3BWGA

The crystal structure of possible transcriptional regulator yydk from bacillus subtilis subsp. subtilis str. 168
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
229
structure length
223
Chain Sequence
QQIATEIETYIEEHQLQQGDKLPVLETLMAQFEVSKSTITKSLELLEQKGAIFQVRGSGIFVRKHKRKGYISLLSNQGDFNVTSKVIELDVRKPTPEAAENLNIGMDEDIYYVKRVRYINGQTLCYEESYYTKSIVTYLNNEIVSHSIFHYIREGLGLKIGFSDLFLHVGQLNEEEAEYLGLEAGLPKLYIESIFHLTNGQPFDYSKISYNYEQSQFVVQANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Uncharacterized HTH-type transcriptional regulator yydK
publication title The crystal structure of possible transcriptional regulator YydK from Bacillus subtilis subsp. subtilis str. 168.
rcsb
source organism Bacillus subtilis subsp. subtilis
total genus 58
structure length 223
sequence length 229
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
A PF07702 UTRA UTRA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bwgA01
3.40.1410.10 Alpha Beta 3-Layer(aba) Sandwich Chorismate lyase Chorismate lyase-like 3bwgA02
3QP5A 3Q9VA 3LA2A 1B9NA 3TO6A 2FQ3A 4IRHA 2MA3A 4IXAA 1JGSA 5CLSA 1WSUA 4U7BA 5FLXK 3U9GA 2XUBA 3F6VA 4RS8A 3HSFA 1G3YA 1TBXA 3BROA 3O3KA 3FXRA 5DD4A 2VT2A 2VODA 3BDDA 3QPTA 4PCQA 1SFUA 2ZMEA 3KLNA 2FU4A 1ON2A 5EEGA 4YIFA 4WX9A 5DD8A 1XDSA 4FX0A 4UVBA 1H9GA 4KDPA 5DEQA 2PN6A 1J2XA 4MTEA 3IHUA 3KEQA 3HYIA 4I0AA 1OR7A 2NYXA 1RUOA 4O3MA 1O3QA 4WF2A 3CUQB 1U5TA 2FMYA 2GA1A 2GXGA 1FBUA 3E6DA 2VOOA 3ZMSA 4N0BA 2A07F 2P5LC 1S3JA 2QBYB 3I5UA 3E6MA 2W84A 1STZA 4R79A 1H0MA 2VXZA 3ZMVA 4AIJA 2RGVA 5E8GA 1U2WA 3LFKA 3WG9A 4JBAA 3GWZA 3ZMTA 5ILSA 3GZ5A 3LSTA 4M71A 4ZH4F 1I27A 3VODA 1HW2A 1W5SA 1G6NA 2QQAA 2VOPA 3Q9SA 2UXNA 2PFBA 1V3FA 2VBYA 2NRAC 2L4MA 1SFEA 1R58A 4N9HA 3RTRA 1FSHA 3I71A 5FGMA 2GWRA 2BBYA 3GF2A 3R0JA 3IWZA 3T8TA 3S2WA 3IRQA 1WI9A 2HTSA 3EYIA 4ENMA 4I02A 3V4GA 4CYDA 2D1VA 2H27A 3QOPA 2G7UA 5ICFA 2HR3A 3COAC 2UWMA 4RB2C 1WKMA 2HGCA 3IRRA 3W6KB 2TDXA 2CG4A 3L9FA 2STWA 4EMSA 1KQ0A 4S04A 1DP7P 1KQ9A 5DCMA 2H09A 3TDUC 3QP6A 2ZKZA 1KA8A 1ZH5A 1MDMB 2JZYA 5E18F 5HLHA 1BC8C 1IXCA 1UFMA 3BJOA 3HHGA 5L3GA 1U8RA 1XN7A 3F8LA 2YSRA 2CGPA 5HDNA 4M72A 1R5GA 2ZNYA 5ERIA 4OMZA 1T2KA 3JSPA 3KP3A 1H9TA 3RKYA 3QPHA 3WODF 3L2CA 2RKHA 3MEXA 2RN7A 2HKOA 2O8XA 1Q1HA 3VB2A 2DPDA 3O6BB 1MKMA 2K4JA 5CJ9A 2Z9OA 4IHSA 5F6FA 5CVJA 3R6SA 2XRNA 2RC4A 5JR3A 5D4RA 1UCRA 1AWCA 3E5UA 1BI1A 2CYYA 1R22A 3IC7A 4G7ZF 1IRFA 1XSVA 1BM9A 2GA2A 5TJJA 3DF8A 1SAXA 2ZO4A 5E17F 3KZYA 5LEKA 4RB3C 3E6CC 4GXOA 3I58A 4OINF 5E8IA 2P5VA 3ZMZA 1BJAA 4EV0A 4RGRA 3SXYA 1O57A 2HYFA 1I1GA 2C6YA 2YX7A 1HW5A 1SD4A 2P8TA 2FNPA 2ETHA 4L9NA 1R1VA 5BS6A 4MQVA 2M30A 2QZ8A 2DPUA 2Z5UA 2E1NA 3CUOA 4I7HA 4JQFA 1A04A 4EGYA 2XV4S 1W5TA 4AIHA 2ESNA 3BJ6A 1LDDA 1QPMA 2PKHA 2IRFG 5BPDA 3BWGA 1U78A 1DPUA 4M9XA 3V7RA 4UV9A 1JHHA 2DQLA 3P9CA 3I0TA 4AVPA 1LEBA 2GXBA 4LG0A 2Y0MA 3ABUA 3LAJA 4XSZF 2GQQA 2ZBKA 4LMYA 1ZLKA 3RPUA 5BMZA 1MGTA 4RGSA 2HKXA 3N4MA 1IN7A 2XAFA 5JFRA 2OQRA 3RI4A 1XGNA 4B09A 2XKPA 1W7PA 1BI3A 1P6RA 2E7XA 1UHMA 5D5WB 2COMA 2XHKA 4ON0A 1G3SA 2UXXA 3HRMA 1T98A 1CF7A 3IL2A 2KIMA 4R1HA 1LNWA 1FLIA 3FMRA 3F23A 1YS7A 4RGUA 1FOKA 5HS9A 5LHGA 3VOEA 3K0LA 1YW8A 1HW1A 2NNYA 3T5XA 2ZJ2A 2ESHA 5FD6A 2M5WA 5K5OA 3TKYA 4EGZA 2WWYA 1PP7U 1T0FA 1TW3A 1RUNA 3PQJA 4LJZF 4UXNA 3J80K 3SZTA 1S8NA 5HS8A 1WQ2A 3B73A 2VBXA 1IUYA 1LDJA 5FFXA 3HTUA 2WV0A 4HQEA 3DDVA 2FBHA 1ZRCA 2FE3A 3ERED 1MJ9A 4EM1A 3U1DA 4WWCA 2M87A 1FP2A 1TNSA 2K4BA 4G6QA 4CXFA 4PDKA 5A2QK 2O6GE 1OYYA 1ZGAA 2JRTA 2FSWA 4BNCA 3WU0A 2EFOA 4MNUA 4KFCA 3K69A 1Z05A 4UVCA 1L3LA 2HYGD 3R4KA 3B02A 1TQPA 3SQNA 2OD5A 4HDVA 2MLKA 2F5CA 3KETA 5LRRA 4HF1A 1TW2A 3E5QA 1Z6RA 1SMTA 1IN8A 2OGGA 4H0EA 2HTJA 3R61A 4RB0A 4NQWA 2MH9A 3R0AA 3DEUA 3FWEA 1CGPA 4OU0A 4BXUA 2ADUA 3AAFA 1Z91A 4F7ZA 4PZJA 2P6TA 3FM3A 3E3VA 1IN5A 3RJPA 4IRGA 3T1BA 3DP7A 3ZMDA 4ZZDA 3ECOA 3C1DA 3HSRA 5ICEA 2EFWA 1HKTA 3CNVA 3ZN0A 2W24A 1K7AA 2AS5F 3CLOA 5D5VB 1RZ4A 3WTZA 3MAJA 1Z1DA 2PI0A 1KYZA 2P4WA 2V1DA 1IF1A 1PDNC 1HSJA 2ZCWA 4S05A 3H92A 3KCCA 2IPQX 4Q48A 3GYHX 2IA2A 2YX4A 3Q5FA 4MEXF 2OZ6A 3HHHA 5CYVA 4BHBA 2LKPA 5L3EA 4EJVA 2O61A 3FXQA 1K78A 1BIAA 1IAWA 1U3EM 2MH2A 1LB2A 3KEOA 4A12A 3E97A 1QBJA 5FFZA 5D6EA 3I59B 1ZAOA 3KLOA 5DV5A 1LDKB 2Y48A 1ULYA 3DKWA 3M8FA 2P7CB 2D1HA 2O03A 1ZARA 2CQKA 1ZG1A 2EV6A 1ZHFA 2PG4A 1MD0A 4GO1A 1W7PD 4LB6B 5JVTA 3RDIA 5HDGA 2DI3A 2DK8A 4DNCA 3MWMA 3P7NA 2P5KA 2K86A 4WXHA 4A5MA 3ZQ7A 2STTA 5KK1A 4EVIA 1ZG5A 3F3XA 4A0XA 4HA8A 2JPBA 4HLYA 2X4HA 2P6SA 2BV6A 3C3WA 2QQ9A 2L02A 1MDMA 4HYEA 3TO7A 4ESJA 1YTYA 3K1MA 1P92A 2QUFA 5DDGA 4HX8A 1R23A 5L3DA 3GUDA 3OOPA 3L09A 3I64A 1MJBA 5JI6A 3C18A 3F8NA 4BHPA 1FW9A 4AWXB 1D8JA 4ZYGA 2LDUA 1F1ZA 1UHWA 4M9ZA 2ZMEB 2HDCA 3FM5A 2K7LA 4HAMA 2ACJA 5CVUA 2FEZA 5AIPA 1RI7A 1J7KA 2A3SA 2PBIA 4BYYA 1QZYA 3GEZA 2FBKA 1YG2A 3GVAA 2YU3A 4OIQF 2FOKA 3PFIA 3LA3A 2HZTA 2EK5A 2NNNA 5DYMA 4CICA 5LBQA 4KNYA 3FHZA 3IKVA 2KKOA 5HS7A 3P9IA 3L00A 3E6BA 1HKSA 4YIIA 4WCGA 1P2FA 2YPRA 1EH7A 4NB5A 3HUGA 1XCVA 2VT3A 4G9YA 3WTWC 5AONA 3WTXC 4I98B 3ZP5A 2DW4A 4KYWA 4HDUA 1J59A 2YR2A 1T38A 2ISZA 2NAZA 2K02A 1YLFA 4UVAA 4WK8F 3EYYA 1BI2A 3RYPA 4AD9A 5FD5A 3WTUC 4K2EA 1I5ZA 3C7JA 4G6DA 3R60A 4DQ2A 3GFIA 4UNOA 5L3FA 3IKTA 2PLYA 1AOYA 4A6DA 1IXSB 4MHGA 3JSOA 1PP8F 5HLGA 2LNBA 1O3SA 4M74A 1XD7A 3ZN1A 4Q5SF 4R8HA 4B8XA 5LRSA 1FSEA 1V4RA 2EV5A 2XIGA 3RKWA 2IA1A 1R00A 3FZVA 1R7JA 5D5XB 2AHCA 1GVJA 2J5PA 2M8EA 5DCMB 2XAJA 3V8LA 2PJPA 4OIOF 2NS0A 1T39A 2GIVA 2ELHA 1SD6A 2XAHA 1ZYRF 1GXPA 2P19A 3H3UA 4MTDA 4YG2F 3SFZA 2P7VB 1O7LA 1USTA 4U0VA 2DU9A 1OMIA 1XMAA 4GYIA 5BPIA 4KMFA 2EFQA 3BJAA 4RAZA 4ZSKA 1EH6A 1DDNA 3JAMZ 1FC3A 3NRVA 1D8KA 2XAGA 3ELKA 4XSXF 3WGIA 1P4AA 1GHCA 3M1EA 1FX7A 2XAQA 3EQLF 3I54A 3DXJF 3BOQA 3HOTA 1OYIA 5IT9Z 1BN5A 1HQCA 1R36A 4EQQA 1TNTA 1IN4A 2CWEA 2EV0A 2IKKA 4OOIA 4KIBA 3TOBA 2QWWA 1S7AA 3HSEA 1Z7UA 1ON1A 4LFUA 2VN2A 3PQKA 4M6XA 3JW4A 1QGPA 4QWQA 1IRGA 1QNTA 1HXDA 4KIFA 1OKRA 3U2RA 4BQAA 1XB4A 2EFPA 2GZWA 1BI0A 4OIPF 4JK1X 2ZFWA 2FBIA 4N9IA 3TOAA 5LLQA 4IHTA 1J75A 3ISPA 5CVRA 4L9JA 2H94A 5ED4A 1Z9CA 2O3FA 3F8MA 3F72A 4CZZA 3H3ZA 3F22A 4RAYA 5D5UB 1FY7A 3WTTC 1JXSA 3K1NA 2DQRA 2Z33A 3QU3A 4YFKF 4ESBA 2IA0A 4G94A 2M1BA 1OPCA 4LG0B 4EJUA 3WE2A 4I09A 5H20A 3CDHA 1FPQA 2CFXA 1KU9A 4MGRA 3BY6A 3REOA 1GXQA 2LF8A 3T8RA 5L3BA 3WTSC 4HX7A 2KRFA 2H6BA 3KFWX 4NHJA 4UV8A 1W7PB 2WC2A 4BAYA 1ZG3A 2FXAA 5DCFA 2V1UA 1TT8A 1KU3A 3HOSA 3L7WA 4ENKA 4ENNA 1KU7A 2KIUA 4MEYF 2Z99A 2FF4A 2M45A 3DPTA 3ECHA 4LLGF 5ICGA 1CF7B 2RDPA 5ILUA 1ZN2A 1DPRA 4A0YA 4CHUA 4I0BA 4ZSBA 2L54A 2F5DA 5FO5A 2IVMA 4PGGA 4FT8A 1FBSA 2A69F 2HFHA 1SFXA 4KICA 3RYRA 3MZHA 2PMUA 3FMQA 3FMSA 2KJBA 3G73A 4Y15A 2DO7A 3OV8A 3ROUA 2Q8KA 5HDKA 3KP6A 4HW0A 1B9MA 1UB9A 3CUQA 4O6JA 1QQIA 2JPCA 5HVQC 4UHTA 4KN4X 1ZGJA 1R5HA 2QBYA 1MZBA 2F2EA 1S7OA 1I1SA 1U6GA 1FBQA 1X3UA 2A6EF 1XGMA 3MCZA 3BP8A 3J81Z 1JD3A 1YQAA 5ILVA 1SMYF 2DFIA 4OMYA 5IT3A 1G3TA 1XMKA 2A68F 5FLXZ 4ESFA 2Z3YA 5JHUA 3F8BA 4HZFA 3QRFF 3HTSB 2DLLA 2FMLA 2D2WA 2FRHA 3CJNA 3KZZA 3LHEA 2G7HA 1K6OA 1U5TC 2J5OA 2CW0F 3CTAA 1XSDA 2A5YB 2HQNA 2ZXJA 1OYWA 2VONA 4ZYEA 1KQ8A 2Y75A 2XROA 5D8LB 1YIOA 