MVXA 4R74A 2IEEA 1SQYA 1N7WA 2F7CA 4F1UA 2HAVA 3FGSA 4NQ8A 5DVIA 4QFLA 5L9MA 2DWAA 3UK4A 2CZIA 5LTCA 1ZLQA 1MY3A 1A99A 3GBAA 4MNIA 3SEYA 2V84A 2Y5KA 4H65A 4OVSA 3RTFB 4OA4A 2KQZA 2RF1A 5FTHA 3VLWA 1NV2A 5JTYB 2B4MA 3W9VA 4Q5TA 4F22A 2Y7RA 5DVFA 1OVTA 4R75A 3VXCA 1EZPA 5I84A 3MSTA 5CMMA 3U93A 1JVYA 1SW5A 4G68C 2XXTA 3EHSA 1R1NA 3ECRA 2V4CA 5I57A 4O3CA 3N26A 2P3VA 2RKMA 4I3YA 2OX3A 4G0SA 2REJA 4AQ4A 2ZYKA 1LSTA 5EHMA 1FSAA 3FATA 1D9VA 2XXHA 1FBEA 4YKKA 3O6HA 2DE3A 4UACA 3MVZA 1S9TA 1L5TA 3TDJA 3HV1A 4PFRA 3LSLA 4JBZA 2O6AA 2Q9TA 1FQBA 1GGGA 3T22A 3KC0A 1KWHA 1G0HA 4RNSA 2F6PA 1FPEA 3K1NA 2I3VA 3RGYA 1Y1MA 1IMCA 2QS2A 4L17A 2WBBA 4JWXA 4TOZA 1F9BA 1US4A 2NVUB 3EHTA 4AS4A 4QXDA 1P1NA 3G3IA 1MM6A 3VLVA 3K2DA 5EYHA 4JVCA 1AH5A 3T1BA 1MQDA 3ILTB 1D9QA 4NN3A 4PF6A 1NUZA 2DP8A 3H6TA 4HTGA 1FBGA 5H8NB 3GBBA 2DE2A 1FTOA 3V8XB 2QRYA 3QSLA 3S2VA 5H8SA 3H6UA 5L8DA 4MF3A 1MPCA 1NUXA 1FCKA 3T93B 4O7IA 1I6BA 4EXLA 3I5OA 4F19A 2O84X 3EPEA 4IO2A 3NOHA 1FQCA 3M3LA 1B32A 3FXUA 3OSRA 1JVXA 3LSXA 3KC1A 1D4NA 3HO7A 1LBXA 4OYVA 3RY3A 4QF9A 1B52A 1Q35A 1MS7A 1IXIA 3CR9A 3QYTA 3HCQA 4KFQA 5CRYA 5I7IA 1POTA 4QFNA 4KGOA 4I40A 2F34A 1FW0A 2ONRA 2UVIA 4ZEIA 1BP1A 3PUVE 3TZAA 1JW1A 3PUZE 2DE4A 4P3LA 4LUBA 1AL3A 1LAXA 3HHFA 4DIGA 2WX9A 1PDAA 3MVWA 2I58A 4IB2A 1NL5A 3C32A 3KJ7A 3IOWA 4WEDA 3PD9A 4GBVA 4I9DA 3THIA 1LFGA 4HE0A 1PB8A 2Q2AA 5T3JA 3ZPMA 3EN3A 1LBYA 4HCWA 2L5VA 1OIBA 4N81A 3TEPA 1SDXA 4PDHA 2DDKA 2PX1A 1D3KA 4AB6A 4LZ7A 4O7MA 4F1VA 4OESA 1FPKA 3MP8A 4U22A 4G8HA 2KR0A 1QUJA 5KCJB 4NF8A 1RDXA 2Z23A 5IGAA 4BLAA 3CHGA 4FIMA 1Y3QA 3C31A 2VGQA 1A54A 3MBPA 1PBPA 4MEVA 3D4CA 1LLSA 1SYHA 4DZ1A 4DCXA 4RK2A 2ZNSA 1EYJA 2IA4A 3Q28A 1RYXA 1HSJA 1PB9A 2Y7WA 4DI4B 3PMWA 5I56B 4I62A 5I2KA 3N5LA 4F3GA 3C34A 4F1YA 2P0SA 3A3UA 5H8QA 3TCHA 2AYSA 1Y4CA 4ELPA 3BKIB 1B3FA 4KCCA 3OO8A 4P47A 1OVBA 2F36A 2ZNTA 2OCUA 1N3XA 3K1MA 3TTKA 4MIJA 2QSXA 4PAIA 3N6TA 3QK6A 4G68B 1N3WA 2OZZA 4DXCA 4N15A 3S4UA 1PBQA 5L9OA 3V89B 3IO6A 2ZZWA 2PFYA 3C36A 2Y84A 2YJPA 3IB1A 3FV2A 3VV5A 1USUB 3C4MA 4E0XA 2XWKA 3OELA 2HZLA 2HCAA 4ISUA 1CE2A 3KGCA 5IZ3A 4N07A 1B5JA 3USDA 2FVZA 2XXYA 2OLBA 4H8IA 4OXVA 4RPOA 1IMFA 2PYYA 4OFOA 1ELJA 1O7TA 3BBRA 4RXLA 3MAMA 4NGUA 1MQHA 3E9XA 4BDNA 5CC2A 4Q30B 2RINA 5I3SA 1K9YA 4XKPA 1MXUA 4BDOA 4F39A 2GH9A 2QFLA 3K6UA 4R73A 1SVXB 2D3IA 4H67A 3U8QA 1OLCA 3QXMA 1J1NA 2CEXA 2Y7KA 3PPOA 3HPIA 5ESYA 1YYZA 3I3VA 5I57B 1AIVA 2Q74A 3DP6A 2R8TA 2Y7IA 1B3HA 2WYPA 2ZYNA 4N91A 4ZE8A 2X26A 3A3CA 5K2XA 4E0WA 5DT6A 3R6UA 1LAHE 3IFAA 4OVTA 3FXRA 1FTJA 5M2VA 2DWIA 1QKBA 1Z7NE 2XX7A 1UIUA 2VPNA 3PUXE 1IXHA 2M8CA 4QHQA 1CNQA 3OXNA 1N7XA 3FVKA 3O2AA 5J16A 4N4UA 3KJTA 1ZJLA 2A5TA 2KLFA 1FQEA 1FPDA 4KYEA 4HW8A 1YZ0A 4OVPA 1I6AA 3AOSA 3KN7A 1H45A 4GIZA 1FQFA 4KR5A 4Q8RA 1H3DA 4EF2A 4P9KA 3O66A 4EQ7A 1IMAA 1WODA 3PGFA 4ECFA 2ANJA 2FIXA 4ONYA 4FECA 1O63A 2F7AA 4GL0A 1MY4A 5A5XB 2QS3A 3VXBA 1B2HA 4G4PA 4OFJA 3SEWA 1NUYA 4PCDA 3M3FA 4O3BA 5TPAA 1ZTYA 4C0RA 1XOCA 4PF8A 1VSOA 1FTLA 1MQJA 4OERA 2QMWA 3QUFA 5L9SA 4NF0A 3MW0A 3IOVA 3GZGA 1AWBA 3O6IA 2B3FA 4MCOA 4QSCA 5DTBA 3W15C 5AA4A 3VLUA 2H9BA 3MPLA 3GYYA 5TP9A 5B70A 2HQ0A 2Q2CA 1CB6A 1XC1A 3N94A 4THIA 3JYRA 3RT8A 1II5A 5DYHA 4TQUQ 4ZZAA 2XXWA 4IO7A 4MNCA 1Q9DA 1QUIA 1USVB 4KD5A 3B7DA 4RJZA 4ZEDA 2ZYOA 1NMUA 2CMOA 3KG2A 3T0JA 4WKMA 1FBFA 1FQAA 2QVRA 2V25A 4R6YA 3IB0A 1MXWA 2B65A 3D1RA 1RDZA 3K6XA 4IY6A 4ND9A 4LZ5A 2RC8A 4FAJA 5CMCA 3FV1A 4FE8A 4OVJA 1FTMA 2DOJA 1B6HA 4IY5A 1H76A 2UVJA 2H4IA 3S9EA 4FATA 2XWOA 1US5A 3UN6A 3BFUA 3VVEA 4OZ9A 2Q8JA 3JZJA 3FXBA 2ESNA 3FUZA 4X8RA 1T0KA 1JW4A 4KGHA 1IUDA 4MJOA 3VFJA 5CMKA 1NV0A 3TTRA 1URSA 4NF8B 3TELA 4U23A 2E0SA 3DLNA 2PT1A 4XKQA 1NI9A 3TPAA 3G3JA 4U1ZA 3TCFA 1NNPA 2QJEA 3TTLA 1BLFA 3AXFA 5EQAA 3PPQA 3IOTA 4GX4A 2PFZA 2F35A 4JB7A 4QFPA 4GRKA 4RA1A 1VR5A 5I2KB 5I58A 1IXGA 2PMSA 5IM2A 4OETA 3N6UA 4Z7EA 3TTMA 5CBSA 2OWSA 4POXA 3MWBA 3MZ1A 4KQPA 1LFHA 3FBPA 4BDLA 1B4HA 4F3PA 4XIGQ 3SEUA 3SEVA 3RNNA 3IB2A 1O64A 2Z22A 2XXPA 3M3KA 3MYUA 2HZKA 1AMFA 1P1QA 3K6WA 4GWXA 4YKIA 1LB9A 1DPPA 2XD2A 1MH4A 3PPRA 2DVZA 4NWDA 4ESXA 1NH7A 4FEDA 3A1ZA 3PPPA 4MHFA 4GQOA 1FPLA 4OVRA 4LONB 1XT8A 1FTKA 5H8HA 2PT2A 3RQTA 3HSTA 3O29A 3TYHA 1BIYA 4HXVA 4JVDA 2ONKE 4KCDA 3KSXA 1UTBA 4QSDA 2Z8EA 3K0VA 4I8CA 3UA8A 3RPLA 3K4UA 2VP1A 1LBBA 2V93A 4N6PA 1USYH 1URDA 3FVNA 2GQ1A 4LATA 1USYE 3HHGA 4Z0IA 5KDTA 3MPKA 4X48A 1IITA 1B40A 3O6GA 1JEVA 4LQ5A 4OVQA 1OQHA 5AA1A 2F5XA 3FVGA 1FPIA 5TU0A 3RTWB 3KBZA 3T96B 2Z8FA 3FJ7A 1A40A 5DEXA 4N6DA 2RCAA 5AA3A 1A8FA 1GV8A 1Y9UA 3EHUA 2NOOA 5IKBA 3LUZA 4RYAA 3OO7A 4F2OA 3U94A 1R9LA 3UV1A 1BTJA 2REGA 4BDRA 3ISPA 1SPIA 1DCUA 3KZGA 3PUWE 2UYFA 5AE4A 2Q88A 4QSEA 4PC9A 3L6HA 4PGPA 3L6GA 3RLFE 4NTLA 1OLAA 4R6HA 3LV0A 3MC2A 3ZS6A 4HS7A 2O7UA 2BJIA 2DXYA 2WKYA 2I4CA 1ZKBA 1XS5A 1IMEA 4PETA 4H6DA 5I7KA 5ET8A 1FPJA 4ZE9A 1EWFA 5EHSA 1LGBC 5EYFA 5H8FB 5TPAB 3G3KA 2QVUA 4KXPA 2X7QA 3FJMA 4IGRA 4KPTA 1ANFA 5LOMA 4F3SA 4ELOA 3Q25A 2VD2A 4GWOA 4YMBA 5EYGA 2Y7PA 4PDDA 4WXJA 2F3DA 1NV3A 4UA8A 4U1OA 1EH3A 5AA4B 3JV9A 2G29A 4GX6A 4NAPA 5TP9B 4EUOA 3MUQA 1B46A 2O51A 3S9LC 5ITOA 1DOTA 1H44A 4MLQA 1YAEA 2VOZA 1S7YA 2UXAA 2I49A 3KFMA 1R9QA 2H5YA 4HE2A 2HFBA 3KN8A 1I69A 1MY1A 2HXWA 3LBSA 2H25A 4H45A 1FPGA 2F7BA 3PMXA 3KN3A 3OEMA 1VFDA 5HM4B 2XX9A 5KZTA 2XXVA 1FBHA 3SEXA 1NFTA 2NUVA 4GOTA 4ZEBA 5FBPA 4MH5A 2O68A 2XXRA 2YPNA 5FHNA 2XA5A 3CFLA 3H6VA 4LP2B 2FYIA 1B05A 2UYEA 4IO5A 3SETA 2HXRA 3E3KA 3RUMA 2O7IA 5AA2A 1IIWA 1I6QA 2QMXA 1B51A 3K6VA 1IMBA 1MH3A 4XKRA 5CM6A 2A5SA 3TFLA 4AS5A 1MRPA 3ILUB 4KI0E 1Q1KA 4NEDA 4R6KA 1KZ8A 2QL3A 5FHMA 2ONSA 1JNFA 3B50A 1B9JA 4PE3A 1G0IA 4JWOA 4C1TA 4P1EA 4N8GA 4PFWA 2P3NA 1M5FA 1R6ZA 1N76A 2YLNA 2OJTA 4EWSA 2ALUA 3Q29A 1D9YA 4O8MA 2BJJX 2DSFA 1MDQA 3MJNA 3EQ1A 1TWYA 2XXKA 1SYIA 5I58B 3E8WA 4TLMB 1RYOA 2VT5A 2CZHA 2I4BA 4H5GA 1JQFA 4P8BA 1IMDA 1LAGE 1ATGA 2XD3A 2HEUA 1B1HA 4ZZEA 4G2ZA 1IQ7A 1OMPA 4QFKA 3B6WA 1B0LA 1NV4A 3PTYA 4F2QA 3H4ZA 2WBDA 4OFLA 3FZVA 3LSWA 1Z7ME 3DP4A 4R2BA 5I59A 2F8DA 3QMFA 3O97A 3BFTA 4P11A 5DW8A 3ZKKA 3F11A 4MX6A 5F24A 1DMBA 2VHAA 1TFAA 1FJ9A 4LN5A 4IO6A 1JP4A 4EXKA 2P1SA 4YU0A 1FBPA 3T9UA 2PVUA 2V3QA 2XX8A 3IORA 4IO3A 1FTAA 4R72A 1MY0A 1TFDA 4PTKA 1UTBB 1UTHA 4LA9A 3GLBA 3RPLB 4XEQA 5CMBA 4EQBA 5I2NA 5KCJA 4MFIA 1TXFA 2Q89A 1XVYA 2OWZA 1INPA 1B7HA 3IAZA 3CG3A 4UABA 1HSEA 2OBDA 1FPFA 4PE5B 3ROJA 4DI3D 1P1WA 2JJKA 2ZXTA 3LC8A 3I6VA 3SZPA 3FVOA 1BKAA 1M5BA 1YXIA 1FPBA 2I3WA 4H1XA 5ICTA 4N17A 3RN8A 4X9TA 2XXQA 1MPDA 1MPBA 1B7UA 1YTVA 1MXXA 4PP0A 2GRVA 2LAOA 4QFOA 1PB7A 4XFEA 1DSNA 3E4RA 1Y1ZA 1N0TA 1BK4A 5HPQA 4NWCA 2XXXA 4GVOA 4DXBA 1FBDA 3OO9A 3A29A 4POWA 2PCRA 2B3BA 2O69A 3P7IA 4G77A 2H98A 1NH8A 3MP1A 2XXUA 1ZBMA 4BDQA 3UP9A 4GX3A 4QBAA 3E78A 2AL4A 5FTIA 4GF8A 3TQWA 3OMBA 3U92A 2I0CA 5ET5A 1JEUA 3CVGA 2OK2A 1SI0A 4F31B 2ZMBA 4QRZA 3PD8A 1QULA 4GXSB 1YCJA 3TODA 1KA0A 4P0GA 3LR1A 2OBGA 1QGXA 1N84A 3FD3A 4NF4A 3DELB 4KYDA 3PU5A 2ZYMA 3L6IA 2F78A 2V3UA 4ELQA 4P0IA 1SD3A 4PQJA 1UIVA 1SW1A 2FA7A 1FBCA 4MAGA 1SBPA 2RC7A 3H3GA 1Y3NA 3HN0A 2AL5A 1MXZA 3H7MA 3U72A 4NF5A 5I7LA 1NKXA 4NMYA 2XWIA 4H5FA 4JDFA 4FEBA 4PFUA 5ELVA 3PPNA 2RC9A 4MBPA 3TCGA 5H8QB 3E8TA 4R9GA 1K9ZA 4LQ2A 