The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
10
|
sequence length |
60
|
structure length |
60
|
Chain Sequence |
MILYDAIMYKYPNAVSRKDFELRNDGNGSYIEKWNLRAPLPTQAELETWWEELQKNPPYE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Solution NMR structure of Phage-like element PBSX protein xkdW, Northeast Structural Genomics Consortium Target SR355
rcsb |
| molecule keywords |
Phage-like element PBSX protein xkdW
|
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Bacillus subtilis
|
| total genus |
10
|
| structure length |
60
|
| sequence length |
60
|
| ec nomenclature | |
| pdb deposition date | 2006-06-26 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Phenylalanyl-tRNA Synthetase; Chain B, domain 1 | XkdW-like |
#chains in the Genus database with same CATH superfamily 2HG7 A; #chains in the Genus database with same CATH topology 3KTV B; 3KTW A; 1MFQ B; 2EJU A; 4DDU A; 1B70 B; 2V3C A; 2LQ3 A; 2HG7 A; 4DDV A; 2YTZ A; 3PCO B; 1JJC B; 4P71 A; 2RHS B; 4P75 A; 2ALY B; 2RHQ B; 4XCO A; 4DDW A; 3DLV A; 4P3E B; 4P73 A; 2AMC B; 4P74 A; 1JID A; 3USH A; 5M73 B; 2IY5 B; 3DLU A; 4DDT A; 1KVN A; 2AKW B; 1B7Y B; 3HFZ B; 2EJT A; 4TVA B; 3TEH B; 1PYS B; 1ND9 A; 1KVV A; 1L9A A; 4IOH A; 2DUL A; 1EIY B; 3AXS A; 3L4G B; 1LNG A; 3NDB A; 4P72 A; 2CXI A; 3AXT A; #chains in the Genus database with same CATH homology 2HG7 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...