3I4PA 1YS6A 4UUVA 4L18B 2EJRA 2W25A 1D3YA 4ZYDA 2L4AA 4HV6A 2JTVA 1FP1D 2HEOA 2PQ8A 5LHHA 3DQVC 3WTYC 4ENJA 4U0WA 2PMHA 2IP2A 2ZNZA 1XDUA 2F5EA 3N97A 1YW7A 1B4AA 2D45A 5E1XA 2MLGA 3WE3A 2E7WA 4XLPF 1QZZA 3V7SA 2A61A 3HIFA 1YFHA 3K9TA 2B0LA 1KU2A 3HFIA 4EJWA 3HRTA 3P9KA 2OA4A 4KMUX 1FNNA 1SD7A 2RA5A 5LGTA 1RIOH 3I53A 3M9AA 3NQOA 5F64A 4GCVA 2L3DA 1O3TA 3WGHA 1O3RA 4AIKA 4EJOA 4L5IA 5E20A 2IT0A 2XVCA 3SHFA 3GX4X 2V79A 3ABTA 4I2OA 1K78B 3K1PA 2QENA 1S29A 3GO5A 5F1RA 2RV8A 1D5VA 2BYVE 4XRFA 3M8EA 4ETSA 2LSOA 5E1ZB 3LQRA 2QQBA 4FHTA 4CDGA 2QYOA 3TGNA 4EM0B 5LGNA 4ZYHA 3CO6C 4KUMA 2BEOA 3ULQB 1EV7A 2Q0OA 2HS5A 2VBWA 4M73A 4Z2YA 4HF0A 1J9IA 1RNLA 3KP4A 4LD5A 1NHAA 3FF5A 1L0OC 1ODDA 3QU6A 4GYGA 4LB5A 1U5TB 2GAUA 2O0YA 4HX4A 4I01A 5D4SA 5AIQA 4HLXA 1MJAA 3BPXA 2EFNA 5E1WA 1XGOA 3E5XA 2BE5F 2MC3A 3GZ6A 2BGCA 2W85A 5FB2A 1WWXA 3FX3A 1ZLJA 5K1YA 1W4MA 2FA1A 3J7AO 2VBZA 4A2UA 2IJLA 4LK0F 1C0WA 4YFNF 3F6OA 4P55A 1O7FA 4ASNA 3BPVA 1S6LA 2CO5A 4HQMA 2RVCA 4MQ9F 4CO8A 3WU1B 1JHFA 5J6XA 5TRDA 2CSOA 3V8KA 3W6JB 1VTNC 2V6CA 3O2PE 4O5VA 2EA2A 4FX4A 5K5QA 4Y17A 2R7DA 3WTVC 4Q47A 1LQ1A 5HOOA 5CVIA 5L3CA 1ZREA 2AXLA 2XGXA 2X0LA 4D0PA 5H6QA 2V1XA 3T0YA 1IXRC 1LVAA 4RGXA 4TV7A 1BIBA 1JE8A 3QAHA 1TTYA 5CVVA 2FA5A 3ML6A 3L5ZA 4ZZLA 1SD5A 2JSCA 2HWVA 3KP2A 1E17A 2XKOA 5D8KB 4L9TA 1P4XA 2DAOA 4KIGA 1USSA 2QVOA 2FNAA 6PAXA 1IN6A 2VE8A 1G4DA 3GFMA 3DFGA 2F5FA 1BBYA 1TQIA 2V9VA 4G7HF 4IPAA 3K2ZA 1PUEE 3DV8A 4L0ZB 4KN7X 2QLZA 4G8XA 1BC7C 1HKQA 1KYWA 1LJ9A 4U0YA 5BOXA 2DTRA 1FYKA 3NEUA 3V7CA 3MFKA 3CO7C 3VEPA 4M6YA 3EUHA 1F4KA 2RNJA 5LHIA 5K5RA 4U7DA 2LF7A 4EJTA 3LAPA 2R7FA 2MBFA 3JAMK 1LEAA 2L01A 3GFJA 3ZMUA 1ZRFA 3GFLA 3V8JA 2XASA 1FWZA 1G3WA 4YFXF 2OOIA 1IW7F 1HBXG 5ICCA 2MD5A 1XCBA 2DBBA 3LA7A 2E1CA 1J5YA 5IT9K 3M7GA 2DK5A 4PGHA 3GW2A 3ZPLA 3F8FA 1ZRDA 1TLHB 2KIFA 5J8FA 5LEJA 1G81A 5BQTA 2OZUA 3D0SA 4G7OF 4XLNF 1R1UA 4Y13A 4E70A 2VC0A 1K79A 2PEXA 3J80Z 1T6SA 1FYMA 3MQ0A 4GGGA 4HOBA 5HLIA 3TQNA 4U88A 2VC1A 3F8CA 4LGWA 4KA4A 4HBLA 3FXUA 2Q2EA 2NWIA 3D5LA 1REPC 1KGSA 4LK1F 4LLLA 4ZSIA 4KT5C 1R1TA 4Q4ZF 2HQRA 1P4WA 1FT9A 1F5TA 1F9NA 5DUIA 4A5NA 5A2QZ 3F21A 4IJAA 2KJCA 3G3ZA 4IF4A 1J0RA 4LLNA 4RB1A 2UZKA 4P9UA 2EB7A 4L5JA 3DPLC 3GLXA 3KE2A 2RQPA 3RKXA 1FYLA 3HRUA 4HF2A 2JT1A 1YYVA 1TQMA 2G9WA 3IWFA 2A6HF 2K27A 1XLRA 4EM2A 4M9SA 3SZPA 1B59A 3CUQC 3RIRA 1FZPB 4P5OA 1XSXA 1G1BA 1ONVA 1Z6TA 3KP5A 1HSTA 2EWNA 3LQQA 5J8CA 3EDPA 4IRIA 5D6FA 1BOAA 2VE9A 1IZ1A 3I59A 3KP7A 4IVNA 4BH9A 1DUXC 2OAZA 4P96A 1XGSA 2HOEA 5DUKA 2QM3A 1B6AA 3EETA 3GXOA 4A0ZA 4A6EA 1QO0D 2OBPA 2OU2A 1EH8A 4L9VA 5EEHA 3BZ6A 2H6CA 5KVRA 3LWFA 2R3SA 2WTEA 1I6XA 4P9FA 4XBFA 5LGUA 3RPQA 3VFZA 4WXCA 2ISYA 3MZYA 3HRSA 5H6RA 1WRJA 2IW5A 1YW9A 2OQGA 4L0YB 3WGGA 4HV5A 1Y0UA 3TO9A 4QLCU 1B1BA 1E2XA 4BHCA 4WXDA 4OIRF 3JTGA 2W57A 1YO5C 3TDZC 3JTHA 2EA4A 4CGZA 3J81K 2DT5A
chains in the Genus database with same CATH superfamily
3SZGA 3QP5A 3Q9VA 3LA2A 5FKMA 2MD0A 1B9NA 3TO6A 2FQ3A 3ONQA 4IRHA 2MA3A 3KEYA 5KAIC 4IXAA 1XMXA 5J1YA 1JGSA 3H0DA 5CLSA 1I39A 1MBJA 4U7BA 1WSUA 5FLXK 1TC3C 3LSPA 2CMPA 2QQ8A 2Z1DA 3U9GA 2XUBA 3CF5F 3F6VA 1W0UA 3DU6A 3VYSB 4RS8A 3HSFA 2IBDA 1G3YA 1TBXA 3H5RA 3BROA 2ME0A 3O3KA 4U87A 4X0GA 3FXRA 5DD4A 2VT2A 1MSEC 2VODA 2LP0A 2W48A 3BDDA 2QCOA 2JVGA 1QHGA 3QPTA 1HOMA 4PCQA 4UB6C 1SFUA 4XIDA 2ZMEA 2PMZN 3KLNA 2FU4A 1ON2A 5EEGA 5GAHJ 2DT6A 5JHFA 5CPRB 4YIFA 5HLTA 4WX9A 1OCCH 1Y6IA 3KIOA 3H9JA 5DD8A 4GFBA 1QVUA 1XDSA 4FX0A 4UVBA 1H9GA 4KDPA 5DEQA 2F48A 2PN6A 1J2XA 4M3DA 3H1CA 4MTEA 3IHUA 4RLQA 2ECBA 2MFZA 1Z3XA 3CP2A 4PJNA 3KEQA 3HYIA 3KZIC 4XKWA 4I0AA 1OR7A 1MNMC 5EGOB 1SAUA 2NYXA 1RUOA 1V54H 1O3QA 4O3MA 4WF2A 2BOLA 2HOTA 3OR2C 3CUQB 1U5TA 2FMYA 1R9TJ 2GA1A 2YUSA 4ZDPA 3BG7A 2GXGA 1FBUA 3E6DA 2VOOA 1IDZA 1U9NA 3ZMSA 3FBIB 4N0BA 4DW6A 2A07F 2P5LC 1S3JA 2QBYB 3BZKA 2IS2A 3I5UA 1FEXA 4A3EJ 3E6MA 2W84A 4YEJA 1STZA 1P7JA 4HNTA 4R79A 1H0MA 3M3YJ 4E7JA 2K9NA 3S14J 2VXZA 3ZMVA 4XORA 1T95A 3TP0A 4AIJA 2EZKA 2F5VA 2RGVA 5E8GA 1IC8A 1U2WA 2HQ5A 2CU7A 3LFKA 3WG9A 2W1OA 1WJEA 4JBAA 3GWZA 3ZMTA 5ILSA 3DWLE 2LBFB 3GZ5A 1FIAA 2N8GA 3LSTA 2DMTA 4M71A 1B8IA 1SFKA 4A3CJ 4ZH4F 3JRGA 1UZCA 1I27A 3OIOA 3VODA 1HW2A 4BACA 1W5SA 1G6NA 2QQAA 4JYKA 2VOPA 4XLFA 3UNGC 4M3BA 3Q9SA 2UXNA 2PFBA 1X4OA 2DMNA 2LLKA 1V3FA 4W1UA 2VBYA 1QA6A 2NRAC 2L4MA 1SFEA 2JN6A 1R58A 1V5FA 2NVXJ 3J7ZI 4N9HA 4QTRA 3B6CA 3RTRA 5E79C 4PSXA 1HLVA 1FSHA 1R5ID 3K4KA 3I71A 1H89C 2KRCA 5FGMA 2GWRA 2BBYA 3GF2A 3LMMA 3LSJA 3R0JA 3IWZA 3T8TA 3S2WA 3IRQA 1WI9A 2HTSA 3ERMA 3EYIA 3BTLA 3KYCB 5FRMA 4ENMA 3Q0UA 1TT5B 2LRDA 3K4MA 2R5ZA 1Y1WJ 1AKHA 3HOWJ 4I02A 3V4GA 4CYDA 4PK4A 1XG1A 2D1VA 2K9QA 2QSHX 2H27A 4AIDA 3HZJA 1I3QJ 2M2EA 3QOPA 3K2AA 2G7UA 5ICFA 2HR3A 5HNFA 3COAC 2UWMA 4XRSA 4BQOA 2K40A 4RB2C 1WKMA 3S2HJ 2HGCA 4D5FA 2NVUB 3IRRA 4B3AA 3W6KB 2TDXA 2CG4A 1DQUA 3L9FA 2STWA 2Y0SN 4EMSA 1KQ0A 4S04A 2OJED 1AHDP 1DP7P 1EF4A 1KQ9A 5DCMA 5J40A 1VQ6I 3H9QA 2H09A 3TDUC 3QP6A 5HNHA 2CFOA 2ZKZA 1KA8A 1ZH5A 4DIQA 5EYRA 1YOVB 2BY3A 3PO3J 3RZOJ 1MDMB 2JZYA 5E18F 2XAUA 5HLHA 1BC8C 1IXCA 1UFMA 3CC4I 4DBQA 3BJOA 3OYBA 3HHGA 5L3GA 5FKNA 1U8RA 1XN7A 1W36C 3F8LA 2YSRA 2CGPA 2I5UA 2Y30A 1HDPA 5HDNA 4M72A 3ZGKA 1R5GA 2ZNYA 5ERIA 4OMZA 1TP4A 5J1RA 4X6AJ 1T2KA 3JSPA 3KP3A 2R4GA 1H9TA 4D9JA 3RKYA 3QPHA 1R4NB 3BR1A 4LG3A 1TWHJ 4XL9A 2I10A 2VKEA 5FKKA 1ZR2A 3DTIA 3WODF 2NVQJ 3L2CA 2HPMA 2IS6A 2CW7A 4MO7A 4IQJA 3GTPJ 2RKHA 3MEXA 2DOAA 1OCPA 2ELJA 2RN7A 1X58A 2HKOA 2O8XA 1Q1HA 3VB2A 1ORKA 4EATA 3S93A 3QYBA 3O6BB 4IZZA 2DPDA 3CC7I 3MKWB 3BZCA 1MKMA 3SYTA 2HPIA 1W0TA 2K4JA 3LL7A 2ZJPF 4XONA 5CJ9A 4C9YA 2Z9OA 4IHSA 5F6FA 1ZTRA 4E7SA 5CVJA 2L7MP 3R6SA 2CQ7A 2XRNA 2RC4A 2CUFA 4E6KG 5JR3A 5D4RA 3OIQA 4KT6A 4UUSA 2QA4I 1UCRA 1HA8A 1AWCA 4ANJA 3E5UA 2BW3B 1BI1A 3OSGA 1X1AA 3OS0A 4BE0A 4A3FJ 3PIPF 2LR8A 2QF7A 2CYYA 2FUG2 3DTKA 1R4MB 1R22A 2P81A 3IC7A 4BUPA 4G7ZF 1IRFA 2Y9YA 1XSVA 5F27A 3FKJA 1BM9A 2GA2A 2LOOA 5TJJA 3DF8A 4OAYA 2XC7A 1SAXA 2ZO4A 5E17F 4DGWB 2DYSH 2CS3A 3H3VK 2EZLA 3KZYA 1Z67A 5LEKA 4RB3C 3TL4X 2HU9A 3E6CC 4GXOA 1MSFC 3I58A 4OINF 5E8IA 4I6ZA 2P5VA 2L9NA 3OS2A 1BJZA 3ZMZA 5BNGA 5EZHA 1BJAA 4EV0A 4RGRA 4C3JJ 3CZ6A 4E7IA 3SXYA 5EF6A 1O57A 4XN3A 3CQZJ 3CP8A 5FKOA 3BR5A 2HYFA 1G59A 1I1GA 2C6YA 2YX7A 1WJAA 4B43A 1HW5A 1SD4A 1FTTA 2DXIA 2P8TA 2FNPA 2VIXA 1IDYA 2ETHA 3HJEA 1BR2A 2IS1A 1VQ9I 3EUHC 4L9NA 2EPFA 1R1VA 3K4NA 2HZDA 2JA2A 5BS6A 3QQAA 3OYCA 1QPIA 4MQVA 2M30A 2QZ8A 2XSJC 3GCMA 3HOXJ 2DPUA 2VJJA 2Z5UA 4RAGA 3G6EI 2E1NA 3ZRGA 3CUOA 3HM5A 2XGCA 2JUCA 2DDAA 4I7HA 4JQFA 2IEKA 4II3A 2F6CA 1A04A 3IP4B 1P7IA 1D0ZA 2XV4S 3TBIA 4EGYA 3K4LA 2D5VA 1W5TA 4AIHA 2ESNA 4ZTJA 4BBSJ 2O9LA 3BJ6A 3OWTA 1LDDA 4HG2A 1QPMA 4BGDA 2PKHA 2IRFG 1A31A 2BXZA 5BPDA 3BWGA 1JJ6C 1U78A 4XKCA 2IGNA 2KDOA 1NK3P 1DPUA 1IRXA 4M9XA 4A93J 3V7RA 4UV9A 1JHHA 2LREA 2ICWG 3MKZA 1JKPC 5FLVA 4YRVA 2M3AA 2DQLA 2L9SA 3P9CA 3I0TA 4AVPA 1POGA 1LEBA 2GXBA 3B6AA 4C2UA 4LG0A 2Y0MA 1E3PA 3ABUA 3LAJA 4CZCA 2OTLI 4XSZF 2GQQA 3W2AA 3CDIA 2ZBKA 4CYCB 4I99C 4W97A 2X6OA 3C2BA 3IV5A 4LMYA 3FKIJ 1ZLKA 1HC8A 3RPUA 5BMZA 1MGTA 2HOSA 1A5JA 4RGSA 3S2DJ 4BBRJ 2HKXA 5K7FA 3N4MA 1X2NA 3CD6I 1IN7A 2XAFA 5JFRA 