1NV7A 4F18A 2XWVA 2DYXA 3C33A 3OSQA 1M5EA 2FNCA 4OANA 1EZ9A 4GWUA 4OEVA 3K01A 3SESA 2DQVA 1MXYA 3SDFA 1Y4TA 3AOTA 2D21A 4G61A 4JSOA 5JK4A 1ZMGA 4MLVA 3TTNA 3S9NC 4ESWA 1GR2A 1NV5A 2CEYA 2HPGA 4GD5A 4GWSA 2R6GE 4YB6A 1SW2A 1POY1 5IAIA 1B3LA 4FBPA 5IZ3B 1VFEA 5AA2B 3WAEA 1MG1A 1QW0A 3OD7A 3T9VA 2CZKA 2E1SA 4OHNA 1TT1A 3FASA 3VVFA 4ZDMA 1SI1A 3KOTA 3D4GA 1AOVA 1GTKA 4PAKA 5A5XA 2W7YA 1B0HA 2QPQA 4DCYA 4YZZA 4KHZE 2DXRA 4KYSA 4U4XA 5EQ9A 3MP6A 3PV0E 1VE4A 4XKNA 5IZZA 4OWDA 5CBRA 3T9HB 1EZOA 4PFBA 3N72A 3IFCA 1H43A 3G3FA 4GWWA 3B6TA 4NF6A 3Q26A 4YB5A 3DM0A 4PBHA 1NV1A 4EQ9A 1DTGA 2ZZVA 4F3BA 1FJ6A 2AIXA 3CRBA 4I3EA 2UVHA 2F97A 4P1LA 1B7ZA 1B1XA 2FBPA 3HFUA 4FORA 4RY1A 3ZKLA 3K02A 4GBWA 3BIHA 4YAHX 2Z8DA 3GXAA 3A09A 4PBQA 3R7XA 3E79A 3W9WA 2WEFA 4JXIA 1LCTA 2Y5LA 3SERA 4DXUA 2CZLA 2XHDA 1IEJA 1WDNA 4GXAA 1JW5A 2R71A 2A5TB 4JWYA 3PMVA 3CFXA 3O9PA 5I59B 2WYKA 1LB8A 1FRPA 3FXQA 1NUWA 5F7VA 1RDYA 5ISUA 1VDWA 5B7DA 4X04A 3QIMA 3SKPA 3QAXA 1P99A 3CI8A 2QS1A 3DP8A 4O94A 5F1QA 4PFTA 3G3GA 1LBWA 4YKPA 4R2FA 1S50A 1WVJA 3M8UA 2ABHA 2F3BA 1PC3A 1EYKA 3OENA 4LVQA 3H03A 3C35A 4NG7A 4U4SA 4EDPA 2DWJA 1DK4A 3RYDA 1UTHB 5JTYA 3V83A 4YKJA 3KBRA 2RCKA 4GFRA 1DTZA 1ZIUA 1NNTA 5I2NB 4NHBA 4ZS9A 5HBCA 5DVJA 1XHYA 2FIEA 3VVDA 3OOAA 2THIA 1LAFE 2B4LA 1QUKA 2Q8MA 4TLLB 3FJGA 3KEIA 3O28A 2RQFA 4WEPA 3CSBA 4NE4A 4DLDA 4N8YA 3LUYA 2OWTA 3CFZA 4MNPA 4N13A 1MY2A 3IO4A 1NNKA 1IXCA 1M5DA 4BDMA 1M5CA 4M4DA 1P1OA 1JETA 2XXIA 3G7WA 1QKAA 1YPNA 3ZSFA 2QVVA 5AA2D 1OQGA 4HE1A 1A7LA 3CG1A 4N6KA 1A8EA 2MKZA 3ONMA 5I7JA 1ZU0A 3CSGA 3BIGA 4H8JA 4JSDA 4NX1A 4O3AA 3TAJA 1KA1A 4OENA 3S9MC 5K2YA 4H0WA 1BP5A 1DPEA 4U2RA 3C9HA 5ICQA 4G8NA 1LEVA 2DS9A 2ZZXA 4PFYA 4Q0CA 1MQIA 2PBWA 4NF4B 4OTEA 3RT6B 5CI5A 1MM7A 1RKMA 5H8NA 3TQLA 4DDDA 1Y20A 4OQOA 4XXUA 1UQWA 1B3GA 1GVCA 2F6GA 4GLIA 1MDP1 1N04A 1LFIA 3VE1B 3IK6B 2HHMA 4RPNA 4M1VA 2D5WA 4NF5B 4PAFA 4EF1A 5JEIA 4LZ8A 2VD3A 4PGNA 3KOSA 4GWYA 1DBZA 3VDFA 4ZECA 3K1PA 3MQ9A 3H6WA 2I6EA 3TUSA 4OEUA 4ELRA 1B4ZA 2GFEA 2I0BA 2DWHA 1NV6A 1B58A 3MZ9A 3B8BA 3IJXB 4P56A 4XTCQ 2UVGA 3FIRA 1QJMA 1PEBA 5I5PA 5A5LA 3E13X 1MXVA 4H46A 3R26A 1QVSA 2ZNUA 5EQ8A 1B5HA 3IX1A
chains in the Genus database with same CATH topology
3TKDA 2GHBA 3LSFB 2DVCA 3T66A 4K3FA 4X1DA 5J1DA 1B3EA 3ODBA 4U21A 5H8HB 4FJPA 3MZBA 2NXOA 2P2AA 2RCBA 3UIFA 4OMBA 2I48A 4R9FA 4ZEFA 5BWJA 4G8MA 4I1DA 4HCYA 4GL8A 3WAFA 2O1LA 3UORA 1Y3PA 3OEKA 1SW4A 4IGTA 4DE8A 5KDTB 2QS4A 4YMAA 4C1UA 4YB7A 3B6QA 4M4GA 5H8FA 4RK9A 3K00A 3TMGA 4F2AA 1MQGA 1HSLA 4ZEKA 3U1OA 1XVXA 1IZ1A 3KSJA 3EF7A 4F29A 3T9XB 4IO4A 4NF6B 5I56A 1P1UA 3H06B 2NWJA 3PUYE 5DEXB 1LCFA 3CIJA 3IOUA 1URGA 5BUUA 3QUJA 1LBCA 3IJOB 2R9JA 2G93A 2GHAA 2HAUA 4YICA 1B5IA 5ITPA 4X1BA 5FHOA 3UGWA 2X7PA 3IL1B 3V5AA 3OO6A 2V3TA 2H99A 4G68A 1FQDA 1EU8A 1A55A 3IR1A 3MVYA 3Q27A 3RPWA 2O1MA 3G3HA 4AB5A 1NNFA 3MVXA 4R74A 2IEEA 1SQYA 1N7WA 2F7CA 4F1UA 2HAVA 3FGSA 5DVIA 4QFLA 5L9MA 2DWAA 3UK4A 1ZLQA 1MY3A 1A99A 3GBAA 3SEYA 2V84A 4H65A 3RTFB 2RF1A 5FTHA 3VLWA 5JTYB 3W9VA 4Q5TA 4F22A 2Y7RA 5DVFA 1OVTA 4R75A 3VXCA 1EZPA 5I84A 5CMMA 3U93A 1JVYA 1SW5A 4G68C 2XXTA 3EHSA 1R1NA 3ECRA 5I57A 4O3CA 3N26A 2RKMA 4G0SA 2REJA 4AQ4A 2ZYKA 1LSTA 5EHMA 3FATA 1D9VA 2XXHA 4YKKA 3O6HA 2DE3A 4UACA 3MVZA 1S9TA 1L5TA 3TDJA 3HV1A 3LSLA 4JBZA 2O6AA 2Q9TA 1FQBA 1GGGA 3T22A 1KWHA 4RNSA 2F6PA 3K1NA 2I3VA 3RGYA 1Y1MA 2QS2A 4L17A 4JWXA 4TOZA 1F9BA 1US4A 2NVUB 3EHTA 1P1NA 3G3IA 1MM6A 3VLVA 3K2DA 1AH5A 1MQDA 3ILTB 2DP8A 3H6TA 4HTGA 5H8NB 3GBBA 2DE2A 1FTOA 3V8XB 2QRYA 3QSLA 3S2VA 5H8SA 3H6UA 5L8DA 4MF3A 1MPCA 1FCKA 3T93B 1I6BA 4EXLA 3I5OA 4F19A 2O84X 3EPEA 4IO2A 1FQCA 3M3LA 1B32A 3FXUA 3OSRA 1JVXA 3LSXA 1D4NA 3HO7A 4OYVA 3RY3A 4QF9A 1B52A 1Q35A 1MS7A 1IXIA 3CR9A 3QYTA 3HCQA 4KFQA 5CRYA 1POTA 4QFNA 4KGOA 2F34A 1FW0A 2ONRA 2UVIA 4ZEIA 1BP1A 3PUVE 3TZAA 1JW1A 3PUZE 2DE4A 4LUBA 1AL3A 1LAXA 3HHFA 4DIGA 1PDAA 3MVWA 2I58A 4IB2A 1NL5A 3C32A 3KJ7A 3IOWA 4WEDA 3PD9A 4I9DA 3THIA 1LFGA 1PB8A 2Q2AA 3ZPMA 3EN3A 4HCWA 1OIBA 3TEPA 1SDXA 2PX1A 1D3KA 4AB6A 4LZ7A 4F1VA 4OESA 3MP8A 4U22A 4G8HA 1QUJA 5KCJB 4NF8A 2Z23A 4BLAA 4FIMA 1Y3QA 3C31A 2VGQA 1A54A 3MBPA 1PBPA 3D4CA 1LLSA 1SYHA 4DZ1A 4DCXA 4RK2A 2ZNSA 2IA4A 3Q28A 1RYXA 1HSJA 1PB9A 2Y7WA 3PMWA 5I56B 4I62A 5I2KA 3N5LA 4F3GA 3C34A 4F1YA 2P0SA 3A3UA 5H8QA 3TCHA 2AYSA 1Y4CA 4ELPA 3BKIB 1B3FA 4KCCA 3OO8A 1OVBA 2F36A 2ZNTA 2OCUA 1N3XA 3K1MA 3TTKA 2QSXA 3N6TA 3QK6A 4G68B 1N3WA 2OZZA 4DXCA 3S4UA 1PBQA 5L9OA 3V89B 3IO6A 3C36A 2Y84A 2YJPA 3IB1A 3FV2A 3VV5A 1USUB 3C4MA 4E0XA 3OELA 2HZLA 2HCAA 4ISUA 1CE2A 3KGCA 4N07A 1B5JA 3USDA 2XXYA 2OLBA 4H8IA 4OXVA 4RPOA 2PYYA 4OFOA 1ELJA 1O7TA 3BBRA 4RXLA 3MAMA 1MQHA 3E9XA 4BDNA 5CC2A 4Q30B 2RINA 4XKPA 1MXUA 4BDOA 4F39A 2GH9A 3K6UA 4H67A 1SVXB 2D3IA 4R73A 3U8QA 1OLCA 3QXMA 1J1NA 2Y7KA 3PPOA 3HPIA 3I3VA 5I57B 1AIVA 3DP6A 2Y7IA 1B3HA 2ZYNA 4ZE8A 2X26A 3A3CA 5K2XA 4E0WA 5DT6A 3R6UA 1LAHE 3FXRA 1FTJA 5M2VA 2DWIA 1QKBA 1Z7NE 2XX7A 1UIUA 3PUXE 1IXHA 2M8CA 4QHQA 3OXNA 1N7XA 3FVKA 3O2AA 3KJTA 1ZJLA 2A5TA 2KLFA 1FQEA 4KYEA 4HW8A 1I6AA 3AOSA 3KN7A 1H45A 4GIZA 1FQFA 4KR5A 4Q8RA 1H3DA 4EF2A 3O66A 4EQ7A 1WODA 3PGFA 4ECFA 2ANJA 4ONYA 4FECA 1O63A 2F7AA 4GL0A 1MY4A 5A5XB 2QS3A 3VXBA 1B2HA 4G4PA 4OFJA 3SEWA 3M3FA 4O3BA 5TPAA 1ZTYA 4C0RA 1XOCA 1VSOA 1FTLA 1MQJA 4OERA 2QMWA 3QUFA 5L9SA 3MW0A 3IOVA 3GZGA 3O6IA 2B3FA 4QSCA 5DTBA 3W15C 5AA4A 3VLUA 2H9BA 3MPLA 5TP9A 5B70A 2HQ0A 2Q2CA 1CB6A 1XC1A 3N94A 4THIA 3JYRA 3RT8A 1II5A 5DYHA 4TQUQ 4ZZAA 2XXWA 4IO7A 1QUIA 1USVB 4KD5A 3B7DA 4RJZA 4ZEDA 2ZYOA 1NMUA 2CMOA 3KG2A 4WKMA 1FQAA 2V25A 4R6YA 3IB0A 1MXWA 2B65A 3K6XA 4IY6A 4ND9A 4LZ5A 2RC8A 4FAJA 5CMCA 3FV1A 4FE8A 4OVJA 1FTMA 2DOJA 1B6HA 4IY5A 1H76A 2UVJA 2H4IA 3S9EA 4FATA 1US5A 3UN6A 3BFUA 3VVEA 4OZ9A 2Q8JA 3JZJA 2ESNA 3FUZA 1T0KA 1JW4A 1IUDA 4KGHA 3VFJA 5CMKA 3TTRA 1URSA 4NF8B 3TELA 4U23A 2E0SA 3DLNA 2PT1A 4XKQA 3TPAA 3G3JA 4U1ZA 3TCFA 1NNPA 2QJEA 3TTLA 1BLFA 3AXFA 3PPQA 3IOTA 2F35A 4JB7A 4QFPA 4GRKA 4RA1A 1VR5A 5I2KB 5I58A 1IXGA 2PMSA 4OETA 3N6UA 4Z7EA 3TTMA 5CBSA 2OWSA 4POXA 3MWBA 3MZ1A 4KQPA 1LFHA 4BDLA 1B4HA 4F3PA 4XIGQ 3SEUA 3SEVA 3RNNA 3IB2A 1O64A 2Z22A 2XXPA 3M3KA 2HZKA 1AMFA 1P1QA 3K6WA 4YKIA 1LB9A 1DPPA 2XD2A 1MH4A 3PPRA 2DVZA 4NWDA 4ESXA 1NH7A 4FEDA 3A1ZA 3PPPA 4GQOA 4LONB 1XT8A 1FTKA 5H8HA 2PT2A 3RQTA 3HSTA 3O29A 3TYHA 1BIYA 2ONKE 4KCDA 3KSXA 1UTBA 4QSDA 2Z8EA 3K0VA 4I8CA 3UA8A 3K4UA 2VP1A 1LBBA 2V93A 4N6PA 1USYH 1URDA 3FVNA 4LATA 1USYE 3HHGA 4Z0IA 5KDTA 3MPKA 4X48A 1IITA 1B40A 3O6GA 1JEVA 4LQ5A 1OQHA 5AA1A 2F5XA 3FVGA 5TU0A 3RTWB 3T96B 2Z8FA 3FJ7A 1A40A 5DEXA 2RCAA 5AA3A 1A8FA 1GV8A 1Y9UA 3EHUA 2NOOA 5IKBA 4RYAA 3OO7A 4F2OA 3U94A 1R9LA 1BTJA 3UV1A 2REGA 4BDRA 3KZGA 3PUWE 2UYFA 5AE4A 2Q88A 4QSEA 3L6HA 3L6GA 3RLFE 4NTLA 1OLAA 4R6HA 3MC2A 3ZS6A 4HS7A 2O7UA 2DXYA 2WKYA 2I4CA 1ZKBA 1XS5A 4PETA 4H6DA 5I7KA 4ZE9A 1EWFA 5EHSA 1LGBC 5EYFA 5H8FB 5TPAB 3G3KA 2X7QA 3FJMA 4IGRA 4KPTA 1ANFA 5LOMA 4F3SA 4ELOA 3Q25A 2VD2A 4GWOA 4YMBA 2Y7PA 4WXJA 4UA8A 4U1OA 1EH3A 5AA4B 3JV9A 2G29A 5TP9B 4EUOA 3MUQA 1B46A 2O51A 3S9LC 5ITOA 1DOTA 1H44A 4MLQA 1YAEA 2VOZA 1S7YA 2UXAA 2I49A 3KFMA 1R9QA 2H5YA 2HFBA 3KN8A 1I69A 1MY1A 2HXWA 3LBSA 2H25A 2F7BA 3PMXA 3KN3A 