1USVB

The structure of the complex between aha1 and hsp90
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
143
structure length
143
Chain Sequence
b'WVDKNCIGWAKEYFKQKLVGVEAGSVKDKKYAKIKSVSSIEGDCEVNQRKGKVISLFDLKITVLIEGHVDSKDGSALPFEGSINVPEVAFDSEASSYQFDISIFKETSELSEAKPLIRSELLPKLRQIFQQFGKDLLATHGND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT SHOCK PROTEIN HSP82
publication title Structural Basis for Recruitment of the ATPase Activator Aha1 to the Hsp90 Chaperone Machinery.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 31
structure length 143
sequence length 143
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09229 Aha1_N Activator of Hsp90 ATPase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.20 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 1usvB00
1USUB 3N72A 1USVB
chains in the Genus database with same CATH superfamily
3UV1A 3AOTA 3L6IA 5I7LA 3H4ZA 1USVB 1USUB 3E8WA 3E8TA 4M4DA 5I7JA 4EWSA 1BP1A 3AOSA 4F2AA 1EWFA 3ZPMA 2RCKA 2RQFA 4KGOA 4KGHA 4G0SA 2OBDA 3A1ZA 3N72A 5I7KA
chains in the Genus database with same CATH topology
3UV1A 3AOTA 3L6IA 5I7LA 3H4ZA 1USVB 1USUB 3E8WA 3E8TA 4M4DA 5I7JA 4EWSA 1BP1A 3AOSA 4F2AA 1EWFA 3ZPMA 2RCKA 2RQFA 4KGOA 4KGHA 4G0SA 2OBDA 3A1ZA 3N72A 5I7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USU B;  3N72 A;  1USV B; 
#chains in the Genus database with same CATH topology
 3UV1 A;  3AOT A;  3L6I A;  5I7L A;  3H4Z A;  1USV B;  1USU B;  3E8W A;  3E8T A;  4M4D A;  5I7J A;  4EWS A;  1BP1 A;  3AOS A;  4F2A A;  1EWF A;  3ZPM A;  2RCK A;  2RQF A;  4KGO A;  4KGH A;  4G0S A;  2OBD A;  3A1Z A;  3N72 A;  5I7K A; 
#chains in the Genus database with same CATH homology
 3UV1 A;  3AOT A;  3L6I A;  5I7L A;  3H4Z A;  1USV B;  1USU B;  3E8W A;  3E8T A;  4M4D A;  5I7J A;  4EWS A;  1BP1 A;  3AOS A;  4F2A A;  1EWF A;  3ZPM A;  2RCK A;  2RQF A;  4KGO A;  4KGH A;  4G0S A;  2OBD A;  3A1Z A;  3N72 A;  5I7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...