2OQRA 3RI4A 4KITB 1XGNA 4B09A 2ZXHA 2FQ4A 2XKPA 1D1AA 3QOEA 5H2FC 1W7PA 2OTJI 1BI3A 2ZSIB 1P6RA 2DA1A 4AUXA 1WH5A 1Y8QB 2E7XA 1UHMA 5D5WB 2UV1A 2COMA 2XHKA 3HEFA 4ON0A 1G3SA 4M3GA 1IO2A 2HNHA 2UXXA 3HRMA 3ZQGA 1T98A 2GLOA 2RNGA 1K4TA 5IP6A 3SFIA 1CF7A 3IL2A 2KIMA 4R1HA 5IP9J 1DU0A 1LNWA 4RM3A 1FLIA 3FMRA 2VJ4A 1VQOI 3F23A 1YS7A 4RGUA 4HNUA 5HS9A 1FOKA 5LHGA 5K7ZA 3VOEA 3K0LA 1YW8A 3PNTA 5K7HA 1HW1A 2NNYA 3T5XA 1PUFA 2ZB9A 2ESHA 2ZJ2A 3M1CA 4XLHA 2M5WA 5FD6A 3TKYA 2XF6A 5K5OA 4EGZA 4AM3A 1KONA 2WWYA 4D7NA 2CW8A 5E3OA 1T0FA 2TRTA 1PP7U 3S16J 1TW3A 2E35A 4FISA 1RUNA 3PQJA 2L2OA 4LJZF 4UXNA 5C44J 3J80K 1YX5A 2WY8Q 3HBLA 5GAGJ 3S3OA 3SZTA 1S8NA 5HS8A 1B72A 1WQ2A 2GIZA 3B73A 2QSGX 2KMUA 2VBXA 2R5YA 1IUYA 1LDJA 1OFCX 2NS8A 2K5CA 1A6QA 5FFXA 2VQLA 3GLLA 3HTUA 2R93J 3LSIA 2WV0A 2XPVA 4HQEA 2HVRA 3DDVA 2FBHA 1BL0A 4MFDA 1ZRCA 2R7TA 2FE3A 3ERED 1MJ9A 4EM1A 4KJZA 3S3NA 2X6WA 3U1DA 4WWCA 2M87A 1FP2A 2DFHA 1TNSA 3OYIA 3MKYB 2K4BA 4G6QA 4CXFA 1MW7A 3VSKA 4LIVA 3HDDA 4PDKA 5A2QK 4FETA 2O6GE 1VF9A 1OYYA 2R7UA 2E2IJ 4XICA 1ZGAA 2JRTA 2FSWA 3OS1A 1E3HA 4BNCA 2M9HA 3WU0A 1K61A 2R7WA 3F9KA 2EFOA 4MNUA 3ZQQA 4KFCA 1R49A 4E7KA 3K69A 4L5EA 1Z05A 2E60A 4UVCA 1W1WE 1L3LA 1UELB 2HYGD 1SC7A 3R4KA 2CQQA 3ASOH 2BY0A 3B02A 1MBFA 2LD5A 1TQPA 3SQNA 3FXKA 2OD5A 4HDVA 1S72I 2MLKA 2WAQA 2F5CA 3KETA 1U9OA 5LRRA 3S1NJ 1ETVA 3ABKH 4HF1A 3A03A 2MW8A 3HOUJ 1TW2A 2A6TA 3E5QA 5TISC 3CMMA 1VFCA 4XMYA 1Z6RA 1SMTA 1QHHD 1NG7A 2DOEA 1IN8A 2DTZA 4DZPA 4Y52J 2OGGA 2M7BA 3BCBA 3W3CA 3RQIA 4H0EA 2M0CA 1DGWY 2HTJA 3R61A 1YJ9I 4RB0A 1K83J 4NQWA 1ETQA 2MH9A 4XLCA 1GVDA 3R0AA 3DEUA 3FWEA 4QPOA 1CGPA 2AXTC 1N25A 2LG4A 4OU0A 3I55I 3BT9A 4NBQA 5B66C 3GTKJ 2W00A 4BXUA 2ADUA 3AAFA 1Z91A 4MFEA 3HOYJ 2LY9A 3ZQIA 5J4VA 2HYJA 3OL3A 3CDLA 4F7ZA 2L7ZA 1JKOC 1NTCA 4PZJA 5IYBJ 2P6TA 2VPRA 3MMYB 3FM3A 3NAUA 2WAQN 2Q2EB 3E3VA 3O8HA 2EZHA 1IN5A 3RJPA 2HVSA 2HQAA 3QPLA 3CC2I 1ZQ3P 1ETKA 4IRGA 3G1OA 3T1BA 3DP7A 3AG4H 4A3LJ 3ZMDA 4ZZDA 3ECOA 3C1DA 2CV1A 3HSRA 5ICEA 2EFWA 5JLXA 3HL2A 1HKTA 4EEFG 3CNVA 2LY1A 3ZN0A 2W24A 3FXLA 1K7AA 2AS5F 3S17J 3CLOA 5D5VB 1RZ4A 3WTZA 3L2VA 3MAJA 1Z1DA 1PJRA 3HGYA 2PI0A 2XPUA 1KYZA 2AQEA 3OYAA 1IJWC 3CESA 2JA7J 2P4WA 2V1DA 1FIPA 1IF1A 1PDNC 1HSJA 2ZCWA 2DN0A 4S05A 3RCOA 3H92A 4Y7NJ 1ZR4A 3KCCA 1JT6A 2DCEA 2IPQX 2DA5A 3JCUC 4Q48A 3GYHX 2RQQA 4FE7A 2IA2A 2YX4A 4XKVA 3Q5FA 4MEXF 2OZ6A 4IHXA 4E7ZA 3HHHA 5CYVA 4BHBA 1OCTC 2OCEA 2LKPA 2Y2ZA 2DFEA 4HEA2 5L3EA 3HGGA 4X1EA 4EJVA 2MG4A 2O61A 2YS9A 3FXQA 3DKYA 1K78A 2AQFA 1BIAA 1IAWA 1U3EM 2MH2A 1LB2A 5CQGA 3KEOA 5B5EC 1AA7A 4RA2A 3QODA 2JJ7A 5GP9A 4A12A 4AU7A 3E97A 1QBJA 1I6HJ 3KYDB 4RM2A 5FFZA 5D6EA 2BXYA 3I59B 3JRDA 3SEZA 3CCLI 1ZAOA 1UMQA 4XRMA 3KLOA 3OYMA 2F4IA 4AYBA 1ZKGA 4J19A 2B7EA 2V4JC 5DV5A 1LDKB 2EILH 2X1EA 2Y48A 3KX2A 2B9SA 1ULYA 3DKWA 2R7ZJ 5E3LA 3FXMA 4BS9A 3BLYA 3M8FA 4IEJA 2P7CB 2D1HA 2IGKA 3RPUD 2O03A 1ZARA 2CQKA 2JRMA 3VYRB 1ZG1A 1HDDC 2EV6A 1VZ0A 1ZHFA 1MH3A 2K3FA 2XF5A 5C4XJ 2ELKA 2PG4A 4Y33A 4ZJZA 5DM6F 1MD0A 3A01A 4GO1A 3SEQA 1W7PD 4LB6B 1LE8A 4BEHB 1GLNA 1EKEA 5JVTA 1SFOJ 5C3EJ 3RDIA 2DDBA 5HDGA 1V5GA 2DI3A 2DK8A 4DNCA 3MWMA 3L2QA 3P7NA 4A3BJ 2P5KA 2K86A 4WXHA 4A5MA 1K6YA 3ZQ7A 2STTA 5KK1A 4EVIA 3BG3A 1ZG5A 1JUSA 2WAEA 3F3XA 4A0XA 4HA8A 2JPBA 4HLYA 2Q1ZB 4B48A 4C2TA 2X4HA 1S5LC 4E7LA 2P6SA 4PUSA 2BV6A 3C3WA 5EG0B 1TL8A 2QQ9A 2L02A 1MDMA 3K4BA 5F0HA 4HYEA 2YU9J 3TO7A 2E34A 4ESJA 1YTYA 3K1MA 5M3MJ 1MMGA 1P92A 4ZDOA 2QUFA 3LSRA 5DDGA 2VUMJ 3ZQFA 1Y1VJ 4HX8A 1R23A 5L3DA 3GUDA 3OOPA 4PSWA 3L09A 2H8RA 3I64A 2W4SA 1MJBA 5JI6A 2I8DA 2OC6A 3C18A 4RBOA 2IXSA 5EZGA 3L1PA 1N77A 3F8NA 3G1LA 4BHPA 1FW9A 2VXDA 3DEWA 4AWXB 2RREA 4F93B 4OWRB 5DM7F 1S9HA 2ZSHB 1D8JA 2R92J 2WAFA 3IH2A 2DT7B 4ZYGA 2LDUA 1F1ZA 1UHWA 4M9ZA 1XC5A 3TEDA 4AVZA 2ME6A 5E3MA 2ZMEB 2XB0X 2HDCA 3FM5A 3W6VA 2K7LA 2QKMB 3U1KA 2Z16A 4HAMA 2ACJA 4XK4A 5CVUA 2FEZA 5AIPA 3TW6A 2BY1A 2BHYA 4C30A 1RI7A 5GPAA 1LFUP 2NVTJ 2EIKH 2E19A 1J7KA 2A3SA 2PBIA 4BYYA 2CUEA 2M8GX 3O8GA 1QZYA 3GEZA 3OOUA 4XOPA 2FBKA 1YG2A 3CMEI 5J1UA 2XDVA 3GVAA 3OSFA 2YU3A 1ITYA 4OIQF 2FOKA 3PFIA 4RAFA 4PJLA 3TMOA 3CCSI 3LA3A 2VI6A 2HZTA 2EK5A 2NNNA 3L2WA 5DYMA 1IUFA 4CICA 5LBQA 2CQXA 1WJBA 4KNYA 3FHZA 3IKVA 5M5WJ 4LOCA 2KKOA 1TWGJ 5IPAA 4PJ0C 5HS7A 1ENHA 3P9IA 3Q0VA 3L00A 3E6BA 1HKSA 2L9RA 2KT0A 3S3MA 4YIIA 2GXAA 2DMPA 4WCGA 3AG1H 1P2FA 3IAM2 2YPRA 5M5YJ 4LIUA 1EH7A 4BJ6C 3M4OJ 4NB5A 3HUGA 1XCVA 2VT3A 4KISA 3E1SA 4G9YA 3WTWC 4HRIA 2HVQA 5AONA 3WTXC 1YRNA 1MIJA 1YHQI 1Q1VA 3CCQI 4I98B 3FISA 3H9GA 2DFFA 4DJAA 1B8IB 3ZP5A 5CQEA 2DW4A 3RZDJ 3I56I 4HDUA 1J59A 4KYWA 2YR2A 4V2GA 3CLQA 3ZQCA 1T38A 3GTJJ 2ISZA 2NAZA 3G71I 2K02A 1YLFA 2X1CA 2JMWA 4UVAA 4WK8F 5IYCJ 1RR7A 1BI2A 3EYYA 3RYPA 3P5JA 4AD9A 4IHYA 4IOAF 5FD5A 4XNFA 3WTUC 3E0JB 1WHUA 3S1QJ 5IP7J 2HXIA 4K2EA 1I5ZA 3C7JA 4G6DA 3D1NI 3R60A 4PFOA 1IV8A 4DQ2A 2H8WA 3GFIA 4MIMA 4E7HA 4UNOA 3Q0WA 2LYCA 2QEXI 3SDBA 1VQ5I 5L3FA 3IKTA 2PLYA 1AOYA 4A6DA 1IXSB 2L0KA 3BC8A 4MHGA 3JSOA 2R5ZB 1PP8F 1AKHB 5HLGA 5TGTA 1VQKI 2LNBA 2R0QC 1LKXA 2VKDA 3DU5A 3H35A 4M74A 1XD7A 1O3SA 3ZN1A 1H88C 2VKHA 4YIRX 4Q5SF 4R8HA 4QPQA 3WHCA 1EJ9A 4B8XA 5LRSA 1FSEA 2DOFA 1V4RA 2EV5A 2VJIA 2XIGA 1V55H 4CCNA 4FCYA 3RKWA 2IA1A 3DEEA 3K70D 1R00A 3FZVA 1LFPA 1VQ7I 3C2HA 1R7JA 4G12A 4DZJA 5D5XB 1ETYA 2K85A 1IGNA 2AHCA 1XTAA 1GVJA 2J5PA 1PVEA 1BR1A 2PX9A 2M8EA 3S15J 3DLAA 1R6RA 1GUUA 3PM1A 5DCMB 1GV2A 3VPRA 3OYGA 1Z77A 5F0FA 5DS9A 2XAJA 3K4JA 4P1WA 3OYDA 1XX5A 3V8LA 4UY8I 2PJPA 2E36A 4OIOF 3GMEA 2NS0A 1HF0A 1QVTA 1T39A 2VKVA 2JQ7A 2BZTA 3AG2H 4BXXJ 2GIVA 3C2GA 2ELHA 2LK2A 4DYQA 1SD6A 2XAHA 1VQ8I 1ZYRF 1GXPA 2P19A 3H3UA 4MTDA 4YG2F 1JT0A 4ABZA 4IQ4A 1H8AC 2IS4A 3SFZA 2P7VB 1WZ2A 3K7AJ 4JP0A 2XPWA 1A36A 3J7YJ 4HSRA 2ZXIA 2VPLA 1O7LA 2DMUA 1D0YA 1USTA 4U0VA 4IHVA 2DU9A 1OMIA 4FE4A 1XMAA 4GYIA 2E5ZA 2MC4A 5BPIA 4II2A 1Z21A 5KNLA 4BU2A 4KMFA 3K4CA 2CH0A 2EFQA 3BJAA 1OISA 2JWTA 4RAZA 1MMDA 4ZSKA 2AHQA 4C3HJ 1EH6A 1DDNA 2KP6A 4NC8A 4CCMA 3GZNB 4IL6C 3JAMZ 1FC3A 3NRVA 1D8KA 1X4PA 2W82A 2XAGA 3BG9A 1RKTA 4UUSB 1UG0A 3ELKA 3NWTA 4XSXF 3FHNA 3WGIA 1SEUA 3J7AY 1P4AA 2EBIA 1GHCA 4G6TB 3M1EA 1FX7A 2XAQA 2DA6A 3EQLF 3I54A 3DXJF 1NK2P 3BOQA 3HOTA 1OYIA 5IT9Z 1BN5A 2L5QA 1X1DA 1HQCA 1R36A 2R7RA 4J00A 2PJRA 2M0MA 4EQQA 1TNTA 1IN4A 2CWEA 2EV0A 3EUAA 2O8KA 3S1MJ 1MBGA 3DBHB 1D1CA 1FOYA 2JK3A 2IKKA 4OOIA 4BXFA 2WB1A 4KIBA 3PSFA 3I3LA 1WCMJ 3TOBA 5FLMJ 2QWWA 4RLFA 1S7AA 2KPMA 2K3PA 3HSEA 3CMAI 2QGUA 1Z7UA 1ON1A 4LFUA 2EINH 5EEAA 1E0EA 4BJ5C 2VN2A 5CKTA 2KISA 3HC7A 3PQKA 1Y8RB 2Y9ZA 3G2BA 2V1NA 4M6XA 3JW4A 4FTHA 1QGPA 4QWQA 1IRGA 1QNTA 1HXDA 4KIFA 1OKRA 3U2RA 4D5CA 4BQAA 1X1CA 1XB4A 2EFPA 1T8IA 2GZWA 1BI0A 3LSMA 5C4JJ 4OIPF 4JK1X 2ZFWA 4CA0A 5KHDA 2FBIA 4N9IA 2E2JJ 1T56A 4I76A 3TOAA 5LLQA 4IHTA 1J75A 2HDWA 3ISPA 5CVRA 4L9JA 3PNVA 2H94A 1YE9A 3ABMH 5ED4A 1Z9CA 2WB1N 3L2RA 2O3FA 3F8MA 3F72A 4CZZA 3H3ZA 3F22A 3IH4A 1WGXA 1DGRM 3WG7H 1K4SA 3OL4A 4RAYA 5D5UB 4CCJA 4HSTA 2XGEA 3A0HC 3JRBA 1FY7A 3WTTC 3OYEA 1JXSA 3K10A 3K1NA 5GTHC 2DQRA 1FTZA 1UHSA 2Z33A 1Y56A 3QU3A 4BKXA 2EIJH 4YFKF 1V5EA 4DYRA 4ESBA 2IA0A 4G94A 4B4CA 2M1BA 1OPCA 1JGGA 4LG0B 4H4KC 4EJUA 3WE2A 2OUMA 4I09A 