3OEMA 1VFDA 5HM4B 2XX9A 5KZTA 2XXVA 3SEXA 1NFTA 2NUVA 4GOTA 4ZEBA 4MH5A 2O68A 2XXRA 2YPNA 5FHNA 3CFLA 3H6VA 4LP2B 2FYIA 1B05A 2UYEA 4IO5A 3SETA 3E3KA 3RUMA 2O7IA 5AA2A 1IIWA 1I6QA 2QMXA 1B51A 3K6VA 1MH3A 4XKRA 5CM6A 2A5SA 3TFLA 1MRPA 3ILUB 4KI0E 1Q1KA 4NEDA 4R6KA 2QL3A 5FHMA 2ONSA 1JNFA 1B9JA 4JWOA 4C1TA 4PFWA 1M5FA 1R6ZA 1N76A 2YLNA 2OJTA 4EWSA 2ALUA 3Q29A 1D9YA 2BJJX 2DSFA 1MDQA 3MJNA 3EQ1A 1TWYA 1SYIA 5I58B 3E8WA 4TLMB 1RYOA 2I4BA 4H5GA 1JQFA 1LAGE 1ATGA 2XD3A 2HEUA 1B1HA 4ZZEA 4G2ZA 1IQ7A 1OMPA 4QFKA 3B6WA 1B0LA 4F2QA 3H4ZA 4OFLA 3FZVA 3LSWA 1Z7ME 3DP4A 4R2BA 5I59A 2F8DA 4P11A 3O97A 3BFTA 3ZKKA 3F11A 1DMBA 2VHAA 1TFAA 4IO6A 4EXKA 2P1SA 4YU0A 3T9UA 2PVUA 2V3QA 2XX8A 3IORA 4IO3A 4R72A 1MY0A 1TFDA 1UTBB 1UTHA 4LA9A 3GLBA 5CMBA 4EQBA 5I2NA 5KCJA 4MFIA 1TXFA 2Q89A 1XVYA 1B7HA 3IAZA 3CG3A 1HSEA 2OBDA 4PE5B 1P1WA 2ZXTA 3LC8A 3I6VA 3FVOA 1BKAA 1M5BA 2I3WA 4H1XA 5ICTA 3RN8A 4X9TA 2XXQA 1MPDA 1MPBA 1B7UA 1YTVA 1MXXA 4PP0A 2GRVA 2LAOA 4QFOA 1PB7A 1DSNA 3E4RA 1Y1ZA 1N0TA 5HPQA 4NWCA 2XXXA 4GVOA 4DXBA 3OO9A 4POWA 3P7IA 2B3BA 2O69A 4G77A 2H98A 1NH8A 3MP1A 2XXUA 1ZBMA 4BDQA 3UP9A 2AL4A 5FTIA 4GF8A 3TQWA 3OMBA 3U92A 2I0CA 1JEUA 3CVGA 2OK2A 1SI0A 4F31B 2ZMBA 4QRZA 3PD8A 1QULA 4GXSB 1YCJA 3TODA 4P0GA 3LR1A 2OBGA 1N84A 3FD3A 4NF4A 3DELB 4KYDA 3PU5A 2ZYMA 3L6IA 2F78A 2V3UA 4ELQA 4P0IA 1SD3A 4PQJA 1UIVA 1SW1A 2FA7A 1SBPA 2RC7A 3H3GA 1Y3NA 3HN0A 2AL5A 1MXZA 3H7MA 3U72A 4NF5A 5I7LA 1NKXA 4NMYA 4H5FA 4JDFA 4FEBA 4PFUA 5ELVA 3PPNA 2RC9A 4MBPA 3TCGA 5H8QB 3E8TA 4R9GA 4LQ2A 4F18A 2DYXA 3C33A 3OSQA 1M5EA 2FNCA 1EZ9A 4OEVA 3K01A 3SESA 2DQVA 1MXYA 3SDFA 1Y4TA 3AOTA 2D21A 4JSOA 5JK4A 1ZMGA 4MLVA 3TTNA 3S9NC 4ESWA 1GR2A 4GD5A 2R6GE 4YB6A 1SW2A 1POY1 5IAIA 1B3LA 1VFEA 5AA2B 3WAEA 1MG1A 1QW0A 3OD7A 3T9VA 2E1SA 4OHNA 1TT1A 3FASA 3VVFA 4ZDMA 1SI1A 3KOTA 3D4GA 1AOVA 1GTKA 5A5XA 2W7YA 1B0HA 2QPQA 4DCYA 4YZZA 4KHZE 2DXRA 4KYSA 4U4XA 3MP6A 3PV0E 1VE4A 4XKNA 4OWDA 5CBRA 3T9HB 1EZOA 3N72A 1H43A 3G3FA 3B6TA 4NF6A 3Q26A 4YB5A 3DM0A 4EQ9A 1DTGA 4F3BA 2AIXA 3CRBA 2UVHA 2F97A 1B7ZA 1B1XA 4FORA 4RY1A 3ZKLA 3K02A 4YAHX 2Z8DA 3GXAA 3A09A 3R7XA 3W9WA 4JXIA 1LCTA 3SERA 4DXUA 2CZLA 2XHDA 1IEJA 1WDNA 4GXAA 1JW5A 2R71A 2A5TB 4JWYA 3PMVA 3CFXA 3O9PA 5I59B 1LB8A 3FXQA 5F7VA 5ISUA 5B7DA 3QIMA 3SKPA 3QAXA 1P99A 3CI8A 2QS1A 3DP8A 5F1QA 4PFTA 3G3GA 4YKPA 4R2FA 1S50A 1WVJA 3M8UA 2ABHA 1PC3A 3OENA 4LVQA 3H03A 3C35A 4U4SA 4EDPA 2DWJA 5JTYA 1UTHB 3V83A 4YKJA 3KBRA 2RCKA 4GFRA 1DTZA 1ZIUA 1NNTA 5I2NB 4ZS9A 5HBCA 5DVJA 1XHYA 3VVDA 3OOAA 2THIA 1LAFE 1QUKA 4TLLB 3FJGA 3KEIA 3O28A 2RQFA 4WEPA 3CSBA 4NE4A 4DLDA 3LUYA 2OWTA 3CFZA 4N13A 1MY2A 3IO4A 1NNKA 1IXCA 1M5DA 4BDMA 1M5CA 4M4DA 1P1OA 1JETA 2XXIA 3G7WA 1QKAA 1YPNA 3ZSFA 5AA2D 1OQGA 1A7LA 3CG1A 1A8EA 3ONMA 5I7JA 1ZU0A 3CSGA 4H8JA 4JSDA 4O3AA 3TAJA 4OENA 3S9MC 5K2YA 4H0WA 1BP5A 1DPEA 4U2RA 3C9HA 5ICQA 4G8NA 2DS9A 4PFYA 4Q0CA 1MQIA 2PBWA 4NF4B 4OTEA 3RT6B 5CI5A 1MM7A 1RKMA 5H8NA 3TQLA 4DDDA 1Y20A 4OQOA 4XXUA 1UQWA 1B3GA 1GVCA 2F6GA 4GLIA 1MDP1 1LFIA 1N04A 3VE1B 3IK6B 4RPNA 4M1VA 2D5WA 4NF5B 4EF1A 5JEIA 4LZ8A 2VD3A 3KOSA 3VDFA 4ZECA 3K1PA 3MQ9A 3H6WA 2I6EA 3TUSA 4OEUA 4ELRA 1B4ZA 2GFEA 2I0BA 2DWHA 1B58A 3MZ9A 3IJXB 4XTCQ 2UVGA 3FIRA 1QJMA 1PEBA 3E13X 1MXVA 3R26A 1QVSA 2ZNUA 1B5HA 3IX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TKD A;  2GHB A;  3LSF B;  2DVC A;  3T66 A;  4K3F A;  4X1D A;  5J1D A;  1B3E A;  3ODB A;  4U21 A;  5H8H B;  4FJP A;  3MZB A;  2NXO A;  2P2A A;  2RCB A;  3UIF A;  4OMB A;  2I48 A;  4R9F A;  4ZEF A;  5BWJ A;  4G8M A;  4I1D A;  4HCY A;  4GL8 A;  3WAF A;  2O1L A;  3UOR A;  1Y3P A;  3OEK A;  1SW4 A;  4IGT A;  4DE8 A;  5KDT B;  2QS4 A;  4YMA A;  4C1U A;  4YB7 A;  3B6Q A;  4M4G A;  5H8F A;  4RK9 A;  3K00 A;  3TMG A;  1MQG A;  1HSL A;  4ZEK A;  3U1O A;  1XVX A;  1IZ1 A;  3KSJ A;  3EF7 A;  4F29 A;  3T9X B;  4IO4 A;  4NF6 B;  5I56 A;  1P1U A;  3H06 B;  2NWJ A;  3PUY E;  5DEX B;  1LCF A;  3CIJ A;  3IOU A;  1URG A;  5BUU A;  3QUJ A;  1LBC A;  3IJO B;  2R9J A;  2G93 A;  2GHA A;  2HAU A;  4YIC A;  1B5I A;  5ITP A;  4X1B A;  5FHO A;  3UGW A;  2X7P A;  3IL1 B;  3V5A A;  3OO6 A;  2V3T A;  2H99 A;  4G68 A;  1FQD A;  1EU8 A;  1A55 A;  3IR1 A;  3MVY A;  3Q27 A;  3RPW A;  2O1M A;  3G3H A;  4AB5 A;  1NNF A;  3MVX A;  4R74 A;  2IEE A;  1SQY A;  1N7W A;  2F7C A;  4F1U A;  2HAV A;  3FGS A;  5DVI A;  4QFL A;  5L9M A;  2DWA A;  3UK4 A;  1ZLQ A;  1MY3 A;  1A99 A;  3GBA A;  3SEY A;  2V84 A;  4H65 A;  3RTF B;  2RF1 A;  5FTH A;  3VLW A;  5JTY B;  3W9V A;  4Q5T A;  4F22 A;  2Y7R A;  5DVF A;  1OVT A;  4R75 A;  3VXC A;  1EZP A;  5I84 A;  5CMM A;  3U93 A;  1JVY A;  1SW5 A;  4G68 C;  2XXT A;  3EHS A;  1R1N A;  3ECR A;  5I57 A;  4O3C A;  3N26 A;  2RKM A;  2REJ A;  4AQ4 A;  2ZYK A;  1LST A;  5EHM A;  3FAT A;  1D9V A;  2XXH A;  4YKK A;  3O6H A;  2DE3 A;  4UAC A;  3MVZ A;  1S9T A;  1L5T A;  3TDJ A;  3HV1 A;  3LSL A;  4JBZ A;  2O6A A;  2Q9T A;  1FQB A;  1GGG A;  3T22 A;  1KWH A;  4RNS A;  2F6P A;  3K1N A;  2I3V A;  3RGY A;  1Y1M A;  2QS2 A;  4L17 A;  4JWX A;  4TOZ A;  1F9B A;  1US4 A;  2NVU B;  3EHT A;  1P1N A;  3G3I A;  1MM6 A;  3VLV A;  3K2D A;  1AH5 A;  1MQD A;  3ILT B;  2DP8 A;  3H6T A;  4HTG A;  5H8N B;  3GBB A;  2DE2 A;  1FTO A;  3V8X B;  2QRY A;  3QSL A;  3S2V A;  5H8S A;  3H6U A;  5L8D A;  4MF3 A;  1MPC A;  1FCK A;  3T93 B;  1I6B A;  4EXL A;  3I5O A;  4F19 A;  2O84 X;  3EPE A;  4IO2 A;  1FQC A;  3M3L A;  1B32 A;  3FXU A;  3OSR A;  1JVX A;  3LSX A;  1D4N A;  3HO7 A;  4OYV A;  3RY3 A;  4QF9 A;  1B52 A;  1Q35 A;  1MS7 A;  1IXI A;  3CR9 A;  3QYT A;  3HCQ A;  4KFQ A;  5CRY A;  1POT A;  4QFN A;  2F34 A;  1FW0 A;  2ONR A;  2UVI A;  4ZEI A;  3PUV E;  3TZA A;  1JW1 A;  3PUZ E;  2DE4 A;  4LUB A;  1AL3 A;  1LAX A;  3HHF A;  4DIG A;  1PDA A;  3MVW A;  2I58 A;  4IB2 A;  1NL5 A;  3C32 A;  3KJ7 A;  3IOW A;  4WED A;  3PD9 A;  4I9D A;  3THI A;  1LFG A;  1PB8 A;  2Q2A A;  3EN3 A;  4HCW A;  1OIB A;  3TEP A;  1SDX A;  2PX1 A;  1D3K A;  4AB6 A;  4LZ7 A;  4F1V A;  4OES A;  3MP8 A;  4U22 A;  4G8H A;  1QUJ A;  5KCJ B;  4NF8 A;  2Z23 A;  4BLA A;  4FIM A;  1Y3Q A;  3C31 A;  2VGQ A;  1A54 A;  3MBP A;  1PBP A;  3D4C A;  1LLS A;  1SYH A;  4DZ1 A;  4DCX A;  4RK2 A;  2ZNS A;  2IA4 A;  3Q28 A;  1RYX A;  1HSJ A;  1PB9 A;  2Y7W A;  3PMW A;  5I56 B;  4I62 A;  5I2K A;  3N5L A;  4F3G A;  3C34 A;  4F1Y A;  2P0S A;  3A3U A;  5H8Q A;  3TCH A;  2AYS A;  1Y4C A;  4ELP A;  3BKI B;  1B3F A;  4KCC A;  3OO8 A;  1OVB A;  2F36 A;  2ZNT A;  2OCU A;  1N3X A;  3K1M A;  3TTK A;  2QSX A;  3N6T A;  3QK6 A;  4G68 B;  1N3W A;  2OZZ A;  4DXC A;  3S4U A;  1PBQ A;  5L9O A;  3V89 B;  3IO6 A;  3C36 A;  2Y84 A;  2YJP A;  3IB1 A;  3FV2 A;  3VV5 A;  3C4M A;  4E0X A;  3OEL A;  2HZL A;  2HCA A;  4ISU A;  1CE2 A;  3KGC A;  4N07 A;  1B5J A;  3USD A;  2XXY A;  2OLB A;  4H8I A;  4OXV A;  4RPO A;  2PYY A;  4OFO A;  1ELJ A;  1O7T A;  3BBR A;  4RXL A;  3MAM A;  1MQH A;  3E9X A;  4BDN A;  5CC2 A;  4Q30 B;  2RIN A;  4XKP A;  1MXU A;  4BDO A;  4F39 A;  2GH9 A;  3K6U A;  4H67 A;  1SVX B;  2D3I A;  4R73 A;  3U8Q A;  1OLC A;  3QXM A;  1J1N A;  2Y7K A;  3PPO A;  3HPI A;  3I3V A;  5I57 B;  1AIV A;  3DP6 A;  2Y7I A;  1B3H A;  