The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
42
|
sequence length |
161
|
structure length |
157
|
Chain Sequence |
NRINVFKTNGFSKSRMTSKVLVFKEMATPPKSVQDELQLNADDTVYYLERLRFVDDDVLCIEYSYYHKEIVKYLNDDIAKGSIFDYLESNMKLRIGFSDIFFNVDKLTSSEASLLQLSTGEPCLRYHQTFYTMTGKPFDSSDIVFHYRHAQFYIPSK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The crystal structure of gene product SA0254 from Staphylocococcus aureus subsp. aureus N315
rcsb |
molecule tags |
Structural genomics, unknown function
|
source organism |
Staphylococcus aureus subsp. aureus
|
molecule keywords |
SA0254 protein
|
total genus |
42
|
structure length |
157
|
sequence length |
161
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2007-01-25 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF07702 | UTRA | UTRA domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Chorismate lyase | Chorismate lyase-like |
#chains in the Genus database with same CATH superfamily 2IKK A; 1XLR A; 2OOI A; 2RA5 A; 4ZSI A; 3LHE A; 1G81 A; 3HFI A; 2OGG A; 3F8M A; 4U0V A; 3DDV A; 1G1B A; 3BWG A; 1FW9 A; 2WV0 A; 2PKH A; 3F8L A; 4ZSK A; 1TT8 A; 4WWC A; 2FA1 A; 2AHC A; 4U0W A; 2P19 A; 3EET A; 3EDP A; 3CNV A; 3L5Z A; 4ZSB A; 2NWI A; 1JD3 A; #chains in the Genus database with same CATH topology 2IKK A; 1XLR A; 2OOI A; 2RA5 A; 4ZSI A; 3LHE A; 1G81 A; 3HFI A; 2OGG A; 3F8M A; 4U0V A; 3DDV A; 1G1B A; 3BWG A; 1FW9 A; 2WV0 A; 2PKH A; 3F8L A; 4ZSK A; 1TT8 A; 4WWC A; 2FA1 A; 2AHC A; 4U0W A; 2P19 A; 3EET A; 3EDP A; 3CNV A; 3L5Z A; 4ZSB A; 2NWI A; 1JD3 A; #chains in the Genus database with same CATH homology 2IKK A; 1XLR A; 2OOI A; 2RA5 A; 4ZSI A; 3LHE A; 1G81 A; 3HFI A; 2OGG A; 3F8M A; 4U0V A; 3DDV A; 1G1B A; 3BWG A; 1FW9 A; 2WV0 A; 2PKH A; 3F8L A; 4ZSK A; 1TT8 A; 4WWC A; 2FA1 A; 2AHC A; 4U0W A; 2P19 A; 3EET A; 3EDP A; 3CNV A; 3L5Z A; 4ZSB A; 2NWI A; 1JD3 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...