3IUOA 5H20A 3CDHA 4CCKA 1FPQA 3BTCA 1AU7A 2CFXA 1MBKA 3HOVJ 2ECCA 1KU9A 4MGRA 1WJCA 3BY6A 3DTEA 3ZXSA 3REOA 1GXQA 2LF8A 3T8RA 5L3BA 3UKGA 3WTSC 1X1BA 3CJRB 4HX7A 2LVSA 2KRFA 4FQGA 2H6BA 3KFWX 4NHJA 4UV8A 1F43A 1W7PB 2WC2A 4BAYA 1ZG3A 2FXAA 1YX3A 2WBMA 5DCFA 1Z0XA 2V1UA 1TT8A 1KU3A 3HOSA 3L7WA 4ENKA 4ENNA 1KU7A 2KIUA 4MEYF 2Z99A 2FF4A 4OAZA 4IHWA 1BW5A 2M45A 3DPTA 3ECHA 4LLGF 4D1QA 5ICGA 1CF7B 1PYVA 2QSFX 2RDPA 5ILUA 1ZN2A 1MMAA 2HI3A 1DPRA 4A0YA 4CHUA 4I0BA 3TP3A 1KZHA 3A02A 3E7LA 2JA8J 4ZSBA 2LFBA 2L54A 4N4OB 2OV7A 2F5DA 5FO5A 2IVMA 4PGGA 2LH9A 4FT8A 2V26A 5IOZA 1FBSA 2OF7A 2A69F 3ABLH 2HFHA 1SFXA 4KICA 3RYRA 2E71A 2OPTA 3MZHA 3QWLA 1MBEA 2PMUA 1PUFB 3FMQA 3FMSA 1FMVA 4BL0B 2V7FA 2KJBA 1ERDA 3ZQHA 3JRFA 3G73A 1UAAA 4DYCA 4Y15A 2LTPA 2DO7A 3OV8A 3ROUA 2ZJRF 5EGOA 2Q8KA 5HDKA 3KP6A 4HW0A 1B9MA 2HXOA 3H0GJ 2KDZA 1APLC 4XQFA 1UB9A 3CUQA 4O6JA 3BR2A 1QQIA 1B72B 2JPCA 5HVQC 4UHTA 3K70C 1BOBA 4JX5A 4KN4X 3MKLA 4M3EA 2R5YB 3N05A 1JTYA 1ZGJA 1QU3A 3CCVI 1R5HA 2QBYA 1MZBA 5E3NA 1WJFA 2F2EA 5B3SH 5LFAA 4IOCF 1S7OA 1I1SA 1U6GA 3QYFA 1IV6A 2ZMEC 3FXJA 1FBQA 1X3UA 2A6EF 1XGMA 3CCRI 3MCZA 3BP8A 2ID6A 3J81Z 3NWSA 5GTIC 4QIWN 1YQAA 5ILVA 1WFXA 3OYKA 1JD3A 1SMYF 2DFIA 4OMYA 5IT3A 1G3TA 1XMKA 2A68F 2LBFA 4Z6YA 4DOZA 5FLXZ 1FOWA 3PNYA 2Z3YA 4ESFA 5JHUA 3F8BA 2WY7Q 4HZFA 3QRFF 3HTSB 2EH3A 2DLLA 2FMLA 4CH7A 2PMZA 2D2WA 1OR7C 3BR0A 2FRHA 1Y39A 3CJNA 3KZZA 1YI2I 2EIMH 2WV1A 3LHEA 2G7HA 3G1MA 1K6OA 1U5TC 2MGQA 3CCYA 4CCOA 1JKQC 5IYDJ 2QKLB 2J5OA 4BY7J 4BE2A 4HPQA 2CW0F 3CTAA 2BHZA 1XSDA 3LNQA 2JVHA 4F55A 2CUZA 2A5YB 1T33A 2HQNA 2XGDA 2Y69H 2ZXJA 1YJWI 1OYWA 2VL8A 1ACIA 4XKBA 2Z2SB 2VONA 4ZYEA 1KQ8A 4NQWB 2Y75A 3HKZA 2XROA 3KYLA 5D8LB 4XLEA 4NNJA 1YIOA 3I4PA 1YS6A 1IRZA 4UUVA 4L18B 2EJRA 5FJ8J 3PIOF 1RRJA 4GDFA 2W25A 1D3YA 4ZYDA 4F92B 2L4AA 1ETOA 4HV6A 2JTVA 1FP1D 2NVYJ 2HEOA 1LVKA 1WJDA 2PQ8A 5LHHA 2KZVA 3DQVC 1WVRA 3F0CA 3WTYC 4ENJA 4U0WA 3MN2A 2PMHA 2GOMA 4M3FA 2ZNZA 2IP2A 1XDUA 1MNDA 2DODA 2F5EA 3D5RC 2X85A 3N97A 2NS7A 3MVPA 5FKLA 3H36A 1I50J 4UUTA 1GDTA 2JSPA 1A35A 1YW7A 4F91B 2DA3A 1B4AA 1ETWA 5LD2C 4NDLA 2D45A 5E1XA 3ZR8X 2MLGA 3WE3A 4DBRA 2E7WA 2H1LA 2FJ1A 1O4XA 2E1MB 4AYBN 3HKZN 5EJCA 4AC0A 2R7QA 4XLPF 4B3XA 1IG7A 1EA3A 1QZZA 3V7SA 2A61A 3A0BC 4RDUA 1ZK8A 3HIFA 1YFHA 1UG2A 5HODA 3K9TA 2MSYA 2B0LA 1WI3A 3FK6A 1KU2A 3HFIA 5M3FJ 4EJWA 3HRTA 3OYFA 1GT0C 3AL0B 3P9KA 2OA4A 4KMUX 1J09A 1FNNA 1SD7A 3UR3C 2RA5A 5LGTA 1RIOH 3I53A 3M9AA 3NQOA 4A3JJ 4PJMA 5F64A 4XR6A 1JUMA 4GCVA 2L3DA 3ESWB 1O3TA 2F4MB 3WGHA 1O3RA 3FIWA 3GTLJ 4AIKA 4A3KJ 3BQZA 2DJNA 4EJOA 4L5IA 1P9QC 5E20A 2IT0A 2XVCA 2CQNA 3SHFA 3GX4X 1Z3YA 4F3QA 2CRGA 3JRIA 2V79A 2KFDA 3IH3A 4FASD 3ABTA 4I2OA 3BTIA 1K78B 3K1PA 2QENA 1S29A 3GO5A 5F1RA 2RV8A 1D5VA 2OCCH 2BYVE 1OCOH 4XRFA 3M8EA 4ETSA 3DLLF 2LSOA 3BTJA 5E1ZB 3LQRA 1W5CC 2RAEA 1N78A 2QQBA 3PL8A 4FHTA 3S32A 4CDGA 3PO2J 2QYOA 3TGNA 4EM0B 3VWBA 5LGNA 3VYUB 4ZYHA 2GOXB 4KUMA 3CO6C 2BEOA 3LFUA 3CMYA 3ULQB 1MMNA 2FD5A 1EV7A 1X1PA 2Y0SA 2Q0OA 3CCMI 2VJ5A 4XRSG 2DMQA 3MD2A 1LFBA 4ZC3A 2HS5A 2VBWA 4M73A 4Z2YA 2BW3A 4HF0A 1J9IA 1VQNI 3PUFA 3X2QH 5IY5H 2KZGA 2KRHA 3BG5A 3W2VA 1RNLA 3KP4A 4LD5A 1NHAA 3FF5A 3H5NA 1L0OC 1F36A 1ODDA 2X51A 3QU6A 2LC2A 4GYGA 3PJRA 4LB5A 3A2KA 1U5TB 2GAUA 2O0YA 4LITA 4HX4A 4I01A 5D4SA 2EZIA 5AIQA 1D0XA 4HLXA 1OCZH 5J3LA 1QZEA 2WA0A 3RQ4A 5DTDA 2DA4A 1MJAA 3M07A 4B1RA 5GADJ 2VLAA 3BPXA 2V9PA 3BG6A 2EFNA 3CJQB 5E1WA 3A01B 1XGOA 3E5XA 3QYEA 2BE5F 1LE8B 2MC3A 3GZ6A 2BGCA 2W85A 5EDNA 4YELA 5FB2A 4IO9F 2R7VA 2LMDA 1WWXA 9ANTA 3WU2C 3FX3A 2JUGA 1ZLJA 5K1YA 1W4MA 3LSKA 1OLTA 2FA1A 3J7AO 2GBYA 2TCTA 2VBZA 4A2UA 2IJLA 3JR9A 4LK0F 2ZC2A 1C0WA 3V42A 3HXLA 3OIPA 4YFNF 1CQTA 3F6OA 2LKXA 1OCRH 2ZXWH 2CV0A 3ZCOA 4P55A 1Z7LA 1O7FA 1MMSA 4ASNA 3BPVA 2O5RA 3DCFA 1S6LA 3LSGA 1G8XA 2CO5A 2RVCA 4HQMA 4MQ9F 3CCEI 4CO8A 2VASA 3WU1B 3ZQLA 1MH4A 1JHFA 2L7FP 5J6XA 5TRDA 2CSOA 3GTMJ 3AG3H 3V8KA 5IOYA 2ZJQF 3W6JB 4CCLA 1X2MA 1VTNC 3PSIA 2V6CA 1Y0NA 1OQYA 3O2PE 5KCMA 5JVGF 4O5VA 2EA2A 4FX4A 5K5QA 3OYHA 2XRLA 4Y17A 2EQRA 2R7DA 3WTVC 4Q47A 1TWFJ 4A3MJ 2E1OA 4N4NB 1LQ1A 2IGMA 3BCAA 5HOOA 5B1BH 1BW6A 4V2FA 2FOWA 3DPUA 5CVIA 1LPQA 5L3CA 1ZREA 2BVMA 4CYCA 1FJLA 5J47A 3A4CA 2AXLA 2XGXA 2X0LA 4V19K 3WHBA 1YIJI 2DA2A 1D1BA 5JLWA 4D0PA 5H6QA 1JKRC 3OYLA 2V1XA 3T0YA 1IXRC 2M4GA 2MABA 1ZELA 3AKZA 2COBA 1LVAA 2HOAA 3Q3SA 4RGXA 4TV7A 2KIQA 4BQNA 2NXNB 1BIBA 1JE8A 4B47A 3EPZA 1RETA 3QAHA 1TTYA 3FK7A 1ZGWA 5CVVA 2FA5A 3ML6A 3L5ZA 1M1EB 3HG9A 4S0HB 3JRCA 4ZZLA 4BQQA 1SD5A 2JSCA 3FBNB 2HWVA 1X19A 3KP2A 1E17A 1SVLA 4XM3A 2XKOA 1HCRA 4F52A 5D8KB 4L9TA 4RMNA 2ZFUA 1P4XA 4NC6A 2CUJA 2DAOA 2JA5J 2KQRA 3HUGB 3D5SC 4KIGA 1USSA 2QVOA 1RPWA 2FNAA 1YRNB 6PAXA 1IN6A 2VE8A 1G4DA 2BY2A 3GFMA 3DFGA 2F5FA 1BBYA 1TQIA 2V9VA 1TT0A 4G7HF 1VI0A 4IPAA 2VB6A 4IX7A 3K2ZA 3M8JA 4Y4RA 5B1AH 1PUEE 2V9KA 3DV8A 4L0ZB 4KN7X 2E5NA 2VQCA 1DP3A 4XN0A 2QLZA 4G8XA 1BC7C 1HKQA 1KYWA 1LJ9A 3DBLB 2K9LA 4U0YA 3IAS2 4CUGA 1ETXA 1OJLA 1RR8C 5BOXA 4BY1J 5M5XJ 2DTRA 3S1RJ 1FYKA 3NEUA 3V7CA 4HNVA 3U21A 3MFKA 2UUZA 1BR4A 1TWCJ 2A5WA 3VEPA 2R7OA 3CO7C 3JRHA 3GBGA 2NOGA 4UB8C 4M6YA 2NOJB 3EUHA 2XF7A 3KPHA 4GRIA 2W7NA 1F4KA 2RNJA 5LHIA 5K5RA 2LF7A 4U7DA 3SDGA 1RC9A 4EJTA 3LAPA 2R7FA 3I4MJ 2MBFA 3VYTB 1WH7A 3JAMK 1WJ5A 4BDYA 1LEAA 2L01A 3GFJA 1UJ8A 3ZOBA 3ZMUA 1ZRFA 1T0FC 4JX6A 3GFLA 1X3WB 3BQYA 2CV2A 1RESA 3V8JA 2XASA 1FWZA 1G3WA 3CF2A 4YFXF 1XPXA 4C3IJ 2OOIA 1IW7F 2X9DA 1HBXG 2E2HJ 5ICCA 2MD5A 1SVOA 1XCBA 3OR1C 3GTGJ 2DBBA 4ZTFA 3JREA 3LA7A 1VNDA 2E1CA 1YJNI 1J5YA 4JX4A 1FMWA 3BR3A 5IT9K 3M7GA 2DK5A 3FXOA 3QPSA 3VDXA 1A6IA 4PGHA 3GW2A 1VQ4I 3F8FA 3ZPLA 2H1KA 3H5AA 4PJJA 1ZRDA 1TLHB 2KIFA 4A69C 4JOMA 5F1JA 5J8FA 3CCUI 2DYRH 2KL4A 2KLOA 2XSDC 3RSNA 5LEJA 1G81A 5BQTA 2OZUA 3DKXA 3D0SA 2AO9A 4XLAA 4G7OF 4C2MJ 4XLNF 3SJMA 1R1UA 4Y13A 1SVMA 4BE1A 4E70A 1GV5A 2M4KA 2VC0A 1K79A 3A1YA 2PEXA 4NC7A 4NUBA 3J80Z 2M34A 1T6SA 1FYMA 3MQ0A 2L7KA 4GGGA 4HOBA 3CCJI 2HDDA 3W2WA 5HLIA 3TQNA 1U0JA 4M6VA 4XOTA 4U88A 5GAEJ 3OY9A 2VC1A 3F8CA 3MZ8A 4LGWA 3HPGA 4KA4A 4HBLA 4Y3OA 2ID3A 3FXUA 2Q2EA 4MLOA 2F4OB 2CJJA 2K9MA 3OYJA 2R7XA 2X1DA 2NWIA 4A3IJ 3D5LA 3RKQA 1REPC 4ZYAA 1KGSA 4LK1F 1RKWA 3DBRB 4LLLA 4A3GJ 4ZSIA 1TZLA 4KT5C 1R1TA 2M7AA 4Q4ZF 2HQRA 1P4WA 5J4YA 3TW7A 1FT9A 1F5TA 1F9NA 5DUIA 4A5NA 5A2QZ 1U8BA 2WADA 3LOCA 1BA5A 2Y31A 3F21A 4IJAA 3FDYA 3CJTB 2KJCA 3HB9A 1DU6A 1VQLI 4E4HA 3G3ZA 1TWAJ 2VQHA 4IF4A 1J0RA 5F0CA 4LLNA 2B63J 4RB1A 2UZKA 1T08B 4P9UA 2EB7A 4L5JA 3DPLC 3GLXA 1MNEA 3AFHA 3KE2A 1SANA 2RQPA 1LUJB 3RKXA 1JUPA 2LKSA 1FYLA 1N75A 3HRUA 4HF2A 2A05A 2JT1A 1YYVA 3GTOJ 3BR6A 1TQMA 2X6XA 2PJRB 4IKFA 2G9WA 3IWFA 2P0WA 2IAIA 2FX0A 2A6HF 2L9VA 3ASNH 4D7MA 2K27A 1NH3A 2X6YA 1XLRA 4M9SA 3SZPA 1JTXA 3NARA 1B59A 4EM2A 3CUQC 3RIRA 1FZPB 2XB5A 3PUBA 4P5OA 1E3OC 1XSXA 1G1BA 1ONVA 1Z6TA 3KP5A 1HSTA 2EWNA 1D5YA 3LQQA 2E1MC 5FROA 5J8CA 3EDPA 4IRIA 5D6FA 5FRNA 1BOAA 2VE9A 2IGOA 5F04A 1WPKA 1IZ1A 2DJIA 1JJ8C 3I59A 1QRYA 3KP7A 4IVNA 3S8PA 4BH9A 1VQPI 1DUXC 2OAZA 4P96A 1XGSA 2X48A 3AL0C 4J01A 2HOEA 3HPHA 1I3AA 4ITVA 5DUKA 4A3DJ 4ZDLA 1W36D 2QM3A 1B6AA 3PFYA 3EETA 2DA7A 5KAFC 2MYSA 3K6GA 3GXOA 4PFPA 4A0ZA 4A6EA 2R7SA 2LY2A 3VSLA 2K9SA 1QO0D 2OBPA 2OU2A 3L2UA 1VQMI 1EH8A 4L9VA 5EEHA 3BZ6A 2H6CA 5KVRA 3I4NJ 2O7OA 3LWFA 2R3SA 2WTEA 1NG6A 1I6XA 1YITI 1R71A 4P9FA 4BEHA 4XBFA 5LGUA 3RPQA 4BJTA 3VFZA 1XS9A 3GTQJ 4WXCA 2ISYA 3MZYA 1G2HA 3HRSA 5H6RA 1WRJA 1FOXA 3OYNA 3I9V2 2GM4A 1JI8A 2IW5A 1S7EA 1YW9A 2OQGA 5F08A 3LSHA 4QSHA 4L0YB 1X3ZB 3EUKL 2VQGA 3WGGA 3HOZJ 4HV5A 1Y0UA 2JA6J 3TO9A 2BVLA 1B1BA 4BHCA 1E2XA 4QLCU 4B44A 2G0EA 4WXDA 3G4SI 4OIRF 2KHMA 5EG0A 3JRAA 3JTGA 2W57A 1YO5C 3TDZC 3JTHA 2V6EA 3OMYA 2EA4A 4CGZA 3J81K 5GPCA 4BDZA 2DT5A 1MBHA 4CSWA