2ZYN A;  4ZE8 A;  2X26 A;  3A3C A;  5K2X A;  4E0W A;  5DT6 A;  3R6U A;  1LAH E;  3FXR A;  1FTJ A;  5M2V A;  2DWI A;  1QKB A;  1Z7N E;  2XX7 A;  1UIU A;  3PUX E;  1IXH A;  2M8C A;  4QHQ A;  3OXN A;  1N7X A;  3FVK A;  3O2A A;  3KJT A;  1ZJL A;  2A5T A;  2KLF A;  1FQE A;  4KYE A;  4HW8 A;  1I6A A;  3KN7 A;  1H45 A;  4GIZ A;  1FQF A;  4KR5 A;  4Q8R A;  1H3D A;  4EF2 A;  3O66 A;  4EQ7 A;  1WOD A;  3PGF A;  4ECF A;  2ANJ A;  4ONY A;  4FEC A;  1O63 A;  2F7A A;  4GL0 A;  1MY4 A;  5A5X B;  2QS3 A;  3VXB A;  1B2H A;  4G4P A;  4OFJ A;  3SEW A;  3M3F A;  4O3B A;  5TPA A;  1ZTY A;  4C0R A;  1XOC A;  1VSO A;  1FTL A;  1MQJ A;  4OER A;  2QMW A;  3QUF A;  5L9S A;  3MW0 A;  3IOV A;  3GZG A;  3O6I A;  2B3F A;  4QSC A;  5DTB A;  3W15 C;  5AA4 A;  3VLU A;  2H9B A;  3MPL A;  5TP9 A;  5B70 A;  2HQ0 A;  2Q2C A;  1CB6 A;  1XC1 A;  3N94 A;  4THI A;  3JYR A;  3RT8 A;  1II5 A;  5DYH A;  4TQU Q;  4ZZA A;  2XXW A;  4IO7 A;  1QUI A;  4KD5 A;  3B7D A;  4RJZ A;  4ZED A;  2ZYO A;  1NMU A;  2CMO A;  3KG2 A;  4WKM A;  1FQA A;  2V25 A;  4R6Y A;  3IB0 A;  1MXW A;  2B65 A;  3K6X A;  4IY6 A;  4ND9 A;  4LZ5 A;  2RC8 A;  4FAJ A;  5CMC A;  3FV1 A;  4FE8 A;  4OVJ A;  1FTM A;  2DOJ A;  1B6H A;  4IY5 A;  1H76 A;  2UVJ A;  2H4I A;  3S9E A;  4FAT A;  1US5 A;  3UN6 A;  3BFU A;  3VVE A;  4OZ9 A;  2Q8J A;  3JZJ A;  2ESN A;  3FUZ A;  1T0K A;  1JW4 A;  1IUD A;  3VFJ A;  5CMK A;  3TTR A;  1URS A;  4NF8 B;  3TEL A;  4U23 A;  2E0S A;  3DLN A;  2PT1 A;  4XKQ A;  3TPA A;  3G3J A;  4U1Z A;  3TCF A;  1NNP A;  2QJE A;  3TTL A;  1BLF A;  3AXF A;  3PPQ A;  3IOT A;  2F35 A;  4JB7 A;  4QFP A;  4GRK A;  4RA1 A;  1VR5 A;  5I2K B;  5I58 A;  1IXG A;  2PMS A;  4OET A;  3N6U A;  4Z7E A;  3TTM A;  5CBS A;  2OWS A;  4POX A;  3MWB A;  3MZ1 A;  4KQP A;  1LFH A;  4BDL A;  1B4H A;  4F3P A;  4XIG Q;  3SEU A;  3SEV A;  3RNN A;  3IB2 A;  1O64 A;  2Z22 A;  2XXP A;  3M3K A;  2HZK A;  1AMF A;  1P1Q A;  3K6W A;  4YKI A;  1LB9 A;  1DPP A;  2XD2 A;  1MH4 A;  3PPR A;  2DVZ A;  4NWD A;  4ESX A;  1NH7 A;  4FED A;  3PPP A;  4GQO A;  4LON B;  1XT8 A;  1FTK A;  5H8H A;  2PT2 A;  3RQT A;  3HST A;  3O29 A;  3TYH A;  1BIY A;  2ONK E;  4KCD A;  3KSX A;  1UTB A;  4QSD A;  2Z8E A;  3K0V A;  4I8C A;  3UA8 A;  3K4U A;  2VP1 A;  1LBB A;  2V93 A;  4N6P A;  1USY H;  1URD A;  3FVN A;  4LAT A;  1USY E;  3HHG A;  4Z0I A;  5KDT A;  3MPK A;  4X48 A;  1IIT A;  1B40 A;  3O6G A;  1JEV A;  4LQ5 A;  1OQH A;  5AA1 A;  2F5X A;  3FVG A;  5TU0 A;  3RTW B;  3T96 B;  2Z8F A;  3FJ7 A;  1A40 A;  5DEX A;  2RCA A;  5AA3 A;  1A8F A;  1GV8 A;  1Y9U A;  3EHU A;  2NOO A;  5IKB A;  4RYA A;  3OO7 A;  4F2O A;  3U94 A;  1R9L A;  1BTJ A;  3UV1 A;  2REG A;  4BDR A;  3KZG A;  3PUW E;  2UYF A;  5AE4 A;  2Q88 A;  4QSE A;  3L6H A;  3L6G A;  3RLF E;  4NTL A;  1OLA A;  4R6H A;  3MC2 A;  3ZS6 A;  4HS7 A;  2O7U A;  2DXY A;  2WKY A;  2I4C A;  1ZKB A;  1XS5 A;  4PET A;  4H6D A;  4ZE9 A;  5EHS A;  1LGB C;  5EYF A;  5H8F B;  5TPA B;  3G3K A;  2X7Q A;  3FJM A;  4IGR A;  4KPT A;  1ANF A;  5LOM A;  4F3S A;  4ELO A;  3Q25 A;  2VD2 A;  4GWO A;  4YMB A;  2Y7P A;  4WXJ A;  4UA8 A;  4U1O A;  1EH3 A;  5AA4 B;  3JV9 A;  2G29 A;  5TP9 B;  4EUO A;  3MUQ A;  1B46 A;  2O51 A;  3S9L C;  5ITO A;  1DOT A;  1H44 A;  4MLQ A;  1YAE A;  2VOZ A;  1S7Y A;  2UXA A;  2I49 A;  3KFM A;  1R9Q A;  2H5Y A;  2HFB A;  3KN8 A;  1I69 A;  1MY1 A;  2HXW A;  3LBS A;  2H25 A;  2F7B A;  3PMX A;  3KN3 A;  3OEM A;  1VFD A;  5HM4 B;  2XX9 A;  5KZT A;  2XXV A;  3SEX A;  1NFT A;  2NUV A;  4GOT A;  4ZEB A;  4MH5 A;  2O68 A;  2XXR A;  2YPN A;  5FHN A;  3CFL A;  3H6V A;  4LP2 B;  2FYI A;  1B05 A;  2UYE A;  4IO5 A;  3SET A;  3E3K A;  3RUM A;  2O7I A;  5AA2 A;  1IIW A;  1I6Q A;  2QMX A;  1B51 A;  3K6V A;  1MH3 A;  4XKR A;  5CM6 A;  2A5S A;  3TFL A;  1MRP A;  3ILU B;  4KI0 E;  1Q1K A;  4NED A;  4R6K A;  2QL3 A;  5FHM A;  2ONS A;  1JNF A;  1B9J A;  4JWO A;  4C1T A;  4PFW A;  1M5F A;  1R6Z A;  1N76 A;  2YLN A;  2OJT A;  2ALU A;  3Q29 A;  1D9Y A;  2BJJ X;  2DSF A;  1MDQ A;  3MJN A;  3EQ1 A;  1TWY A;  1SYI A;  5I58 B;  4TLM B;  1RYO A;  2I4B A;  4H5G A;  1JQF A;  1LAG E;  1ATG A;  2XD3 A;  2HEU A;  1B1H A;  4ZZE A;  4G2Z A;  1IQ7 A;  1OMP A;  4QFK A;  3B6W A;  1B0L A;  4F2Q A;  3H4Z A;  4OFL A;  3FZV A;  3LSW A;  1Z7M E;  3DP4 A;  4R2B A;  5I59 A;  2F8D A;  4P11 A;  3O97 A;  3BFT A;  3ZKK A;  3F11 A;  1DMB A;  2VHA A;  1TFA A;  4IO6 A;  4EXK A;  2P1S A;  4YU0 A;  3T9U A;  2PVU A;  2V3Q A;  2XX8 A;  3IOR A;  4IO3 A;  4R72 A;  1MY0 A;  1TFD A;  1UTB B;  1UTH A;  4LA9 A;  3GLB A;  5CMB A;  4EQB A;  5I2N A;  5KCJ A;  4MFI A;  1TXF A;  2Q89 A;  1XVY A;  1B7H A;  3IAZ A;  3CG3 A;  1HSE A;  4PE5 B;  1P1W A;  2ZXT A;  3LC8 A;  3I6V A;  3FVO A;  1BKA A;  1M5B A;  2I3W A;  4H1X A;  5ICT A;  3RN8 A;  4X9T A;  2XXQ A;  1MPD A;  1MPB A;  1B7U A;  1YTV A;  1MXX A;  4PP0 A;  2GRV A;  2LAO A;  4QFO A;  1PB7 A;  1DSN A;  3E4R A;  1Y1Z A;  1N0T A;  5HPQ A;  4NWC A;  2XXX A;  4GVO A;  4DXB A;  3OO9 A;  4POW A;  3P7I A;  2B3B A;  2O69 A;  4G77 A;  2H98 A;  1NH8 A;  3MP1 A;  2XXU A;  1ZBM A;  4BDQ A;  3UP9 A;  2AL4 A;  5FTI A;  4GF8 A;  3TQW A;  3OMB A;  3U92 A;  2I0C A;  1JEU A;  3CVG A;  2OK2 A;  1SI0 A;  4F31 B;  2ZMB A;  4QRZ A;  3PD8 A;  1QUL A;  4GXS B;  1YCJ A;  3TOD A;  4P0G A;  3LR1 A;  2OBG A;  1N84 A;  3FD3 A;  4NF4 A;  3DEL B;  4KYD A;  3PU5 A;  2ZYM A;  2F78 A;  2V3U A;  4ELQ A;  4P0I A;  1SD3 A;  4PQJ A;  1UIV A;  1SW1 A;  2FA7 A;  1SBP A;  2RC7 A;  3H3G A;  1Y3N A;  3HN0 A;  2AL5 A;  1MXZ A;  3H7M A;  3U72 A;  4NF5 A;  1NKX A;  4NMY A;  4H5F A;  4JDF A;  4FEB A;  4PFU A;  5ELV A;  3PPN A;  2RC9 A;  4MBP A;  3TCG A;  5H8Q B;  4R9G A;  4LQ2 A;  4F18 A;  2DYX A;  3C33 A;  3OSQ A;  1M5E A;  2FNC A;  1EZ9 A;  4OEV A;  3K01 A;  3SES A;  2DQV A;  1MXY A;  3SDF A;  1Y4T A;  2D21 A;  4JSO A;  5JK4 A;  1ZMG A;  4MLV A;  3TTN A;  3S9N C;  4ESW A;  1GR2 A;  4GD5 A;  2R6G E;  4YB6 A;  1SW2 A;  1POY 1;  5IAI A;  1B3L A;  1VFE A;  5AA2 B;  3WAE A;  1MG1 A;  1QW0 A;  3OD7 A;  3T9V A;  2E1S A;  4OHN A;  1TT1 A;  3FAS A;  3VVF A;  4ZDM A;  1SI1 A;  3KOT A;  3D4G A;  1AOV A;  1GTK A;  5A5X A;  2W7Y A;  1B0H A;  2QPQ A;  4DCY A;  4YZZ A;  4KHZ E;  2DXR A;  4KYS A;  4U4X A;  3MP6 A;  3PV0 E;  1VE4 A;  4XKN A;  4OWD A;  5CBR A;  3T9H B;  1EZO A;  1H43 A;  3G3F A;  3B6T A;  4NF6 A;  3Q26 A;  4YB5 A;  3DM0 A;  4EQ9 A;  1DTG A;  4F3B A;  2AIX A;  3CRB A;  2UVH A;  2F97 A;  1B7Z A;  1B1X A;  4FOR A;  4RY1 A;  3ZKL A;  3K02 A;  4YAH X;  2Z8D A;  3GXA A;  3A09 A;  3R7X A;  3W9W A;  4JXI A;  1LCT A;  3SER A;  4DXU A;  2CZL A;  2XHD A;  1IEJ A;  1WDN A;  4GXA A;  1JW5 A;  2R71 A;  2A5T B;  4JWY A;  3PMV A;  3CFX A;  3O9P A;  5I59 B;  1LB8 A;  3FXQ A;  5F7V A;  5ISU A;  5B7D A;  3QIM A;  3SKP A;  3QAX A;  1P99 A;  3CI8 A;  2QS1 A;  3DP8 A;  5F1Q A;  4PFT A;  3G3G A;  4YKP A;  4R2F A;  1S50 A;  1WVJ A;  3M8U A;  2ABH A;  1PC3 A;  3OEN A;  4LVQ A;  3H03 A;  3C35 A;  4U4S A;  4EDP A;  2DWJ A;  5JTY A;  1UTH B;  3V83 A;  4YKJ A;  3KBR A;  4GFR A;  1DTZ A;  1ZIU A;  1NNT A;  5I2N B;  4ZS9 A;  5HBC A;  5DVJ A;  1XHY A;  3VVD A;  3OOA A;  2THI A;  1LAF E;  1QUK A;  4TLL B;  3FJG A;  3KEI A;  3O28 A;  4WEP A;  3CSB A;  4NE4 A;  4DLD A;  3LUY A;  2OWT A;  3CFZ A;  4N13 A;  1MY2 A;  3IO4 A;  1NNK A;  1IXC A;  1M5D A;  4BDM A;  1M5C A;  1P1O A;  2XXI A;  1JET A;  3G7W A;  1QKA A;  1YPN A;  3ZSF A;  5AA2 D;  1OQG A;  1A7L A;  3CG1 A;  1A8E A;  3ONM A;  1ZU0 A;  3CSG A;  4H8J A;  4JSD A;  4O3A A;  3TAJ A;  4OEN A;  3S9M C;  5K2Y A;  4H0W A;  1BP5 A;  1DPE A;  4U2R A;  3C9H A;  5ICQ A;  4G8N A;  2DS9 A;  4PFY A;  4Q0C A;  1MQI A;  2PBW A;  4NF4 B;  4OTE A;  3RT6 B;  5CI5 A;  1MM7 A;  1RKM A;  5H8N A;  3TQL A;  4DDD A;  1Y20 A;  4OQO A;  4XXU A;  1UQW A;  1B3G A;  1GVC A;  2F6G A;  4GLI A;  1MDP 1;  1LFI A;  1N04 A;  3VE1 B;  3IK6 B;  4RPN A;  4M1V A;  2D5W A;  4NF5 B;  4EF1 A;  5JEI A;  4LZ8 A;  2VD3 A;  3KOS A;  3VDF A;  4ZEC A;  3K1P A;  3MQ9 A;  3H6W A;  2I6E A;  3TUS A;  4OEU A;  4ELR A;  1B4Z A;  2GFE A;  2I0B A;  2DWH A;  1B58 A;  3MZ9 A;  3IJX B;  4XTC Q;  2UVG A;  3FIR A;  1QJM A;  1PEB A;  3E13 X;  1MXV A;  3R26 A;  1QVS A;  2ZNU A;  1B5H A;  3IX1 A; 