chains in the Genus database with same CATH topology
3QP5A 3Q9VA 3LA2A 1B9NA 3TO6A 2FQ3A 4IRHA 2MA3A 4IXAA 1JGSA 5CLSA 1WSUA 4U7BA 5FLXK 3U9GA 2XUBA 3F6VA 4RS8A 3HSFA 1G3YA 1TBXA 3BROA 3O3KA 3FXRA 5DD4A 2VT2A 2VODA 3BDDA 3QPTA 4PCQA 1SFUA 2ZMEA 3KLNA 2FU4A 1ON2A 5EEGA 4YIFA 4WX9A 5DD8A 1XDSA 4FX0A 4UVBA 1H9GA 4KDPA 5DEQA 2PN6A 1J2XA 4MTEA 3IHUA 3KEQA 3HYIA 4I0AA 1OR7A 2NYXA 1RUOA 4O3MA 1O3QA 4WF2A 3CUQB 1U5TA 2FMYA 2GA1A 2GXGA 1FBUA 3E6DA 2VOOA 3ZMSA 4N0BA 2A07F 2P5LC 1S3JA 2QBYB 3I5UA 3E6MA 2W84A 1STZA 4R79A 1H0MA 2VXZA 3ZMVA 4AIJA 2RGVA 5E8GA 1U2WA 3LFKA 3WG9A 4JBAA 3GWZA 3ZMTA 5ILSA 3GZ5A 3LSTA 4M71A 4ZH4F 1I27A 3VODA 1HW2A 1W5SA 1G6NA 2QQAA 2VOPA 3Q9SA 2UXNA 2PFBA 1V3FA 2VBYA 2NRAC 2L4MA 1SFEA 1R58A 4N9HA 3RTRA 1FSHA 3I71A 5FGMA 2GWRA 2BBYA 3GF2A 3R0JA 3IWZA 3T8TA 3S2WA 3IRQA 1WI9A 2HTSA 3EYIA 4ENMA 4I02A 3V4GA 4CYDA 2D1VA 2H27A 3QOPA 2G7UA 5ICFA 2HR3A 3COAC 2UWMA 4RB2C 1WKMA 2HGCA 3IRRA 3W6KB 2TDXA 2CG4A 3L9FA 2STWA 4EMSA 1KQ0A 4S04A 1DP7P 1KQ9A 5DCMA 2H09A 3TDUC 3QP6A 2ZKZA 1KA8A 1ZH5A 1MDMB 2JZYA 5E18F 5HLHA 1BC8C 1IXCA 1UFMA 3BJOA 3HHGA 5L3GA 1U8RA 1XN7A 3F8LA 2YSRA 2CGPA 5HDNA 4M72A 1R5GA 2ZNYA 5ERIA 4OMZA 1T2KA 3JSPA 3KP3A 1H9TA 3RKYA 3QPHA 3WODF 3L2CA 2RKHA 3MEXA 2RN7A 2HKOA 2O8XA 1Q1HA 3VB2A 2DPDA 3O6BB 1MKMA 2K4JA 5CJ9A 2Z9OA 4IHSA 5F6FA 5CVJA 3R6SA 2XRNA 2RC4A 5JR3A 5D4RA 1UCRA 1AWCA 3E5UA 1BI1A 2CYYA 1R22A 3IC7A 4G7ZF 1IRFA 1XSVA 1BM9A 2GA2A 5TJJA 3DF8A 1SAXA 2ZO4A 5E17F 3KZYA 5LEKA 4RB3C 3E6CC 4GXOA 3I58A 4OINF 5E8IA 2P5VA 3ZMZA 1BJAA 4EV0A 4RGRA 3SXYA 1O57A 2HYFA 1I1GA 2C6YA 2YX7A 1HW5A 1SD4A 2P8TA 2FNPA 2ETHA 4L9NA 1R1VA 5BS6A 4MQVA 2M30A 2QZ8A 2DPUA 2Z5UA 2E1NA 3CUOA 4I7HA 4JQFA 1A04A 4EGYA 2XV4S 1W5TA 4AIHA 2ESNA 3BJ6A 1LDDA 1QPMA 2PKHA 2IRFG 5BPDA 3BWGA 1U78A 1DPUA 4M9XA 3V7RA 4UV9A 1JHHA 2DQLA 3P9CA 3I0TA 4AVPA 1LEBA 2GXBA 4LG0A 2Y0MA 3ABUA 3LAJA 4XSZF 2GQQA 2ZBKA 4LMYA 1ZLKA 3RPUA 5BMZA 1MGTA 4RGSA 2HKXA 3N4MA 1IN7A 2XAFA 5JFRA 2OQRA 3RI4A 1XGNA 4B09A 2XKPA 1W7PA 1BI3A 1P6RA 2E7XA 1UHMA 5D5WB 2COMA 2XHKA 4ON0A 1G3SA 2UXXA 3HRMA 1T98A 1CF7A 3IL2A 2KIMA 4R1HA 1LNWA 1FLIA 3FMRA 3F23A 1YS7A 4RGUA 1FOKA 5HS9A 5LHGA 3VOEA 3K0LA 1YW8A 1HW1A 2NNYA 3T5XA 2ZJ2A 2ESHA 5FD6A 2M5WA 5K5OA 3TKYA 4EGZA 2WWYA 1PP7U 1T0FA 1TW3A 1RUNA 3PQJA 4LJZF 4UXNA 3J80K 3SZTA 1S8NA 5HS8A 1WQ2A 3B73A 2VBXA 1IUYA 1LDJA 5FFXA 3HTUA 2WV0A 4HQEA 3DDVA 2FBHA 1ZRCA 2FE3A 3ERED 1MJ9A 4EM1A 3U1DA 4WWCA 2M87A 1FP2A 1TNSA 2K4BA 4G6QA 4CXFA 4PDKA 5A2QK 2O6GE 1OYYA 1ZGAA 2JRTA 2FSWA 4BNCA 3WU0A 2EFOA 4MNUA 4KFCA 3K69A 1Z05A 4UVCA 1L3LA 2HYGD 3R4KA 3B02A 1TQPA 3SQNA 2OD5A 4HDVA 2MLKA 2F5CA 3KETA 5LRRA 4HF1A 1TW2A 3E5QA 1Z6RA 1SMTA 1IN8A 2OGGA 4H0EA 2HTJA 3R61A 4RB0A 4NQWA 2MH9A 3R0AA 3DEUA 3FWEA 1CGPA 4OU0A 4BXUA 2ADUA 3AAFA 1Z91A 4F7ZA 4PZJA 2P6TA 3FM3A 3E3VA 1IN5A 3RJPA 4IRGA 3T1BA 3DP7A 3ZMDA 4ZZDA 3ECOA 3C1DA 3HSRA 5ICEA 2EFWA 1HKTA 3CNVA 3ZN0A 2W24A 1K7AA 2AS5F 3CLOA 5D5VB 1RZ4A 3WTZA 3MAJA 1Z1DA 2PI0A 1KYZA 2P4WA 2V1DA 1IF1A 1PDNC 1HSJA 2ZCWA 4S05A 3H92A 3KCCA 2IPQX 4Q48A 3GYHX 2IA2A 2YX4A 3Q5FA 4MEXF 2OZ6A 3HHHA 5CYVA 4BHBA 2LKPA 5L3EA 4EJVA 2O61A 3FXQA 1K78A 1BIAA 1IAWA 1U3EM 2MH2A 1LB2A 3KEOA 4A12A 3E97A 1QBJA 5FFZA 5D6EA 3I59B 1ZAOA 3KLOA 5DV5A 1LDKB 2Y48A 1ULYA 3DKWA 3M8FA 2P7CB 2D1HA 2O03A 1ZARA 2CQKA 1ZG1A 2EV6A 1ZHFA 2PG4A 1MD0A 4GO1A 1W7PD 4LB6B 5JVTA 3RDIA 5HDGA 2DI3A 2DK8A 4DNCA 3MWMA 3P7NA 2P5KA 2K86A 4WXHA 4A5MA 3ZQ7A 2STTA 5KK1A 4EVIA 1ZG5A 3F3XA 4A0XA 4HA8A 2JPBA 4HLYA 2X4HA 2P6SA 2BV6A 3C3WA 2QQ9A 2L02A 1MDMA 4HYEA 3TO7A 4ESJA 1YTYA 3K1MA 1P92A 2QUFA 5DDGA 4HX8A 1R23A 5L3DA 3GUDA 3OOPA 3L09A 3I64A 1MJBA 5JI6A 3C18A 3F8NA 4BHPA 1FW9A 4AWXB 1D8JA 4ZYGA 2LDUA 1F1ZA 1UHWA 4M9ZA 2ZMEB 2HDCA 3FM5A 2K7LA 4HAMA 2ACJA 5CVUA 2FEZA 5AIPA 1RI7A 1J7KA 2A3SA 2PBIA 4BYYA 1QZYA 3GEZA 2FBKA 1YG2A 3GVAA 2YU3A 4OIQF 2FOKA 3PFIA 3LA3A 2HZTA 2EK5A 2NNNA 5DYMA 4CICA 5LBQA 4KNYA 3FHZA 3IKVA 2KKOA 5HS7A 3P9IA 3L00A 3E6BA 1HKSA 4YIIA 4WCGA 1P2FA 2YPRA 1EH7A 4NB5A 3HUGA 1XCVA 2VT3A 4G9YA 3WTWC 5AONA 3WTXC 4I98B 3ZP5A 2DW4A 4KYWA 4HDUA 1J59A 2YR2A 1T38A 2ISZA 2NAZA 2K02A 1YLFA 4UVAA 4WK8F 3EYYA 1BI2A 3RYPA 4AD9A 5FD5A 3WTUC 4K2EA 1I5ZA 3C7JA 4G6DA 3R60A 4DQ2A 3GFIA 4UNOA 5L3FA 3IKTA 2PLYA 1AOYA 4A6DA 1IXSB 4MHGA 3JSOA 1PP8F 5HLGA 2LNBA 1O3SA 4M74A 1XD7A 3ZN1A 4Q5SF 4R8HA 4B8XA 5LRSA 1FSEA 1V4RA 2EV5A 2XIGA 3RKWA 2IA1A 1R00A 3FZVA 1R7JA 5D5XB 2AHCA 1GVJA 2J5PA 2M8EA 5DCMB 2XAJA 3V8LA 2PJPA 4OIOF 2NS0A 1T39A 2GIVA 2ELHA 1SD6A 2XAHA 1ZYRF 1GXPA 2P19A 3H3UA 4MTDA 4YG2F 3SFZA 2P7VB 1O7LA 1USTA 4U0VA 2DU9A 1OMIA 1XMAA 4GYIA 5BPIA 4KMFA 2EFQA 3BJAA 4RAZA 4ZSKA 1EH6A 1DDNA 3JAMZ 1FC3A 3NRVA 1D8KA 2XAGA 3ELKA 4XSXF 3WGIA 1P4AA 1GHCA 3M1EA 1FX7A 2XAQA 3EQLF 3I54A 3DXJF 3BOQA 3HOTA 1OYIA 5IT9Z 1BN5A 1HQCA 1R36A 4EQQA 1TNTA 1IN4A 2CWEA 2EV0A 2IKKA 4OOIA 4KIBA 3TOBA 2QWWA 1S7AA 3HSEA 1Z7UA 1ON1A 4LFUA 2VN2A 3PQKA 4M6XA 3JW4A 1QGPA 4QWQA 1IRGA 1QNTA 1HXDA 4KIFA 1OKRA 3U2RA 4BQAA 1XB4A 2EFPA 2GZWA 1BI0A 4OIPF 4JK1X 2ZFWA 2FBIA 4N9IA 3TOAA 5LLQA 4IHTA 1J75A 3ISPA 5CVRA 4L9JA 2H94A 5ED4A 1Z9CA 2O3FA 3F8MA 3F72A 4CZZA 3H3ZA 3F22A 4RAYA 5D5UB 1FY7A 3WTTC 1JXSA 3K1NA 2DQRA 2Z33A 3QU3A 4YFKF 4ESBA 2IA0A 4G94A 2M1BA 1OPCA 4LG0B 4EJUA 3WE2A 4I09A 5H20A 3CDHA 1FPQA 2CFXA 1KU9A 4MGRA 3BY6A 3REOA 1GXQA 2LF8A 3T8RA 5L3BA 3WTSC 4HX7A 2KRFA 2H6BA 3KFWX 4NHJA 4UV8A 1W7PB 2WC2A 4BAYA 1ZG3A 2FXAA 5DCFA 2V1UA 1TT8A 1KU3A 3HOSA 3L7WA 4ENKA 4ENNA 1KU7A 2KIUA 4MEYF 2Z99A 2FF4A 2M45A 3DPTA 3ECHA 4LLGF 5ICGA 1CF7B 2RDPA 5ILUA 1ZN2A 1DPRA 4A0YA 4CHUA 4I0BA 4ZSBA 2L54A 2F5DA 5FO5A 2IVMA 4PGGA 4FT8A 1FBSA 2A69F 2HFHA 1SFXA 4KICA 3RYRA 3MZHA 2PMUA 3FMQA 3FMSA 2KJBA 3G73A 4Y15A 2DO7A 3OV8A 3ROUA 2Q8KA 5HDKA 3KP6A 4HW0A 1B9MA 1UB9A 3CUQA 4O6JA 1QQIA 2JPCA 5HVQC 4UHTA 4KN4X 1ZGJA 1R5HA 2QBYA 1MZBA 2F2EA 1S7OA 1I1SA 1U6GA 1FBQA 1X3UA 2A6EF 1XGMA 3MCZA 3BP8A 3J81Z 1JD3A 1YQAA 5ILVA 1SMYF 2DFIA 4OMYA 5IT3A 1G3TA 1XMKA 2A68F 5FLXZ 4ESFA 2Z3YA 5JHUA 3F8BA 4HZFA 3QRFF 3HTSB 2DLLA 2FMLA 2D2WA 2FRHA 3CJNA 3KZZA 3LHEA 2G7HA 1K6OA 1U5TC 2J5OA 2CW0F 3CTAA 1XSDA 2A5YB 2HQNA 2ZXJA 1OYWA 2VONA 4ZYEA 1KQ8A 2Y75A 2XROA 5D8LB 1YIOA 3I4PA 1YS6A 4UUVA 4L18B 2EJRA 2W25A 1D3YA 4ZYDA 2L4AA 4HV6A 2JTVA 1FP1D 2HEOA 2PQ8A 5LHHA 3DQVC 3WTYC 4ENJA 4U0WA 2PMHA 2IP2A 2ZNZA 1XDUA 2F5EA 3N97A 1YW7A 1B4AA 2D45A 5E1XA 2MLGA 3WE3A 2E7WA 4XLPF 1QZZA 3V7SA 2A61A 3HIFA 1YFHA 3K9TA 2B0LA 1KU2A 3HFIA 4EJWA 3HRTA 3P9KA 2OA4A 4KMUX 1FNNA 1SD7A 2RA5A 5LGTA 1RIOH 3I53A 3M9AA 3NQOA 5F64A 4GCVA 2L3DA 1O3TA 3WGHA 1O3RA 4AIKA 4EJOA 4L5IA 5E20A 2IT0A 2XVCA 3SHFA 3GX4X 2V79A 