#chains in the Genus database with same CATH topology
 3TKD A;  2GHB A;  3LSF B;  2DVC A;  3T66 A;  4K3F A;  4X1D A;  5J1D A;  4IR8 A;  5ET6 A;  1B3E A;  3ODB A;  5ET7 A;  4U21 A;  5H8H B;  4PFI A;  3EKI A;  4FJP A;  3MZB A;  1EYI A;  2NXO A;  2P2A A;  1XI6 A;  5LDZ A;  2RCB A;  3UIF A;  4OMB A;  2I48 A;  4MMP A;  4R9F A;  4ZEF A;  5BWJ A;  4G8M A;  4I1D A;  4HCY A;  4GL8 A;  3WAF A;  2O1L A;  3UOR A;  3U65 A;  1Y3P A;  3OEK A;  1SW4 A;  4IGT A;  4JVI A;  4DE8 A;  5KDT B;  2QS4 A;  4YMA A;  4C1U A;  4YB7 A;  3B6Q A;  4M4G A;  5H8F A;  5IZ1 A;  4RK9 A;  3K00 A;  3TMG A;  4F2A A;  1MQG A;  1HSL A;  4ZEK A;  3U1O A;  1XVX A;  1IZ1 A;  3KSJ A;  3EF7 A;  4F29 A;  3T9X B;  4IO4 A;  4NF6 B;  5I56 A;  1P1U A;  3H06 B;  2NWJ A;  3PUY E;  5DEX B;  4GWZ A;  1LBZ A;  4XF5 A;  1LCF A;  3CIJ A;  3IOU A;  5EQ7 A;  1URG A;  5BUU A;  3QUJ A;  1LBC A;  3IJO B;  2R9J A;  2G93 A;  2GHA A;  2HAU A;  4YIC A;  1B5I A;  5ITP A;  4X1B A;  5FHO A;  3UGW A;  2VPO A;  2X7P A;  3IL1 B;  3V5A A;  3OO6 A;  2V3T A;  2H99 A;  1LBV A;  4G68 A;  1FQD A;  1EU8 A;  1A55 A;  3IR1 A;  3MVY A;  3Q27 A;  2FHY A;  3RPW A;  2O1M A;  3G3H A;  4AB5 A;  1NNF A;  3MVX A;  4R74 A;  2IEE A;  1SQY A;  1N7W A;  2F7C A;  4F1U A;  2HAV A;  3FGS A;  4NQ8 A;  5DVI A;  4QFL A;  5L9M A;  2DWA A;  3UK4 A;  2CZI A;  5LTC A;  1ZLQ A;  1MY3 A;  1A99 A;  3GBA A;  4MNI A;  3SEY A;  2V84 A;  2Y5K A;  4H65 A;  4OVS A;  3RTF B;  4OA4 A;  2KQZ A;  2RF1 A;  5FTH A;  3VLW A;  1NV2 A;  5JTY B;  2B4M A;  3W9V A;  4Q5T A;  4F22 A;  2Y7R A;  5DVF A;  1OVT A;  4R75 A;  3VXC A;  1EZP A;  5I84 A;  3MST A;  5CMM A;  3U93 A;  1JVY A;  1SW5 A;  4G68 C;  2XXT A;  3EHS A;  1R1N A;  3ECR A;  2V4C A;  5I57 A;  4O3C A;  3N26 A;  2P3V A;  2RKM A;  4I3Y A;  2OX3 A;  4G0S A;  2REJ A;  4AQ4 A;  2ZYK A;  1LST A;  5EHM A;  1FSA A;  3FAT A;  1D9V A;  2XXH A;  1FBE A;  4YKK A;  3O6H A;  2DE3 A;  4UAC A;  3MVZ A;  1S9T A;  1L5T A;  3TDJ A;  3HV1 A;  4PFR A;  3LSL A;  4JBZ A;  2O6A A;  2Q9T A;  1FQB A;  1GGG A;  3T22 A;  3KC0 A;  1KWH A;  1G0H A;  4RNS A;  2F6P A;  1FPE A;  3K1N A;  2I3V A;  3RGY A;  1Y1M A;  1IMC A;  2QS2 A;  4L17 A;  2WBB A;  4JWX A;  4TOZ A;  1F9B A;  1US4 A;  2NVU B;  3EHT A;  4AS4 A;  4QXD A;  1P1N A;  3G3I A;  1MM6 A;  3VLV A;  3K2D A;  5EYH A;  4JVC A;  1AH5 A;  3T1B A;  1MQD A;  3ILT B;  1D9Q A;  4NN3 A;  4PF6 A;  1NUZ A;  2DP8 A;  3H6T A;  4HTG A;  1FBG A;  5H8N B;  3GBB A;  2DE2 A;  1FTO A;  3V8X B;  2QRY A;  3QSL A;  3S2V A;  5H8S A;  3H6U A;  5L8D A;  4MF3 A;  1MPC A;  1NUX A;  1FCK A;  3T93 B;  4O7I A;  1I6B A;  4EXL A;  3I5O A;  4F19 A;  2O84 X;  3EPE A;  4IO2 A;  3NOH A;  1FQC A;  3M3L A;  1B32 A;  3FXU A;  3OSR A;  1JVX A;  3LSX A;  3KC1 A;  1D4N A;  3HO7 A;  1LBX A;  4OYV A;  3RY3 A;  4QF9 A;  1B52 A;  1Q35 A;  1MS7 A;  1IXI A;  3CR9 A;  3QYT A;  3HCQ A;  4KFQ A;  5CRY A;  5I7I A;  1POT A;  4QFN A;  4KGO A;  4I40 A;  2F34 A;  1FW0 A;  2ONR A;  2UVI A;  4ZEI A;  1BP1 A;  3PUV E;  3TZA A;  1JW1 A;  3PUZ E;  2DE4 A;  4P3L A;  4LUB A;  1AL3 A;  1LAX A;  3HHF A;  4DIG A;  2WX9 A;  1PDA A;  3MVW A;  2I58 A;  4IB2 A;  1NL5 A;  3C32 A;  3KJ7 A;  3IOW A;  4WED A;  3PD9 A;  4GBV A;  4I9D A;  3THI A;  1LFG A;  4HE0 A;  1PB8 A;  2Q2A A;  5T3J A;  3ZPM A;  3EN3 A;  1LBY A;  4HCW A;  2L5V A;  1OIB A;  4N81 A;  3TEP A;  1SDX A;  4PDH A;  2DDK A;  2PX1 A;  1D3K A;  4AB6 A;  4LZ7 A;  4O7M A;  4F1V A;  4OES A;  1FPK A;  3MP8 A;  4U22 A;  4G8H A;  2KR0 A;  1QUJ A;  5KCJ B;  4NF8 A;  1RDX A;  2Z23 A;  5IGA A;  4BLA A;  3CHG A;  4FIM A;  1Y3Q A;  3C31 A;  2VGQ A;  1A54 A;  3MBP A;  1PBP A;  4MEV A;  3D4C A;  1LLS A;  1SYH A;  4DZ1 A;  4DCX A;  4RK2 A;  2ZNS A;  1EYJ A;  2IA4 A;  3Q28 A;  1RYX A;  1HSJ A;  1PB9 A;  2Y7W A;  4DI4 B;  3PMW A;  5I56 B;  4I62 A;  5I2K A;  3N5L A;  4F3G A;  3C34 A;  4F1Y A;  2P0S A;  3A3U A;  5H8Q A;  3TCH A;  2AYS A;  1Y4C A;  4ELP A;  3BKI B;  1B3F A;  4KCC A;  3OO8 A;  4P47 A;  1OVB A;  2F36 A;  2ZNT A;  2OCU A;  1N3X A;  3K1M A;  3TTK A;  4MIJ A;  2QSX A;  4PAI A;  3N6T A;  3QK6 A;  4G68 B;  1N3W A;  2OZZ A;  4DXC A;  4N15 A;  3S4U A;  1PBQ A;  5L9O A;  3V89 B;  3IO6 A;  2ZZW A;  2PFY A;  3C36 A;  2Y84 A;  2YJP A;  3IB1 A;  3FV2 A;  3VV5 A;  1USU B;  3C4M A;  4E0X A;  2XWK A;  3OEL A;  2HZL A;  2HCA A;  4ISU A;  1CE2 A;  3KGC A;  5IZ3 A;  4N07 A;  1B5J A;  3USD A;  2FVZ A;  2XXY A;  2OLB A;  4H8I A;  4OXV A;  4RPO A;  1IMF A;  2PYY A;  4OFO A;  1ELJ A;  1O7T A;  3BBR A;  4RXL A;  3MAM A;  4NGU A;  1MQH A;  3E9X A;  4BDN A;  5CC2 A;  4Q30 B;  2RIN A;  5I3S A;  1K9Y A;  4XKP A;  1MXU A;  4BDO A;  4F39 A;  2GH9 A;  2QFL A;  3K6U A;  4R73 A;  1SVX B;  2D3I A;  4H67 A;  3U8Q A;  1OLC A;  3QXM A;  1J1N A;  2CEX A;  2Y7K A;  3PPO A;  3HPI A;  5ESY A;  1YYZ A;  3I3V A;  5I57 B;  1AIV A;  2Q74 A;  3DP6 A;  2R8T A;  2Y7I A;  1B3H A;  2WYP A;  2ZYN A;  4N91 A;  4ZE8 A;  2X26 A;  3A3C A;  5K2X A;  4E0W A;  5DT6 A;  3R6U A;  1LAH E;  3IFA A;  4OVT A;  3FXR A;  1FTJ A;  5M2V A;  2DWI A;  1QKB A;  1Z7N E;  2XX7 A;  1UIU A;  2VPN A;  3PUX E;  1IXH A;  2M8C A;  4QHQ A;  1CNQ A;  3OXN A;  1N7X A;  3FVK A;  3O2A A;  5J16 A;  4N4U A;  3KJT A;  1ZJL A;  2A5T A;  2KLF A;  1FQE A;  1FPD A;  4KYE A;  4HW8 A;  1YZ0 A;  4OVP A;  1I6A A;  3AOS A;  3KN7 A;  1H45 A;  4GIZ A;  1FQF A;  4KR5 A;  4Q8R A;  1H3D A;  4EF2 A;  4P9K A;  3O66 A;  4EQ7 A;  1IMA A;  1WOD A;  3PGF A;  4ECF A;  2ANJ A;  2FIX A;  4ONY A;  4FEC A;  1O63 A;  2F7A A;  4GL0 A;  1MY4 A;  5A5X B;  2QS3 A;  3VXB A;  1B2H A;  4G4P A;  4OFJ A;  3SEW A;  1NUY A;  4PCD A;  3M3F A;  4O3B A;  5TPA A;  1ZTY A;  4C0R A;  1XOC A;  4PF8 A;  1VSO A;  1FTL A;  1MQJ A;  4OER A;  2QMW A;  3QUF A;  5L9S A;  4NF0 A;  3MW0 A;  3IOV A;  3GZG A;  1AWB A;  3O6I A;  2B3F A;  4MCO A;  4QSC A;  5DTB A;  3W15 C;  5AA4 A;  3VLU A;  2H9B A;  3MPL A;  3GYY A;  5TP9 A;  5B70 A;  2HQ0 A;  2Q2C A;  1CB6 A;  1XC1 A;  3N94 A;  4THI A;  3JYR A;  3RT8 A;  1II5 A;  5DYH A;  4TQU Q;  4ZZA A;  2XXW A;  4IO7 A;  4MNC A;  1Q9D A;  1QUI A;  1USV B;  4KD5 A;  3B7D A;  4RJZ A;  4ZED A;  2ZYO A;  1NMU A;  2CMO A;  3KG2 A;  3T0J A;  4WKM A;  1FBF A;  1FQA A;  2QVR A;  2V25 A;  4R6Y A;  3IB0 A;  1MXW A;  2B65 A;  3D1R A;  1RDZ A;  3K6X A;  4IY6 A;  4ND9 A;  4LZ5 A;  2RC8 A;  4FAJ A;  5CMC A;  3FV1 A;  4FE8 A;  4OVJ A;  1FTM A;  2DOJ A;  1B6H A;  4IY5 A;  1H76 A;  2UVJ A;  2H4I A;  3S9E A;  4FAT A;  2XWO A;  1US5 A;  3UN6 A;  3BFU A;  3VVE A;  4OZ9 A;  2Q8J A;  3JZJ A;  3FXB A;  2ESN A;  3FUZ A;  4X8R A;  1T0K A;  1JW4 A;  4KGH A;  1IUD A;  4MJO A;  3VFJ A;  5CMK A;  1NV0 A;  3TTR A;  1URS A;  4NF8 B;  3TEL A;  4U23 A;  2E0S A;  3DLN A;  2PT1 A;  4XKQ A;  1NI9 A;  3TPA A;  3G3J A;  4U1Z A;  3TCF A;  1NNP A;  2QJE A;  3TTL A;  1BLF A;  3AXF A;  5EQA A;  3PPQ A;  3IOT A;  4GX4 A;  2PFZ A;  2F35 A;  4JB7 A;  4QFP A;  4GRK A;  4RA1 A;  1VR5 A;  5I2K B;  5I58 A;  1IXG A;  2PMS A;  5IM2 A;  4OET A;  3N6U A;  4Z7E A;  3TTM A;  5CBS A;  2OWS A;  4POX A;  3MWB A;  3MZ1 A;  4KQP A;  1LFH A;  3FBP A;  4BDL A;  1B4H A;  4F3P A;  4XIG Q;  3SEU A;  3SEV A;  3RNN A;  3IB2 A;  1O64 A;  2Z22 A;  2XXP A;  3M3K A;  3MYU A;  2HZK A;  1AMF A;  1P1Q A;  3K6W A;  4GWX A;  4YKI A;  1LB9 A;  1DPP A;  2XD2 A;  1MH4 A;  3PPR A;  2DVZ A;  4NWD A;  4ESX A;  1NH7 A;  4FED A;  3A1Z A;  3PPP A;  4MHF A;  4GQO A;  1FPL A;  4OVR A;  4LON B;  1XT8 A;  1FTK A;  5H8H A;  2PT2 A;  3RQT A;  3HST A;  3O29 A;  3TYH A;  1BIY A;  4HXV A;  4JVD A;  2ONK E;  4KCD A;  3KSX A;  1UTB A;  4QSD A;  2Z8E A;  3K0V A;  4I8C A;  3UA8 A;  3RPL A;  3K4U A;  2VP1 A;  1LBB A;  2V93 A;  4N6P A;  1USY H;  1URD A;  3FVN A;  2GQ1 A;  4LAT A;  1USY E;  3HHG A;  4Z0I A;  5KDT A;  3MPK A;  4X48 A;  1IIT A;  1B40 A;  3O6G A;  1JEV A;  4LQ5 A;  4OVQ A;  1OQH A;  5AA1 A;  2F5X A;  3FVG A;  1FPI A;  5TU0 A;  3RTW B;  3KBZ A;  3T96 B;  2Z8F A;  3FJ7 A;  1A40 A;  5DEX A;  4N6D A;  2RCA A;  5AA3 A;  1A8F A;  1GV8 A;  1Y9U A;  3EHU A;  2NOO A;  5IKB A;  3LUZ A;  4RYA A;  3OO7 A;  4F2O A;  3U94 A;  1R9L A;  3UV1 A;  1BTJ A;  2REG A;  4BDR A;  3ISP A;  1SPI A;  1DCU A;  3KZG A;  3PUW E;  2UYF A;  5AE4 A;  2Q88 A;  4QSE A;  4PC9 A;  3L6H A;  4PGP A;  3L6G A;  3RLF E;  4NTL A;  1OLA A;  4R6H A;  3LV0 A;  3MC2 A;  3ZS6 A;  4HS7 A;  2O7U A;  2BJI A;  2DXY A;  2WKY A;  2I4C A;  1ZKB A;  1XS5 A;  1IME A;  4PET A;  4H6D A;  5I7K A;  5ET8 A;  1FPJ A;  4ZE9 A;  1EWF A;  5EHS A;  1LGB C;  5EYF A;  5H8F B;  5TPA B;  3G3K A;  2QVU A;  4KXP A;  2X7Q A;  3FJM A;  4IGR A;  4KPT A;  1ANF A;  5LOM A;  4F3S A;  4ELO A;  3Q25 A;  2VD2 A;  4GWO A;  4YMB A;  5EYG A;  2Y7P A;  4PDD A;  4WXJ A;  2F3D A;  1NV3 A;  4UA8 A;  4U1O A;  1EH3 A;  5AA4 B;  3JV9 A;  2G29 A;  4GX6 A;  4NAP A;  5TP9 B;  4EUO A;  3MUQ A;  1B46 A;  2O51 A;  3S9L C;  5ITO A;  1DOT A;  1H44 A;  4MLQ A;  1YAE A;  2VOZ A;  1S7Y A;  2UXA A;  2I49 A;  3KFM A;  1R9Q A;  2H5Y A;  4HE2 A;  2HFB A;  3KN8 A;  1I69 A;  1MY1 A;  2HXW A;  3LBS A;  2H25 A;  4H45 A;  1FPG A;  2F7B A;  3PMX A;  3KN3 A;  3OEM A;  1VFD A;  5HM4 B;  2XX9 A;  5KZT A;  2XXV A;  1FBH A;  3SEX A;  1NFT A;  2NUV A;  4GOT A;  4ZEB A;  5FBP A;  4MH5 A;  2O68 A;  2XXR A;  2YPN A;  5FHN A;  2XA5 A;  3CFL A;  3H6V A;  4LP2 B;  2FYI A;  1B05 A;  2UYE A;  4IO5 A;  3SET A;  2HXR A;  3E3K A;  3RUM A;  2O7I A;  5AA2 A;  1IIW A;  1I6Q A;  2QMX A;  1B51 A;  3K6V A;  1IMB A;  1MH3 A;  4XKR A;  5CM6 A;  2A5S A;  3TFL A;  4AS5 A;  1MRP A;  3ILU B;  4KI0 E;  1Q1K A;  4NED A;  4R6K A;  1KZ8 A;  2QL3 A;  5FHM A;  2ONS A;  1JNF A;  3B50 A;  1B9J A;  4PE3 A;  1G0I A;  4JWO A;  4C1T A;  4P1E A;  4N8G A;  4PFW A;  2P3N A;  1M5F A;  1R6Z A;  1N76 A;  2YLN A;  2OJT A;  4EWS A;  2ALU A;  3Q29 A;  1D9Y A;  4O8M A;  2BJJ X;  2DSF A;  1MDQ A;  3MJN A;  3EQ1 A;  1TWY A;  2XXK A;  1SYI A;  5I58 B;  3E8W A;  4TLM B;  1RYO A;  2VT5 A;  2CZH A;  2I4B A;  4H5G A;  1JQF A;  4P8B A;  1IMD A;  1LAG E;  1ATG A;  2XD3 A;  2HEU A;  1B1H A;  4ZZE A;  4G2Z A;  1IQ7 A;  1OMP A;  4QFK A;  3B6W A;  1B0L A;  1NV4 A;  3PTY A;  4F2Q A;  3H4Z A;  2WBD A;  4OFL A;  3FZV A;  3LSW A;  1Z7M E;  3DP4 A;  4R2B A;  5I59 A;  2F8D A;  3QMF A;  3O97 A;  3BFT A;  4P11 A;  5DW8 A;  3ZKK A;  3F11 A;  4MX6 A;  5F24 A;  1DMB A;  2VHA A;  1TFA A;  1FJ9 A;  4LN5 A;  4IO6 A;  1JP4 A;  4EXK A;  2P1S A;  4YU0 A;  1FBP A;  3T9U A;  2PVU A;  2V3Q A;  2XX8 A;  3IOR A;  4IO3 A;  1FTA A;  4R72 A;  1MY0 A;  1TFD A;  4PTK A;  1UTB B;  1UTH A;  4LA9 A;  3GLB A;  3RPL B;  4XEQ A;  5CMB A;  4EQB A;  5I2N A;  5KCJ A;  4MFI A;  1TXF A;  2Q89 A;  1XVY A;  2OWZ A;  1INP A;  1B7H A;  3IAZ A;  3CG3 A;  4UAB A;  1HSE A;  2OBD A;  1FPF A;  4PE5 B;  3ROJ A;  4DI3 D;  1P1W A;  2JJK A;  2ZXT A;  3LC8 A;  3I6V A;  3SZP A;  3FVO A;  1BKA A;  1M5B A;  1YXI A;  1FPB A;  2I3W A;  4H1X A;  5ICT A;  4N17 A;  3RN8 A;  4X9T A;  2XXQ A;  1MPD A;  1MPB A;  1B7U A;  1YTV A;  1MXX A;  4PP0 A;  2GRV A;  2LAO A;  4QFO A;  1PB7 A;  4XFE A;  1DSN A;  3E4R A;  1Y1Z A;  1N0T A;  1BK4 A;  5HPQ A;  4NWC A;  2XXX A;  4GVO A;  4DXB A;  1FBD A;  3OO9 A;  3A29 A;  4POW A;  2PCR A;  2B3B A;  2O69 A;  3P7I A;  4G77 A;  2H98 A;  1NH8 A;  3MP1 A;  2XXU A;  1ZBM A;  4BDQ A;  3UP9 A;  4GX3 A;  4QBA A;  3E78 A;  2AL4 A;  5FTI A;  4GF8 A;  3TQW A;  3OMB A;  3U92 A;  2I0C A;  5ET5 A;  1JEU A;  3CVG A;  2OK2 A;  1SI0 A;  4F31 B;  2ZMB A;  4QRZ A;  3PD8 A;  1QUL A;  4GXS B;  1YCJ A;  3TOD A;  1KA0 A;  4P0G A;  3LR1 A;  2OBG A;  1QGX A;  1N84 A;  3FD3 A;  4NF4 A;  3DEL B;  4KYD A;  3PU5 A;  2ZYM A;  3L6I A;  2F78 A;  2V3U A;  4ELQ A;  4P0I A;  1SD3 A;  4PQJ A;  1UIV A;  1SW1 A;  2FA7 A;  1FBC A;  4MAG A;  1SBP A;  2RC7 A;  3H3G A;  1Y3N A;  3HN0 A;  2AL5 A;  1MXZ A;  3H7M A;  3U72 A;  4NF5 A;  5I7L A;  1NKX A;  4NMY A;  2XWI A;  4H5F A;  4JDF A;  4FEB A;  4PFU A;  5ELV A;  3PPN A;  2RC9 A;  4MBP A;  3TCG A;  5H8Q B;  3E8T A;  4R9G A;  1K9Z A;  4LQ2 A;  1NV7 A;  4F18 A;  2XWV A;  2DYX A;  3C33 A;  3OSQ A;  1M5E A;  2FNC A;  4OAN A;  1EZ9 A;  4GWU A;  4OEV A;  3K01 A;  3SES A;  2DQV A;  1MXY A;  3SDF A;  1Y4T A;  3AOT A;  2D21 A;  4G61 A;  4JSO A;  5JK4 A;  1ZMG A;  4MLV A;  3TTN A;  3S9N C;  4ESW A;  1GR2 A;  1NV5 A;  2CEY A;  2HPG A;  4GD5 A;  4GWS A;  2R6G E;  4YB6 A;  1SW2 A;  1POY 1;  5IAI A;  1B3L A;  4FBP A;  5IZ3 B;  1VFE A;  5AA2 B;  3WAE A;  1MG1 A;  1QW0 A;  3OD7 A;  3T9V A;  2CZK A;  2E1S A;  4OHN A;  1TT1 A;  3FAS A;  3VVF A;  4ZDM A;  1SI1 A;  3KOT A;  3D4G A;  1AOV A;  1GTK A;  4PAK A;  5A5X A;  2W7Y A;  1B0H A;  2QPQ A;  4DCY A;  4YZZ A;  4KHZ E;  2DXR A;  4KYS A;  4U4X A;  5EQ9 A;  3MP6 A;  3PV0 E;  1VE4 A;  4XKN A;  5IZZ A;  4OWD A;  5CBR A;  3T9H B;  1EZO A;  4PFB A;  3N72 A;  3IFC A;  1H43 A;  3G3F A;  4GWW A;  3B6T A;  4NF6 A;  3Q26 A;  4YB5 A;  3DM0 A;  4PBH A;  1NV1 A;  4EQ9 A;  1DTG A;  2ZZV A;  4F3B A;  1FJ6 A;  2AIX A;  3CRB A;  4I3E A;  2UVH A;  2F97 A;  4P1L A;  1B7Z A;  1B1X A;  2FBP A;  3HFU A;  4FOR A;  4RY1 A;  3ZKL A;  3K02 A;  4GBW A;  3BIH A;  4YAH X;  2Z8D A;  3GXA A;  3A09 A;  4PBQ A;  3R7X A;  3E79 A;  3W9W A;  2WEF A;  4JXI A;  1LCT A;  2Y5L A;  3SER A;  4DXU A;  2CZL A;  2XHD A;  1IEJ A;  1WDN A;  4GXA A;  1JW5 A;  2R71 A;  2A5T B;  4JWY A;  3PMV A;  3CFX A;  3O9P A;  