3ABTA 4I2OA 1K78B 3K1PA 2QENA 1S29A 3GO5A 5F1RA 2RV8A 1D5VA 2BYVE 4XRFA 3M8EA 4ETSA 2LSOA 5E1ZB 3LQRA 2QQBA 4FHTA 4CDGA 2QYOA 3TGNA 4EM0B 5LGNA 4ZYHA 3CO6C 4KUMA 2BEOA 3ULQB 1EV7A 2Q0OA 2HS5A 2VBWA 4M73A 4Z2YA 4HF0A 1J9IA 1RNLA 3KP4A 4LD5A 1NHAA 3FF5A 1L0OC 1ODDA 3QU6A 4GYGA 4LB5A 1U5TB 2GAUA 2O0YA 4HX4A 4I01A 5D4SA 5AIQA 4HLXA 1MJAA 3BPXA 2EFNA 5E1WA 1XGOA 3E5XA 2BE5F 2MC3A 3GZ6A 2BGCA 2W85A 5FB2A 1WWXA 3FX3A 1ZLJA 5K1YA 1W4MA 2FA1A 3J7AO 2VBZA 4A2UA 2IJLA 4LK0F 1C0WA 4YFNF 3F6OA 4P55A 1O7FA 4ASNA 3BPVA 1S6LA 2CO5A 4HQMA 2RVCA 4MQ9F 4CO8A 3WU1B 1JHFA 5J6XA 5TRDA 2CSOA 3V8KA 3W6JB 1VTNC 2V6CA 3O2PE 4O5VA 2EA2A 4FX4A 5K5QA 4Y17A 2R7DA 3WTVC 4Q47A 1LQ1A 5HOOA 5CVIA 5L3CA 1ZREA 2AXLA 2XGXA 2X0LA 4D0PA 5H6QA 2V1XA 3T0YA 1IXRC 1LVAA 4RGXA 4TV7A 1BIBA 1JE8A 3QAHA 1TTYA 5CVVA 2FA5A 3ML6A 3L5ZA 4ZZLA 1SD5A 2JSCA 2HWVA 3KP2A 1E17A 2XKOA 5D8KB 4L9TA 1P4XA 2DAOA 4KIGA 1USSA 2QVOA 2FNAA 6PAXA 1IN6A 2VE8A 1G4DA 3GFMA 3DFGA 2F5FA 1BBYA 1TQIA 2V9VA 4G7HF 4IPAA 3K2ZA 1PUEE 3DV8A 4L0ZB 4KN7X 2QLZA 4G8XA 1BC7C 1HKQA 1KYWA 1LJ9A 4U0YA 5BOXA 2DTRA 1FYKA 3NEUA 3V7CA 3MFKA 3CO7C 3VEPA 4M6YA 3EUHA 1F4KA 2RNJA 5LHIA 5K5RA 4U7DA 2LF7A 4EJTA 3LAPA 2R7FA 2MBFA 3JAMK 1LEAA 2L01A 3GFJA 3ZMUA 1ZRFA 3GFLA 3V8JA 2XASA 1FWZA 1G3WA 4YFXF 2OOIA 1IW7F 1HBXG 5ICCA 2MD5A 1XCBA 2DBBA 3LA7A 2E1CA 1J5YA 5IT9K 3M7GA 2DK5A 4PGHA 3GW2A 3ZPLA 3F8FA 1ZRDA 1TLHB 2KIFA 5J8FA 5LEJA 1G81A 5BQTA 2OZUA 3D0SA 4G7OF 4XLNF 1R1UA 4Y13A 4E70A 2VC0A 1K79A 2PEXA 3J80Z 1T6SA 1FYMA 3MQ0A 4GGGA 4HOBA 5HLIA 3TQNA 4U88A 2VC1A 3F8CA 4LGWA 4KA4A 4HBLA 3FXUA 2Q2EA 2NWIA 3D5LA 1REPC 1KGSA 4LK1F 4LLLA 4ZSIA 4KT5C 1R1TA 4Q4ZF 2HQRA 1P4WA 1FT9A 1F5TA 1F9NA 5DUIA 4A5NA 5A2QZ 3F21A 4IJAA 2KJCA 3G3ZA 4IF4A 1J0RA 4LLNA 4RB1A 2UZKA 4P9UA 2EB7A 4L5JA 3DPLC 3GLXA 3KE2A 2RQPA 3RKXA 1FYLA 3HRUA 4HF2A 2JT1A 1YYVA 1TQMA 2G9WA 3IWFA 2A6HF 2K27A 1XLRA 4EM2A 4M9SA 3SZPA 1B59A 3CUQC 3RIRA 1FZPB 4P5OA 1XSXA 1G1BA 1ONVA 1Z6TA 3KP5A 1HSTA 2EWNA 3LQQA 5J8CA 3EDPA 4IRIA 5D6FA 1BOAA 2VE9A 1IZ1A 3I59A 3KP7A 4IVNA 4BH9A 1DUXC 2OAZA 4P96A 1XGSA 2HOEA 5DUKA 2QM3A 1B6AA 3EETA 3GXOA 4A0ZA 4A6EA 1QO0D 2OBPA 2OU2A 1EH8A 4L9VA 5EEHA 3BZ6A 2H6CA 5KVRA 3LWFA 2R3SA 2WTEA 1I6XA 4P9FA 4XBFA 5LGUA 3RPQA 3VFZA 4WXCA 2ISYA 3MZYA 3HRSA 5H6RA 1WRJA 2IW5A 1YW9A 2OQGA 4L0YB 3WGGA 4HV5A 1Y0UA 3TO9A 4QLCU 1B1BA 1E2XA 4BHCA 4WXDA 4OIRF 3JTGA 2W57A 1YO5C 3TDZC 3JTHA 2EA4A 4CGZA 3J81K 2DT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QP5 A;  3Q9V A;  3LA2 A;  1B9N A;  3TO6 A;  2FQ3 A;  4IRH A;  2MA3 A;  4IXA A;  1JGS A;  5CLS A;  1WSU A;  4U7B A;  5FLX K;  3U9G A;  2XUB A;  3F6V A;  4RS8 A;  3HSF A;  1G3Y A;  1TBX A;  3BRO A;  3O3K A;  3FXR A;  5DD4 A;  2VT2 A;  2VOD A;  3BDD A;  3QPT A;  4PCQ A;  1SFU A;  2ZME A;  3KLN A;  2FU4 A;  1ON2 A;  5EEG A;  4YIF A;  4WX9 A;  5DD8 A;  1XDS A;  4FX0 A;  4UVB A;  1H9G A;  4KDP A;  5DEQ A;  2PN6 A;  1J2X A;  4MTE A;  3IHU A;  3KEQ A;  3HYI A;  4I0A A;  1OR7 A;  2NYX A;  1RUO A;  4O3M A;  1O3Q A;  4WF2 A;  3CUQ B;  1U5T A;  2FMY A;  2GA1 A;  2GXG A;  1FBU A;  3E6D A;  2VOO A;  3ZMS A;  4N0B A;  2A07 F;  2P5L C;  1S3J A;  2QBY B;  3I5U A;  3E6M A;  2W84 A;  1STZ A;  4R79 A;  1H0M A;  2VXZ A;  3ZMV A;  4AIJ A;  2RGV A;  5E8G A;  1U2W A;  3LFK A;  3WG9 A;  4JBA A;  3GWZ A;  3ZMT A;  5ILS A;  3GZ5 A;  3LST A;  4M71 A;  4ZH4 F;  1I27 A;  3VOD A;  1HW2 A;  1W5S A;  1G6N A;  2QQA A;  2VOP A;  3Q9S A;  2UXN A;  2PFB A;  1V3F A;  2VBY A;  2NRA C;  2L4M A;  1SFE A;  1R58 A;  4N9H A;  3RTR A;  1FSH A;  3I71 A;  5FGM A;  2GWR A;  2BBY A;  3GF2 A;  3R0J A;  3IWZ A;  3T8T A;  3S2W A;  3IRQ A;  1WI9 A;  2HTS A;  3EYI A;  4ENM A;  4I02 A;  3V4G A;  4CYD A;  2D1V A;  2H27 A;  3QOP A;  2G7U A;  5ICF A;  2HR3 A;  3COA C;  2UWM A;  4RB2 C;  1WKM A;  2HGC A;  3IRR A;  3W6K B;  2TDX A;  2CG4 A;  3L9F A;  2STW A;  4EMS A;  1KQ0 A;  4S04 A;  1DP7 P;  1KQ9 A;  5DCM A;  2H09 A;  3TDU C;  3QP6 A;  2ZKZ A;  1KA8 A;  1ZH5 A;  1MDM B;  2JZY A;  5E18 F;  5HLH A;  1BC8 C;  1IXC A;  1UFM A;  3BJO A;  3HHG A;  5L3G A;  1U8R A;  1XN7 A;  3F8L A;  2YSR A;  2CGP A;  5HDN A;  4M72 A;  1R5G A;  2ZNY A;  5ERI A;  4OMZ A;  1T2K A;  3JSP A;  3KP3 A;  1H9T A;  3RKY A;  3QPH A;  3WOD F;  3L2C A;  2RKH A;  3MEX A;  2RN7 A;  2HKO A;  2O8X A;  1Q1H A;  3VB2 A;  2DPD A;  3O6B B;  1MKM A;  2K4J A;  5CJ9 A;  2Z9O A;  4IHS A;  5F6F A;  5CVJ A;  3R6S A;  2XRN A;  2RC4 A;  5JR3 A;  5D4R A;  1UCR A;  1AWC A;  3E5U A;  1BI1 A;  2CYY A;  1R22 A;  3IC7 A;  4G7Z F;  1IRF A;  1XSV A;  1BM9 A;  2GA2 A;  5TJJ A;  3DF8 A;  1SAX A;  2ZO4 A;  5E17 F;  3KZY A;  5LEK A;  4RB3 C;  3E6C C;  4GXO A;  3I58 A;  4OIN F;  5E8I A;  2P5V A;  3ZMZ A;  1BJA A;  4EV0 A;  4RGR A;  3SXY A;  1O57 A;  2HYF A;  1I1G A;  2C6Y A;  2YX7 A;  1HW5 A;  1SD4 A;  2P8T A;  2FNP A;  2ETH A;  4L9N A;  1R1V A;  5BS6 A;  4MQV A;  2M30 A;  2QZ8 A;  2DPU A;  2Z5U A;  2E1N A;  3CUO A;  4I7H A;  4JQF A;  1A04 A;  4EGY A;  2XV4 S;  1W5T A;  4AIH A;  2ESN A;  3BJ6 A;  1LDD A;  1QPM A;  2PKH A;  2IRF G;  5BPD A;  3BWG A;  1U78 A;  1DPU A;  4M9X A;  3V7R A;  4UV9 A;  1JHH A;  2DQL A;  3P9C A;  3I0T A;  4AVP A;  1LEB A;  2GXB A;  4LG0 A;  2Y0M A;  3ABU A;  3LAJ A;  4XSZ F;  2GQQ A;  2ZBK A;  4LMY A;  1ZLK A;  3RPU A;  5BMZ A;  1MGT A;  4RGS A;  2HKX A;  3N4M A;  1IN7 A;  2XAF A;  5JFR A;  2OQR A;  3RI4 A;  1XGN A;  4B09 A;  2XKP A;  1W7P A;  1BI3 A;  1P6R A;  2E7X A;  1UHM A;  5D5W B;  2COM A;  2XHK A;  4ON0 A;  1G3S A;  2UXX A;  3HRM A;  1T98 A;  1CF7 A;  3IL2 A;  2KIM A;  4R1H A;  1LNW A;  1FLI A;  3FMR A;  3F23 A;  1YS7 A;  4RGU A;  1FOK A;  5HS9 A;  5LHG A;  3VOE A;  3K0L A;  1YW8 A;  1HW1 A;  2NNY A;  3T5X A;  2ZJ2 A;  2ESH A;  5FD6 A;  2M5W A;  5K5O A;  3TKY A;  4EGZ A;  2WWY A;  1PP7 U;  1T0F A;  1TW3 A;  1RUN A;  3PQJ A;  4LJZ F;  4UXN A;  3J80 K;  3SZT A;  1S8N A;  5HS8 A;  1WQ2 A;  3B73 A;  2VBX A;  1IUY A;  1LDJ A;  5FFX A;  3HTU A;  2WV0 A;  4HQE A;  3DDV A;  2FBH A;  1ZRC A;  2FE3 A;  3ERE D;  1MJ9 A;  4EM1 A;  3U1D A;  4WWC A;  2M87 A;  1FP2 A;  1TNS A;  2K4B A;  4G6Q A;  4CXF A;  4PDK A;  5A2Q K;  2O6G E;  1OYY A;  1ZGA A;  2JRT A;  2FSW A;  4BNC A;  3WU0 A;  2EFO A;  4MNU A;  4KFC A;  3K69 A;  1Z05 A;  4UVC A;  1L3L A;  2HYG D;  3R4K A;  3B02 A;  1TQP A;  3SQN A;  2OD5 A;  4HDV A;  2MLK A;  2F5C A;  3KET A;  5LRR A;  4HF1 A;  1TW2 A;  3E5Q A;  1Z6R A;  1SMT A;  1IN8 A;  2OGG A;  4H0E A;  2HTJ A;  3R61 A;  4RB0 A;  4NQW A;  2MH9 A;  3R0A A;  3DEU A;  3FWE A;  1CGP A;  4OU0 A;  4BXU A;  2ADU A;  3AAF A;  1Z91 A;  4F7Z A;  4PZJ A;  2P6T A;  3FM3 A;  3E3V A;  1IN5 A;  3RJP A;  4IRG A;  3T1B A;  3DP7 A;  3ZMD A;  4ZZD A;  3ECO A;  3C1D A;  3HSR A;  5ICE A;  2EFW A;  1HKT A;  3CNV A;  3ZN0 A;  2W24 A;  1K7A A;  2AS5 F;  3CLO A;  5D5V B;  1RZ4 A;  3WTZ A;  3MAJ A;  1Z1D A;  2PI0 A;  1KYZ A;  2P4W A;  2V1D A;  1IF1 A;  1PDN C;  1HSJ A;  2ZCW A;  4S05 A;  3H92 A;  3KCC A;  2IPQ X;  4Q48 A;  3GYH X;  2IA2 A;  2YX4 A;  3Q5F A;  4MEX F;  2OZ6 A;  3HHH A;  5CYV A;  4BHB A;  2LKP A;  5L3E A;  4EJV A;  2O61 A;  3FXQ A;  1K78 A;  1BIA A;  1IAW A;  1U3E M;  2MH2 A;  1LB2 A;  3KEO A;  4A12 A;  3E97 A;  1QBJ A;  5FFZ A;  5D6E A;  3I59 B;  1ZAO A;  3KLO A;  5DV5 A;  1LDK B;  2Y48 A;  1ULY A;  3DKW A;  3M8F A;  2P7C B;  2D1H A;  2O03 A;  1ZAR A;  2CQK A;  1ZG1 A;  2EV6 A;  1ZHF A;  2PG4 A;  1MD0 A;  4GO1 A;  1W7P D;  4LB6 B;  5JVT A;  3RDI A;  5HDG A;  2DI3 A;  2DK8 A;  4DNC A;  3MWM A;  3P7N A;  2P5K A;  2K86 A;  4WXH A;  4A5M A;  3ZQ7 A;  2STT A;  5KK1 A;  4EVI A;  1ZG5 A;  3F3X A;  4A0X A;  4HA8 A;  2JPB A;  4HLY A;  2X4H A;  2P6S A;  2BV6 A;  3C3W A;  2QQ9 A;  2L02 A;  1MDM A;  4HYE A;  3TO7 A;  4ESJ A;  1YTY A;  3K1M A;  1P92 A;  2QUF A;  5DDG A;  4HX8 A;  1R23 A;  5L3D A;  3GUD A;  3OOP A;  3L09 A;  3I64 A;  1MJB A;  5JI6 A;  3C18 A;  3F8N A;  4BHP A;  1FW9 A;  4AWX B;  1D8J A;  4ZYG A;  2LDU A;  1F1Z A;  1UHW A;  4M9Z A;  2ZME B;  2HDC A;  3FM5 A;  2K7L A;  4HAM A;  2ACJ A;  5CVU A;  2FEZ A;  5AIP A;  1RI7 A;  1J7K A;  2A3S A;  2PBI A;  4BYY A;  1QZY A;  3GEZ A;  2FBK A;  1YG2 A;  3GVA A;  2YU3 A;  4OIQ F;  2FOK A;  3PFI A;  3LA3 A;  2HZT A;  2EK5 A;  2NNN A;  5DYM A;  4CIC A;  5LBQ A;  4KNY A;  3FHZ A;  3IKV A;  2KKO A;  5HS7 A;  3P9I A;  3L00 A;  3E6B A;  1HKS A;  4YII A;  4WCG A;  1P2F A;  2YPR A;  1EH7 A;  4NB5 A;  3HUG A;  1XCV A;  2VT3 A;  4G9Y A;  3WTW C;  5AON A;  3WTX C;  4I98 B;  3ZP5 A;  2DW4 A;  4KYW A;  4HDU A;  1J59 A;  2YR2 A;  1T38 A;  2ISZ A;  2NAZ A;  2K02 A;  1YLF A;  4UVA A;  4WK8 F;  3EYY A;  1BI2 A;  3RYP A;  4AD9 A;  5FD5 A;  3WTU C;  4K2E A;  1I5Z A;  3C7J A;  4G6D A;  3R60 A;  4DQ2 A;  3GFI A;  4UNO A;  5L3F A;  3IKT A;  2PLY A;  1AOY A;  4A6D A;  1IXS B;  4MHG A;  3JSO A;  1PP8 F;  5HLG A;  2LNB A;  1O3S A;  4M74 A;  1XD7 A;  3ZN1 A;  4Q5S F;  4R8H A;  4B8X A;  5LRS A;  1FSE A;  1V4R A;  2EV5 A;  2XIG A;  3RKW A;  2IA1 A;  1R00 A;  3FZV A;  1R7J A;  5D5X B;  2AHC A;  1GVJ A;  2J5P A;  2M8E A;  5DCM B;  2XAJ A;  3V8L A;  2PJP A;  4OIO F;  2NS0 A;  1T39 A;  2GIV A;  2ELH A;  1SD6 A;  2XAH A;  1ZYR F;  1GXP A;  2P19 A;  3H3U A;  4MTD A;  4YG2 F;  3SFZ A;  2P7V B;  1O7L A;  1UST A;  4U0V A;  2DU9 A;  1OMI A;  1XMA A;  4GYI A;  5BPI A;  4KMF A;  2EFQ A;  3BJA A;  4RAZ A;  4ZSK A;  1EH6 A;  1DDN A;  3JAM Z;  1FC3 A;  3NRV A;  1D8K A;  2XAG A;  3ELK A;  4XSX F;  3WGI A;  1P4A A;  1GHC A;  3M1E A;  1FX7 A;  2XAQ A;  3EQL F;  3I54 A;  3DXJ F;  3BOQ A;  3HOT A;  1OYI A;  5IT9 Z;  1BN5 A;  1HQC A;  1R36 A;  4EQQ A;  1TNT A;  1IN4 A;  2CWE A;  2EV0 A;  2IKK A;  4OOI A;  4KIB A;  3TOB A;  2QWW A;  1S7A A;  3HSE A;  1Z7U A;  1ON1 A;  4LFU A;  2VN2 A;  3PQK A;  4M6X A;  3JW4 A;  1QGP A;  4QWQ A;  1IRG A;  1QNT A;  1HXD A;  4KIF A;  1OKR A;  3U2R A;  4BQA A;  1XB4 A;  2EFP A;  2GZW A;  1BI0 A;  4OIP F;  4JK1 X;  2ZFW A;  2FBI A;  4N9I A;  3TOA A;  5LLQ A;  4IHT A;  1J75 A;  3ISP A;  5CVR A;  4L9J A;  2H94 A;  5ED4 A;  1Z9C A;  2O3F A;  3F8M A;  3F72 A;  4CZZ A;  3H3Z A;  3F22 A;  4RAY A;  5D5U B;  1FY7 A;  3WTT C;  1JXS A;  3K1N A;  2DQR A;  2Z33 A;  3QU3 A;  4YFK F;  4ESB A;  2IA0 A;  4G94 A;  2M1B A;  1OPC A;  4LG0 B;  4EJU A;  3WE2 A;  4I09 A;  5H20 A;  3CDH A;  1FPQ A;  2CFX A;  1KU9 A;  4MGR A;  3BY6 A;  3REO A;  1GXQ A;  2LF8 A;  3T8R A;  5L3B A;  3WTS C;  4HX7 A;  2KRF A;  2H6B A;  3KFW X;  4NHJ A;  4UV8 A;  1W7P B;  2WC2 A;  4BAY A;  1ZG3 A;  2FXA A;  5DCF A;  2V1U A;  1TT8 A;  1KU3 A;  3HOS A;  3L7W A;  4ENK A;  4ENN A;  1KU7 A;  2KIU A;  4MEY F;  2Z99 A;  2FF4 A;  2M45 A;  3DPT A;  3ECH A;  4LLG F;  5ICG A;  1CF7 B;  2RDP A;  5ILU A;  1ZN2 A;  1DPR A;  4A0Y A;  4CHU A;  4I0B A;  4ZSB A;  2L54 A;  2F5D A;  5FO5 A;  2IVM A;  4PGG A;  4FT8 A;  1FBS A;  2A69 F;  2HFH A;  1SFX A;  4KIC A;  3RYR A;  3MZH A;  2PMU A;  3FMQ A;  3FMS A;  2KJB A;  3G73 A;  4Y15 A;  2DO7 A;  3OV8 A;  3ROU A;  2Q8K A;  5HDK A;  3KP6 A;  4HW0 A;  1B9M A;  1UB9 A;  3CUQ A;  4O6J A;  1QQI A;  2JPC A;  5HVQ C;  4UHT A;  4KN4 X;  1ZGJ A;  1R5H A;  2QBY A;  1MZB A;  2F2E A;  1S7O A;  1I1S A;  1U6G A;  1FBQ A;  1X3U A;  2A6E F;  1XGM A;  3MCZ A;  3BP8 A;  3J81 Z;  1JD3 A;  1YQA A;  5ILV A;  1SMY F;  2DFI A;  4OMY A;  5IT3 A;  1G3T A;  1XMK A;  2A68 F;  5FLX Z;  4ESF A;  2Z3Y A;  5JHU A;  3F8B A;  4HZF A;  3QRF F;  3HTS B;  2DLL A;  2FML A;  2D2W A;  2FRH A;  3CJN A;  3KZZ A;  3LHE A;  2G7H A;  1K6O A;  1U5T C;  2J5O A;  2CW0 F;  3CTA A;  1XSD A;  2A5Y B;  2HQN A;  2ZXJ A;  1OYW A;  2VON A;  4ZYE A;  1KQ8 A;  2Y75 A;  2XRO A;  5D8L B;  1YIO A;  3I4P A;  1YS6 A;  4UUV A;  4L18 B;  2EJR A;  2W25 A;  1D3Y A;  4ZYD A;  2L4A A;  4HV6 A;  2JTV A;  1FP1 D;  2HEO A;  2PQ8 A;  5LHH A;  3DQV C;  3WTY C;  4ENJ A;  4U0W A;  2PMH A;  2IP2 A;  2ZNZ A;  1XDU A;  2F5E A;  3N97 A;  1YW7 A;  1B4A A;  2D45 A;  5E1X A;  2MLG A;  3WE3 A;  2E7W A;  4XLP F;  1QZZ A;  3V7S A;  2A61 A;  3HIF A;  1YFH A;  3K9T A;  2B0L A;  1KU2 A;  3HFI A;  4EJW A;  3HRT A;  3P9K A;  2OA4 A;  4KMU X;  1FNN A;  1SD7 A;  2RA5 A;  5LGT A;  1RIO H;  3I53 A;  3M9A A;  3NQO A;  5F64 A;  4GCV A;  2L3D A;  1O3T A;  3WGH A;  1O3R A;  4AIK A;  4EJO A;  4L5I A;  5E20 A;  2IT0 A;  2XVC A;  3SHF A;  3GX4 X;  2V79 A;  3ABT A;  4I2O A;  1K78 B;  3K1P A;  2QEN A;  1S29 A;  3GO5 A;  5F1R A;  2RV8 A;  1D5V A;  2BYV E;  4XRF A;  3M8E A;  4ETS A;  2LSO A;  5E1Z B;  3LQR A;  2QQB A;  4FHT A;  4CDG A;  2QYO A;  3TGN A;  4EM0 B;  5LGN A;  4ZYH A;  3CO6 C;  4KUM A;  2BEO A;  3ULQ B;  1EV7 A;  2Q0O A;  2HS5 A;  2VBW A;  4M73 A;  4Z2Y A;  4HF0 A;  1J9I A;  1RNL A;  3KP4 A;  4LD5 A;  1NHA A;  3FF5 A;  1L0O C;  1ODD A;  3QU6 A;  4GYG A;  4LB5 A;  1U5T B;  2GAU A;  2O0Y A;  4HX4 A;  4I01 A;  5D4S A;  5AIQ A;  4HLX A;  1MJA A;  3BPX A;  2EFN A;  5E1W A;  1XGO A;  3E5X A;  2BE5 F;  2MC3 A;  3GZ6 A;  2BGC A;  2W85 A;  5FB2 A;  1WWX A;  3FX3 A;  1ZLJ A;  5K1Y A;  1W4M A;  2FA1 A;  3J7A O;  2VBZ A;  4A2U A;  2IJL A;  4LK0 F;  1C0W A;  4YFN F;  3F6O A;  4P55 A;  1O7F A;  4ASN A;  3BPV A;  1S6L A;  2CO5 A;  4HQM A;  2RVC A;  4MQ9 F;  4CO8 A;  3WU1 B;  1JHF A;  5J6X A;  5TRD A;  2CSO A;  3V8K A;  3W6J B;  1VTN C;  2V6C A;  3O2P E;  4O5V A;  2EA2 A;  4FX4 A;  5K5Q A;  4Y17 A;  2R7D A;  3WTV C;  4Q47 A;  1LQ1 A;  5HOO A;  5CVI A;  5L3C A;  1ZRE A;  2AXL A;  2XGX A;  2X0L A;  4D0P A;  5H6Q A;  2V1X A;  3T0Y A;  1IXR C;  1LVA A;  4RGX A;  4TV7 A;  1BIB A;  1JE8 A;  3QAH A;  1TTY A;  5CVV A;  2FA5 A;  3ML6 A;  3L5Z A;  4ZZL A;  1SD5 A;  2JSC A;  2HWV A;  3KP2 A;  1E17 A;  2XKO A;  5D8K B;  4L9T A;  1P4X A;  2DAO A;  4KIG A;  1USS A;  2QVO A;  2FNA A;  6PAX A;  1IN6 A;  2VE8 A;  1G4D A;  3GFM A;  3DFG A;  2F5F A;  1BBY A;  1TQI A;  2V9V A;  4G7H F;  4IPA A;  3K2Z A;  1PUE E;  3DV8 A;  4L0Z B;  4KN7 X;  2QLZ A;  4G8X A;  1BC7 C;  1HKQ A;  1KYW A;  1LJ9 A;  4U0Y A;  5BOX A;  2DTR A;  1FYK A;  3NEU A;  3V7C A;  3MFK A;  3CO7 C;  3VEP A;  4M6Y A;  3EUH A;  1F4K A;  2RNJ A;  5LHI A;  5K5R A;  4U7D A;  2LF7 A;  4EJT A;  3LAP A;  2R7F A;  2MBF A;  3JAM K;  1LEA A;  2L01 A;  3GFJ A;  3ZMU A;  1ZRF A;  3GFL A;  3V8J A;  2XAS A;  1FWZ A;  1G3W A;  4YFX F;  2OOI A;  1IW7 F;  1HBX G;  5ICC A;  2MD5 A;  1XCB A;  2DBB A;  3LA7 A;  2E1C A;  1J5Y A;  5IT9 K;  