5I59 B;  2WYK A;  1LB8 A;  1FRP A;  3FXQ A;  1NUW A;  5F7V A;  1RDY A;  5ISU A;  1VDW A;  5B7D A;  4X04 A;  3QIM A;  3SKP A;  3QAX A;  1P99 A;  3CI8 A;  2QS1 A;  3DP8 A;  4O94 A;  5F1Q A;  4PFT A;  3G3G A;  1LBW A;  4YKP A;  4R2F A;  1S50 A;  1WVJ A;  3M8U A;  2ABH A;  2F3B A;  1PC3 A;  1EYK A;  3OEN A;  4LVQ A;  3H03 A;  3C35 A;  4NG7 A;  4U4S A;  4EDP A;  2DWJ A;  1DK4 A;  3RYD A;  1UTH B;  5JTY A;  3V83 A;  4YKJ A;  3KBR A;  2RCK A;  4GFR A;  1DTZ A;  1ZIU A;  1NNT A;  5I2N B;  4NHB A;  4ZS9 A;  5HBC A;  5DVJ A;  1XHY A;  2FIE A;  3VVD A;  3OOA A;  2THI A;  1LAF E;  2B4L A;  1QUK A;  2Q8M A;  4TLL B;  3FJG A;  3KEI A;  3O28 A;  2RQF A;  4WEP A;  3CSB A;  4NE4 A;  4DLD A;  4N8Y A;  3LUY A;  2OWT A;  3CFZ A;  4MNP A;  4N13 A;  1MY2 A;  3IO4 A;  1NNK A;  1IXC A;  1M5D A;  4BDM A;  1M5C A;  4M4D A;  1P1O A;  1JET A;  2XXI A;  3G7W A;  1QKA A;  1YPN A;  3ZSF A;  2QVV A;  5AA2 D;  1OQG A;  4HE1 A;  1A7L A;  3CG1 A;  4N6K A;  1A8E A;  2MKZ A;  3ONM A;  5I7J A;  1ZU0 A;  3CSG A;  3BIG A;  4H8J A;  4JSD A;  4NX1 A;  4O3A A;  3TAJ A;  1KA1 A;  4OEN A;  3S9M C;  5K2Y A;  4H0W A;  1BP5 A;  1DPE A;  4U2R A;  3C9H A;  5ICQ A;  4G8N A;  1LEV A;  2DS9 A;  2ZZX A;  4PFY A;  4Q0C A;  1MQI A;  2PBW A;  4NF4 B;  4OTE A;  3RT6 B;  5CI5 A;  1MM7 A;  1RKM A;  5H8N A;  3TQL A;  4DDD A;  1Y20 A;  4OQO A;  4XXU A;  1UQW A;  1B3G A;  1GVC A;  2F6G A;  4GLI A;  1MDP 1;  1N04 A;  1LFI A;  3VE1 B;  3IK6 B;  2HHM A;  4RPN A;  4M1V A;  2D5W A;  4NF5 B;  4PAF A;  4EF1 A;  5JEI A;  4LZ8 A;  2VD3 A;  4PGN A;  3KOS A;  4GWY A;  1DBZ A;  3VDF A;  4ZEC A;  3K1P A;  3MQ9 A;  3H6W A;  2I6E A;  3TUS A;  4OEU A;  4ELR A;  1B4Z A;  2GFE A;  2I0B A;  2DWH A;  1NV6 A;  1B58 A;  3MZ9 A;  3B8B A;  3IJX B;  4P56 A;  4XTC Q;  2UVG A;  3FIR A;  1QJM A;  1PEB A;  5I5P A;  5A5L A;  3E13 X;  1MXV A;  4H46 A;  3R26 A;  1QVS A;  2ZNU A;  5EQ8 A;  1B5H A;  3IX1 A; 
#chains in the Genus database with same CATH homology
 3TKD A;  2GHB A;  3LSF B;  2DVC A;  3T66 A;  4K3F A;  4X1D A;  5J1D A;  1B3E A;  3ODB A;  4U21 A;  5H8H B;  4FJP A;  3MZB A;  2NXO A;  2P2A A;  2RCB A;  3UIF A;  4OMB A;  2I48 A;  4R9F A;  4ZEF A;  5BWJ A;  4G8M A;  4I1D A;  4HCY A;  4GL8 A;  3WAF A;  2O1L A;  3UOR A;  1Y3P A;  3OEK A;  1SW4 A;  4IGT A;  4DE8 A;  5KDT B;  2QS4 A;  4YMA A;  4C1U A;  4YB7 A;  3B6Q A;  4M4G A;  5H8F A;  4RK9 A;  3K00 A;  3TMG A;  4F2A A;  1MQG A;  1HSL A;  4ZEK A;  3U1O A;  1XVX A;  1IZ1 A;  3KSJ A;  3EF7 A;  4F29 A;  3T9X B;  4IO4 A;  4NF6 B;  5I56 A;  1P1U A;  3H06 B;  2NWJ A;  3PUY E;  5DEX B;  1LCF A;  3CIJ A;  3IOU A;  1URG A;  5BUU A;  3QUJ A;  1LBC A;  3IJO B;  2R9J A;  2G93 A;  2GHA A;  2HAU A;  4YIC A;  1B5I A;  5ITP A;  4X1B A;  5FHO A;  3UGW A;  2X7P A;  3IL1 B;  3V5A A;  3OO6 A;  2V3T A;  2H99 A;  4G68 A;  1FQD A;  1EU8 A;  1A55 A;  3IR1 A;  3MVY A;  3Q27 A;  3RPW A;  2O1M A;  3G3H A;  4AB5 A;  1NNF A;  3MVX A;  4R74 A;  2IEE A;  1SQY A;  1N7W A;  2F7C A;  4F1U A;  2HAV A;  3FGS A;  5DVI A;  4QFL A;  5L9M A;  2DWA A;  3UK4 A;  1ZLQ A;  1MY3 A;  1A99 A;  3GBA A;  3SEY A;  2V84 A;  4H65 A;  3RTF B;  2RF1 A;  5FTH A;  3VLW A;  5JTY B;  3W9V A;  4Q5T A;  4F22 A;  2Y7R A;  5DVF A;  1OVT A;  4R75 A;  3VXC A;  1EZP A;  5I84 A;  5CMM A;  3U93 A;  1JVY A;  1SW5 A;  4G68 C;  2XXT A;  3EHS A;  1R1N A;  3ECR A;  5I57 A;  4O3C A;  3N26 A;  2RKM A;  4G0S A;  2REJ A;  4AQ4 A;  2ZYK A;  1LST A;  5EHM A;  3FAT A;  1D9V A;  2XXH A;  4YKK A;  3O6H A;  2DE3 A;  4UAC A;  3MVZ A;  1S9T A;  1L5T A;  3TDJ A;  3HV1 A;  3LSL A;  4JBZ A;  2O6A A;  2Q9T A;  1FQB A;  1GGG A;  3T22 A;  1KWH A;  4RNS A;  2F6P A;  3K1N A;  2I3V A;  3RGY A;  1Y1M A;  2QS2 A;  4L17 A;  4JWX A;  4TOZ A;  1F9B A;  1US4 A;  2NVU B;  3EHT A;  1P1N A;  3G3I A;  1MM6 A;  3VLV A;  3K2D A;  1AH5 A;  1MQD A;  3ILT B;  2DP8 A;  3H6T A;  4HTG A;  5H8N B;  3GBB A;  2DE2 A;  1FTO A;  3V8X B;  2QRY A;  3QSL A;  3S2V A;  5H8S A;  3H6U A;  5L8D A;  4MF3 A;  1MPC A;  1FCK A;  3T93 B;  1I6B A;  4EXL A;  3I5O A;  4F19 A;  2O84 X;  3EPE A;  4IO2 A;  1FQC A;  3M3L A;  1B32 A;  3FXU A;  3OSR A;  1JVX A;  3LSX A;  1D4N A;  3HO7 A;  4OYV A;  3RY3 A;  4QF9 A;  1B52 A;  1Q35 A;  1MS7 A;  1IXI A;  3CR9 A;  3QYT A;  3HCQ A;  4KFQ A;  5CRY A;  1POT A;  4QFN A;  4KGO A;  2F34 A;  1FW0 A;  2ONR A;  2UVI A;  4ZEI A;  1BP1 A;  3PUV E;  3TZA A;  1JW1 A;  3PUZ E;  2DE4 A;  4LUB A;  1AL3 A;  1LAX A;  3HHF A;  4DIG A;  1PDA A;  3MVW A;  2I58 A;  4IB2 A;  1NL5 A;  3C32 A;  3KJ7 A;  3IOW A;  4WED A;  3PD9 A;  4I9D A;  3THI A;  1LFG A;  1PB8 A;  2Q2A A;  3ZPM A;  3EN3 A;  4HCW A;  1OIB A;  3TEP A;  1SDX A;  2PX1 A;  1D3K A;  4AB6 A;  4LZ7 A;  4F1V A;  4OES A;  3MP8 A;  4U22 A;  4G8H A;  1QUJ A;  5KCJ B;  4NF8 A;  2Z23 A;  4BLA A;  4FIM A;  1Y3Q A;  3C31 A;  2VGQ A;  1A54 A;  3MBP A;  1PBP A;  3D4C A;  1LLS A;  1SYH A;  4DZ1 A;  4DCX A;  4RK2 A;  2ZNS A;  2IA4 A;  3Q28 A;  1RYX A;  1HSJ A;  1PB9 A;  2Y7W A;  3PMW A;  5I56 B;  4I62 A;  5I2K A;  3N5L A;  4F3G A;  3C34 A;  4F1Y A;  2P0S A;  3A3U A;  5H8Q A;  3TCH A;  2AYS A;  1Y4C A;  4ELP A;  3BKI B;  1B3F A;  4KCC A;  3OO8 A;  1OVB A;  2F36 A;  2ZNT A;  2OCU A;  1N3X A;  3K1M A;  3TTK A;  2QSX A;  3N6T A;  3QK6 A;  4G68 B;  1N3W A;  2OZZ A;  4DXC A;  3S4U A;  1PBQ A;  5L9O A;  3V89 B;  3IO6 A;  3C36 A;  2Y84 A;  2YJP A;  3IB1 A;  3FV2 A;  3VV5 A;  1USU B;  3C4M A;  4E0X A;  3OEL A;  2HZL A;  2HCA A;  4ISU A;  1CE2 A;  3KGC A;  4N07 A;  1B5J A;  3USD A;  2XXY A;  2OLB A;  4H8I A;  4OXV A;  4RPO A;  2PYY A;  4OFO A;  1ELJ A;  1O7T A;  3BBR A;  4RXL A;  3MAM A;  1MQH A;  3E9X A;  4BDN A;  5CC2 A;  4Q30 B;  2RIN A;  4XKP A;  1MXU A;  4BDO A;  4F39 A;  2GH9 A;  3K6U A;  4H67 A;  1SVX B;  2D3I A;  4R73 A;  3U8Q A;  1OLC A;  3QXM A;  1J1N A;  2Y7K A;  3PPO A;  3HPI A;  3I3V A;  5I57 B;  1AIV A;  3DP6 A;  2Y7I A;  1B3H A;  2ZYN A;  4ZE8 A;  2X26 A;  3A3C A;  5K2X A;  4E0W A;  5DT6 A;  3R6U A;  1LAH E;  3FXR A;  1FTJ A;  5M2V A;  2DWI A;  1QKB A;  1Z7N E;  2XX7 A;  1UIU A;  3PUX E;  1IXH A;  2M8C A;  4QHQ A;  3OXN A;  1N7X A;  3FVK A;  3O2A A;  3KJT A;  1ZJL A;  2A5T A;  2KLF A;  1FQE A;  4KYE A;  4HW8 A;  1I6A A;  3AOS A;  3KN7 A;  1H45 A;  4GIZ A;  1FQF A;  4KR5 A;  4Q8R A;  1H3D A;  4EF2 A;  3O66 A;  4EQ7 A;  1WOD A;  3PGF A;  4ECF A;  2ANJ A;  4ONY A;  4FEC A;  1O63 A;  2F7A A;  4GL0 A;  1MY4 A;  5A5X B;  2QS3 A;  3VXB A;  1B2H A;  4G4P A;  4OFJ A;  3SEW A;  3M3F A;  4O3B A;  5TPA A;  1ZTY A;  4C0R A;  1XOC A;  1VSO A;  1FTL A;  1MQJ A;  4OER A;  2QMW A;  3QUF A;  5L9S A;  3MW0 A;  3IOV A;  3GZG A;  3O6I A;  2B3F A;  4QSC A;  5DTB A;  3W15 C;  5AA4 A;  3VLU A;  2H9B A;  3MPL A;  5TP9 A;  5B70 A;  2HQ0 A;  2Q2C A;  1CB6 A;  1XC1 A;  3N94 A;  4THI A;  3JYR A;  3RT8 A;  1II5 A;  5DYH A;  4TQU Q;  4ZZA A;  2XXW A;  4IO7 A;  1QUI A;  1USV B;  4KD5 A;  3B7D A;  4RJZ A;  4ZED A;  2ZYO A;  1NMU A;  2CMO A;  3KG2 A;  4WKM A;  1FQA A;  2V25 A;  4R6Y A;  3IB0 A;  1MXW A;  2B65 A;  3K6X A;  4IY6 A;  4ND9 A;  4LZ5 A;  2RC8 A;  4FAJ A;  5CMC A;  3FV1 A;  4FE8 A;  4OVJ A;  1FTM A;  2DOJ A;  1B6H A;  4IY5 A;  1H76 A;  2UVJ A;  2H4I A;  3S9E A;  4FAT A;  1US5 A;  3UN6 A;  3BFU A;  3VVE A;  4OZ9 A;  2Q8J A;  3JZJ A;  2ESN A;  3FUZ A;  1T0K A;  1JW4 A;  1IUD A;  4KGH A;  3VFJ A;  5CMK A;  3TTR A;  1URS A;  4NF8 B;  3TEL A;  4U23 A;  2E0S A;  3DLN A;  2PT1 A;  4XKQ A;  3TPA A;  3G3J A;  4U1Z A;  3TCF A;  1NNP A;  2QJE A;  3TTL A;  1BLF A;  3AXF A;  3PPQ A;  3IOT A;  2F35 A;  4JB7 A;  4QFP A;  4GRK A;  4RA1 A;  1VR5 A;  5I2K B;  5I58 A;  1IXG A;  2PMS A;  4OET A;  3N6U A;  4Z7E A;  3TTM A;  5CBS A;  2OWS A;  4POX A;  3MWB A;  3MZ1 A;  4KQP A;  1LFH A;  4BDL A;  1B4H A;  4F3P A;  4XIG Q;  3SEU A;  3SEV A;  3RNN A;  3IB2 A;  1O64 A;  2Z22 A;  2XXP A;  3M3K A;  2HZK A;  1AMF A;  1P1Q A;  3K6W A;  4YKI A;  1LB9 A;  1DPP A;  2XD2 A;  1MH4 A;  3PPR A;  2DVZ A;  4NWD A;  4ESX A;  1NH7 A;  4FED A;  3A1Z A;  3PPP A;  4GQO A;  4LON B;  1XT8 A;  1FTK A;  5H8H A;  2PT2 A;  3RQT A;  3HST A;  3O29 A;  3TYH A;  1BIY A;  2ONK E;  4KCD A;  3KSX A;  1UTB A;  4QSD A;  2Z8E A;  3K0V A;  4I8C A;  3UA8 A;  3K4U A;  2VP1 A;  1LBB A;  2V93 A;  4N6P A;  1USY H;  1URD A;  3FVN A;  4LAT A;  1USY E;  3HHG A;  4Z0I A;  5KDT A;  3MPK A;  4X48 A;  1IIT A;  1B40 A;  3O6G A;  1JEV A;  4LQ5 A;  1OQH A;  5AA1 A;  2F5X A;  3FVG A;  5TU0 A;  3RTW B;  3T96 B;  2Z8F A;  3FJ7 A;  1A40 A;  5DEX A;  2RCA A;  5AA3 A;  1A8F A;  1GV8 A;  1Y9U A;  3EHU A;  2NOO A;  5IKB A;  4RYA A;  3OO7 A;  4F2O A;  3U94 A;  1R9L A;  1BTJ A;  3UV1 A;  2REG A;  4BDR A;  3KZG A;  3PUW E;  2UYF A;  5AE4 A;  2Q88 A;  4QSE A;  3L6H A;  3L6G A;  3RLF E;  4NTL A;  1OLA A;  4R6H A;  3MC2 A;  3ZS6 A;  4HS7 A;  2O7U A;  2DXY A;  2WKY A;  2I4C A;  1ZKB A;  1XS5 A;  4PET A;  4H6D A;  5I7K A;  4ZE9 A;  1EWF A;  5EHS A;  1LGB C;  5EYF A;  5H8F B;  5TPA B;  3G3K A;  2X7Q A;  3FJM A;  4IGR A;  4KPT A;  1ANF A;  5LOM A;  4F3S A;  4ELO A;  3Q25 A;  2VD2 A;  4GWO A;  4YMB A;  2Y7P A;  4WXJ A;  4UA8 A;  4U1O A;  1EH3 A;  5AA4 B;  3JV9 A;  2G29 A;  5TP9 B;  4EUO A;  3MUQ A;  1B46 A;  2O51 A;  3S9L C;  5ITO A;  1DOT A;  1H44 A;  4MLQ A;  1YAE A;  2VOZ A;  1S7Y A;  2UXA A;  2I49 A;  3KFM A;  1R9Q A;  2H5Y A;  2HFB A;  3KN8 A;  1I69 A;  1MY1 A;  2HXW A;  3LBS A;  2H25 A;  2F7B A;  3PMX A;  3KN3 A;  3OEM A;  1VFD A;  5HM4 B;  2XX9 A;  5KZT A;  2XXV A;  3SEX A;  1NFT A;  2NUV A;  4GOT A;  4ZEB A;  4MH5 A;  2O68 A;  2XXR A;  2YPN A;  5FHN A;  3CFL A;  3H6V A;  4LP2 B;  2FYI A;  1B05 A;  2UYE A;  4IO5 A;  3SET A;  3E3K A;  3RUM A;  2O7I A;  5AA2 A;  1IIW A;  1I6Q A;  2QMX A;  1B51 A;  3K6V A;  1MH3 A;  4XKR A;  5CM6 A;  2A5S A;  3TFL A;  1MRP A;  3ILU B;  4KI0 E;  1Q1K A;  4NED A;  4R6K A;  2QL3 A;  5FHM A;  2ONS A;  1JNF A;  1B9J A;  4JWO A;  4C1T A;  4PFW A;  1M5F A;  1R6Z A;  1N76 A;  2YLN A;  2OJT A;  4EWS A;  2ALU A;  3Q29 A;  1D9Y A;  2BJJ X;  2DSF A;  1MDQ A;  3MJN A;  3EQ1 A;  1TWY A;  1SYI A;  5I58 B;  3E8W A;  4TLM B;  1RYO A;  2I4B A;  4H5G A;  1JQF A;  1LAG E;  1ATG A;  2XD3 A;  2HEU A;  1B1H A;  4ZZE A;  4G2Z A;  1IQ7 A;  1OMP A;  4QFK A;  3B6W A;  1B0L A;  4F2Q A;  3H4Z A;  4OFL A;  3FZV A;  3LSW A;  1Z7M E;  3DP4 A;  4R2B A;  5I59 A;  2F8D A;  4P11 A;  3O97 A;  3BFT A;  3ZKK A;  3F11 A;  1DMB A;  2VHA A;  1TFA A;  4IO6 A;  4EXK A;  2P1S A;  4YU0 A;  3T9U A;  2PVU A;  2V3Q A;  2XX8 A;  3IOR A;  4IO3 A;  4R72 A;  1MY0 A;  1TFD A;  1UTB B;  1UTH A;  4LA9 A;  3GLB A;  5CMB A;  4EQB A;  5I2N A;  5KCJ A;  4MFI A;  1TXF A;  2Q89 A;  1XVY A;  1B7H A;  3IAZ A;  3CG3 A;  1HSE A;  2OBD A;  4PE5 B;  1P1W A;  2ZXT A;  3LC8 A;  3I6V A;  3FVO A;  1BKA A;  1M5B A;  2I3W A;  4H1X A;  5ICT A;  3RN8 A;  4X9T A;  2XXQ A;  1MPD A;  1MPB A;  1B7U A;  1YTV A;  1MXX A;  4PP0 A;  2GRV A;  2LAO A;  4QFO A;  1PB7 A;  1DSN A;  3E4R A;  1Y1Z A;  1N0T A;  5HPQ A;  4NWC A;  2XXX A;  4GVO A;  4DXB A;  3OO9 A;  4POW A;  3P7I A;  2B3B A;  2O69 A;  4G77 A;  2H98 A;  1NH8 A;  3MP1 A;  2XXU A;  1ZBM A;  4BDQ A;  3UP9 A;  2AL4 A;  5FTI A;  4GF8 A;  3TQW A;  3OMB A;  3U92 A;  2I0C A;  1JEU A;  3CVG A;  2OK2 A;  1SI0 A;  4F31 B;  2ZMB A;  4QRZ A;  3PD8 A;  1QUL A;  4GXS B;  1YCJ A;  3TOD A;  4P0G A;  3LR1 A;  2OBG A;  1N84 A;  3FD3 A;  4NF4 A;  3DEL B;  4KYD A;  3PU5 A;  2ZYM A;  3L6I A;  2F78 A;  2V3U A;  4ELQ A;  4P0I A;  1SD3 A;  4PQJ A;  1UIV A;  1SW1 A;  2FA7 A;  1SBP A;  2RC7 A;  3H3G A;  1Y3N A;  3HN0 A;  2AL5 A;  1MXZ A;  3H7M A;  3U72 A;  4NF5 A;  5I7L A;  1NKX A;  4NMY A;  4H5F A;  4JDF A;  4FEB A;  4PFU A;  5ELV A;  3PPN A;  2RC9 A;  4MBP A;  3TCG A;  5H8Q B;  3E8T A;  4R9G A;  4LQ2 A;  4F18 A;  2DYX A;  3C33 A;  3OSQ A;  1M5E A;  2FNC A;  1EZ9 A;  4OEV A;  3K01 A;  3SES A;  2DQV A;  1MXY A;  3SDF A;  1Y4T A;  3AOT A;  2D21 A;  4JSO A;  5JK4 A;  1ZMG A;  4MLV A;  3TTN A;  3S9N C;  4ESW A;  1GR2 A;  4GD5 A;  2R6G E;  4YB6 A;  1SW2 A;  1POY 1;  5IAI A;  1B3L A;  1VFE A;  5AA2 B;  3WAE A;  1MG1 A;  1QW0 A;  3OD7 A;  3T9V A;  2E1S A;  4OHN A;  1TT1 A;  3FAS A;  3VVF A;  4ZDM A;  1SI1 A;  3KOT A;  3D4G A;  1AOV A;  1GTK A;  5A5X A;  2W7Y A;  1B0H A;  2QPQ A;  4DCY A;  4YZZ A;  4KHZ E;  2DXR A;  4KYS A;  4U4X A;  3MP6 A;  3PV0 E;  1VE4 A;  4XKN A;  4OWD A;  5CBR A;  3T9H B;  1EZO A;  3N72 A;  1H43 A;  3G3F A;  3B6T A;  4NF6 A;  3Q26 A;  4YB5 A;  3DM0 A;  4EQ9 A;  1DTG A;  4F3B A;  2AIX A;  3CRB A;  2UVH A;  2F97 A;  1B7Z A;  1B1X A;  4FOR A;  4RY1 A;  3ZKL A;  3K02 A;  4YAH X;  2Z8D A;  3GXA A;  3A09 A;  3R7X A;  3W9W A;  4JXI A;  1LCT A;  3SER A;  4DXU A;  2CZL A;  2XHD A;  1IEJ A;  1WDN A;  4GXA A;  1JW5 A;  2R71 A;  2A5T B;  4JWY A;  3PMV A;  3CFX A;  3O9P A;  5I59 B;  1LB8 A;  3FXQ A;  5F7V A;  5ISU A;  5B7D A;  3QIM A;  3SKP A;  3QAX A;  1P99 A;  3CI8 A;  2QS1 A;  3DP8 A;  5F1Q A;  4PFT A;  3G3G A;  4YKP A;  4R2F A;  1S50 A;  1WVJ A;  3M8U A;  2ABH A;  1PC3 A;  3OEN A;  4LVQ A;  3H03 A;  3C35 A;  4U4S A;  4EDP A;  2DWJ A;  5JTY A;  1UTH B;  3V83 A;  4YKJ A;  3KBR A;  2RCK A;  4GFR A;  1DTZ A;  1ZIU A;  1NNT A;  5I2N B;  4ZS9 A;  5HBC A;  5DVJ A;  1XHY A;  3VVD A;  3OOA A;  2THI A;  1LAF E;  1QUK A;  4TLL B;  3FJG A;  3KEI A;  3O28 A;  2RQF A;  4WEP A;  3CSB A;  4NE4 A;  4DLD A;  3LUY A;  2OWT A;  3CFZ A;  4N13 A;  1MY2 A;  3IO4 A;  1NNK A;  1IXC A;  1M5D A;  4BDM A;  1M5C A;  4M4D A;  1P1O A;  1JET A;  2XXI A;  3G7W A;  1QKA A;  1YPN A;  3ZSF A;  5AA2 D;  1OQG A;  1A7L A;  3CG1 A;  1A8E A;  3ONM A;  5I7J A;  1ZU0 A;  3CSG A;  4H8J A;  4JSD A;  4O3A A;  3TAJ A;  4OEN A;  3S9M C;  5K2Y A;  4H0W A;  1BP5 A;  1DPE A;  4U2R A;  3C9H A;  5ICQ A;  4G8N A;  2DS9 A;  4PFY A;  4Q0C A;  1MQI A;  2PBW A;  4NF4 B;  4OTE A;  3RT6 B;  5CI5 A;  1MM7 A;  1RKM A;  5H8N A;  3TQL A;  4DDD A;  1Y20 A;  4OQO A;  4XXU A;  1UQW A;  1B3G A;  1GVC A;  2F6G A;  4GLI A;  1MDP 1;  1LFI A;  1N04 A;  3VE1 B;  3IK6 B;  4RPN A;  4M1V A;  2D5W A;  4NF5 B;  4EF1 A;  5JEI A;  4LZ8 A;  2VD3 A;  3KOS A;  3VDF A;  4ZEC A;  3K1P A;  3MQ9 A;  3H6W A;  2I6E A;  3TUS A;  4OEU A;  4ELR A;  1B4Z A;  2GFE A;  2I0B A;  2DWH A;  1B58 A;  3MZ9 A;  3IJX B;  4XTC Q;  2UVG A;  3FIR A;  1QJM A;  1PEB A;  3E13 X;  1MXV A;  3R26 A;  1QVS A;  2ZNU A;  1B5H A;  3IX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...