3M7G A;  2DK5 A;  4PGH A;  3GW2 A;  3ZPL A;  3F8F A;  1ZRD A;  1TLH B;  2KIF A;  5J8F A;  5LEJ A;  1G81 A;  5BQT A;  2OZU A;  3D0S A;  4G7O F;  4XLN F;  1R1U A;  4Y13 A;  4E70 A;  2VC0 A;  1K79 A;  2PEX A;  3J80 Z;  1T6S A;  1FYM A;  3MQ0 A;  4GGG A;  4HOB A;  5HLI A;  3TQN A;  4U88 A;  2VC1 A;  3F8C A;  4LGW A;  4KA4 A;  4HBL A;  3FXU A;  2Q2E A;  2NWI A;  3D5L A;  1REP C;  1KGS A;  4LK1 F;  4LLL A;  4ZSI A;  4KT5 C;  1R1T A;  4Q4Z F;  2HQR A;  1P4W A;  1FT9 A;  1F5T A;  1F9N A;  5DUI A;  4A5N A;  5A2Q Z;  3F21 A;  4IJA A;  2KJC A;  3G3Z A;  4IF4 A;  1J0R A;  4LLN A;  4RB1 A;  2UZK A;  4P9U A;  2EB7 A;  4L5J A;  3DPL C;  3GLX A;  3KE2 A;  2RQP A;  3RKX A;  1FYL A;  3HRU A;  4HF2 A;  2JT1 A;  1YYV A;  1TQM A;  2G9W A;  3IWF A;  2A6H F;  2K27 A;  1XLR A;  4EM2 A;  4M9S A;  3SZP A;  1B59 A;  3CUQ C;  3RIR A;  1FZP B;  4P5O A;  1XSX A;  1G1B A;  1ONV A;  1Z6T A;  3KP5 A;  1HST A;  2EWN A;  3LQQ A;  5J8C A;  3EDP A;  4IRI A;  5D6F A;  1BOA A;  2VE9 A;  1IZ1 A;  3I59 A;  3KP7 A;  4IVN A;  4BH9 A;  1DUX C;  2OAZ A;  4P96 A;  1XGS A;  2HOE A;  5DUK A;  2QM3 A;  1B6A A;  3EET A;  3GXO A;  4A0Z A;  4A6E A;  1QO0 D;  2OBP A;  2OU2 A;  1EH8 A;  4L9V A;  5EEH A;  3BZ6 A;  2H6C A;  5KVR A;  3LWF A;  2R3S A;  2WTE A;  1I6X A;  4P9F A;  4XBF A;  5LGU A;  3RPQ A;  3VFZ A;  4WXC A;  2ISY A;  3MZY A;  3HRS A;  5H6R A;  1WRJ A;  2IW5 A;  1YW9 A;  2OQG A;  4L0Y B;  3WGG A;  4HV5 A;  1Y0U A;  3TO9 A;  4QLC U;  1B1B A;  1E2X A;  4BHC A;  4WXD A;  4OIR F;  3JTG A;  2W57 A;  1YO5 C;  3TDZ C;  3JTH A;  2EA4 A;  4CGZ A;  3J81 K;  2DT5 A; 
#chains in the Genus database with same CATH topology
 3SZG A;  3QP5 A;  3Q9V A;  3LA2 A;  5FKM A;  2MD0 A;  1B9N A;  3TO6 A;  2FQ3 A;  3ONQ A;  4IRH A;  2MA3 A;  3KEY A;  5KAI C;  4IXA A;  1XMX A;  5J1Y A;  1JGS A;  3H0D A;  5CLS A;  1I39 A;  1MBJ A;  4U7B A;  1WSU A;  5FLX K;  1TC3 C;  3LSP A;  2CMP A;  2QQ8 A;  2Z1D A;  3U9G A;  2XUB A;  3CF5 F;  3F6V A;  1W0U A;  3DU6 A;  3VYS B;  4RS8 A;  3HSF A;  2IBD A;  1G3Y A;  1TBX A;  3H5R A;  3BRO A;  2ME0 A;  3O3K A;  4U87 A;  4X0G A;  3FXR A;  5DD4 A;  2VT2 A;  1MSE C;  2VOD A;  2LP0 A;  2W48 A;  3BDD A;  2QCO A;  2JVG A;  1QHG A;  3QPT A;  1HOM A;  4PCQ A;  4UB6 C;  1SFU A;  4XID A;  2ZME A;  2PMZ N;  3KLN A;  2FU4 A;  1ON2 A;  5EEG A;  5GAH J;  2DT6 A;  5JHF A;  5CPR B;  4YIF A;  5HLT A;  4WX9 A;  1OCC H;  1Y6I A;  3KIO A;  3H9J A;  5DD8 A;  4GFB A;  1QVU A;  1XDS A;  4FX0 A;  4UVB A;  1H9G A;  4KDP A;  5DEQ A;  2F48 A;  2PN6 A;  1J2X A;  4M3D A;  3H1C A;  4MTE A;  3IHU A;  4RLQ A;  2ECB A;  2MFZ A;  1Z3X A;  3CP2 A;  4PJN A;  3KEQ A;  3HYI A;  3KZI C;  4XKW A;  4I0A A;  1OR7 A;  1MNM C;  5EGO B;  1SAU A;  2NYX A;  1RUO A;  1V54 H;  1O3Q A;  4O3M A;  4WF2 A;  2BOL A;  2HOT A;  3OR2 C;  3CUQ B;  1U5T A;  2FMY A;  1R9T J;  2GA1 A;  2YUS A;  4ZDP A;  3BG7 A;  2GXG A;  1FBU A;  3E6D A;  2VOO A;  1IDZ A;  1U9N A;  3ZMS A;  3FBI B;  4N0B A;  4DW6 A;  2A07 F;  2P5L C;  1S3J A;  2QBY B;  3BZK A;  2IS2 A;  3I5U A;  1FEX A;  4A3E J;  3E6M A;  2W84 A;  4YEJ A;  1STZ A;  1P7J A;  4HNT A;  4R79 A;  1H0M A;  3M3Y J;  4E7J A;  2K9N A;  3S14 J;  2VXZ A;  3ZMV A;  4XOR A;  1T95 A;  3TP0 A;  4AIJ A;  2EZK A;  2F5V A;  2RGV A;  5E8G A;  1IC8 A;  1U2W A;  2HQ5 A;  2CU7 A;  3LFK A;  3WG9 A;  2W1O A;  1WJE A;  4JBA A;  3GWZ A;  3ZMT A;  5ILS A;  3DWL E;  2LBF B;  3GZ5 A;  1FIA A;  2N8G A;  3LST A;  2DMT A;  4M71 A;  1B8I A;  1SFK A;  4A3C J;  4ZH4 F;  3JRG A;  1UZC A;  1I27 A;  3OIO A;  3VOD A;  1HW2 A;  4BAC A;  1W5S A;  1G6N A;  2QQA A;  4JYK A;  2VOP A;  4XLF A;  3UNG C;  4M3B A;  3Q9S A;  2UXN A;  2PFB A;  1X4O A;  2DMN A;  2LLK A;  1V3F A;  4W1U A;  2VBY A;  1QA6 A;  2NRA C;  2L4M A;  1SFE A;  2JN6 A;  1R58 A;  1V5F A;  2NVX J;  3J7Z I;  4N9H A;  4QTR A;  3B6C A;  3RTR A;  5E79 C;  4PSX A;  1HLV A;  1FSH A;  1R5I D;  3K4K A;  3I71 A;  1H89 C;  2KRC A;  5FGM A;  2GWR A;  2BBY A;  3GF2 A;  3LMM A;  3LSJ A;  3R0J A;  3IWZ A;  3T8T A;  3S2W A;  3IRQ A;  1WI9 A;  2HTS A;  3ERM A;  3EYI A;  3BTL A;  3KYC B;  5FRM A;  4ENM A;  3Q0U A;  1TT5 B;  2LRD A;  3K4M A;  2R5Z A;  1Y1W J;  1AKH A;  3HOW J;  4I02 A;  3V4G A;  4CYD A;  4PK4 A;  1XG1 A;  2D1V A;  2K9Q A;  2QSH X;  2H27 A;  4AID A;  3HZJ A;  1I3Q J;  2M2E A;  3QOP A;  3K2A A;  2G7U A;  5ICF A;  2HR3 A;  5HNF A;  3COA C;  2UWM A;  4XRS A;  4BQO A;  2K40 A;  4RB2 C;  1WKM A;  3S2H J;  2HGC A;  4D5F A;  2NVU B;  3IRR A;  4B3A A;  3W6K B;  2TDX A;  2CG4 A;  1DQU A;  3L9F A;  2STW A;  2Y0S N;  4EMS A;  1KQ0 A;  4S04 A;  2OJE D;  1AHD P;  1DP7 P;  1EF4 A;  1KQ9 A;  5DCM A;  5J40 A;  1VQ6 I;  3H9Q A;  2H09 A;  3TDU C;  3QP6 A;  5HNH A;  2CFO A;  2ZKZ A;  1KA8 A;  1ZH5 A;  4DIQ A;  5EYR A;  1YOV B;  2BY3 A;  3PO3 J;  3RZO J;  1MDM B;  2JZY A;  5E18 F;  2XAU A;  5HLH A;  1BC8 C;  1IXC A;  1UFM A;  3CC4 I;  4DBQ A;  3BJO A;  3OYB A;  3HHG A;  5L3G A;  5FKN A;  1U8R A;  1XN7 A;  1W36 C;  3F8L A;  2YSR A;  2CGP A;  2I5U A;  2Y30 A;  1HDP A;  5HDN A;  4M72 A;  3ZGK A;  1R5G A;  2ZNY A;  5ERI A;  4OMZ A;  1TP4 A;  5J1R A;  4X6A J;  1T2K A;  3JSP A;  3KP3 A;  2R4G A;  1H9T A;  4D9J A;  3RKY A;  3QPH A;  1R4N B;  3BR1 A;  4LG3 A;  1TWH J;  4XL9 A;  2I10 A;  2VKE A;  5FKK A;  1ZR2 A;  3DTI A;  3WOD F;  2NVQ J;  3L2C A;  2HPM A;  2IS6 A;  2CW7 A;  4MO7 A;  4IQJ A;  3GTP J;  2RKH A;  3MEX A;  2DOA A;  1OCP A;  2ELJ A;  2RN7 A;  1X58 A;  2HKO A;  2O8X A;  1Q1H A;  3VB2 A;  1ORK A;  4EAT A;  3S93 A;  3QYB A;  3O6B B;  4IZZ A;  2DPD A;  3CC7 I;  3MKW B;  3BZC A;  1MKM A;  3SYT A;  2HPI A;  1W0T A;  2K4J A;  3LL7 A;  2ZJP F;  4XON A;  5CJ9 A;  4C9Y A;  2Z9O A;  4IHS A;  5F6F A;  1ZTR A;  4E7S A;  5CVJ A;  2L7M P;  3R6S A;  2CQ7 A;  2XRN A;  2RC4 A;  2CUF A;  4E6K G;  5JR3 A;  5D4R A;  3OIQ A;  4KT6 A;  4UUS A;  2QA4 I;  1UCR A;  1HA8 A;  1AWC A;  4ANJ A;  3E5U A;  2BW3 B;  1BI1 A;  3OSG A;  1X1A A;  3OS0 A;  4BE0 A;  4A3F J;  3PIP F;  2LR8 A;  2QF7 A;  2CYY A;  2FUG 2;  3DTK A;  1R4M B;  1R22 A;  2P81 A;  3IC7 A;  4BUP A;  4G7Z F;  1IRF A;  2Y9Y A;  1XSV A;  5F27 A;  3FKJ A;  1BM9 A;  2GA2 A;  2LOO A;  5TJJ A;  3DF8 A;  4OAY A;  2XC7 A;  1SAX A;  2ZO4 A;  5E17 F;  4DGW B;  2DYS H;  2CS3 A;  3H3V K;  2EZL A;  3KZY A;  1Z67 A;  5LEK A;  4RB3 C;  3TL4 X;  2HU9 A;  3E6C C;  4GXO A;  1MSF C;  3I58 A;  4OIN F;  5E8I A;  4I6Z A;  2P5V A;  2L9N A;  3OS2 A;  1BJZ A;  3ZMZ A;  5BNG A;  5EZH A;  1BJA A;  4EV0 A;  4RGR A;  4C3J J;  3CZ6 A;  4E7I A;  3SXY A;  5EF6 A;  1O57 A;  4XN3 A;  3CQZ J;  3CP8 A;  5FKO A;  3BR5 A;  2HYF A;  1G59 A;  1I1G A;  2C6Y A;  2YX7 A;  1WJA A;  4B43 A;  1HW5 A;  1SD4 A;  1FTT A;  2DXI A;  2P8T A;  2FNP A;  2VIX A;  1IDY A;  2ETH A;  3HJE A;  1BR2 A;  2IS1 A;  1VQ9 I;  3EUH C;  4L9N A;  2EPF A;  1R1V A;  3K4N A;  2HZD A;  2JA2 A;  5BS6 A;  3QQA A;  3OYC A;  1QPI A;  4MQV A;  2M30 A;  2QZ8 A;  2XSJ C;  3GCM A;  3HOX J;  2DPU A;  2VJJ A;  2Z5U A;  4RAG A;  3G6E I;  2E1N A;  3ZRG A;  3CUO A;  3HM5 A;  2XGC A;  2JUC A;  2DDA A;  4I7H A;  4JQF A;  2IEK A;  4II3 A;  2F6C A;  1A04 A;  3IP4 B;  1P7I A;  1D0Z A;  2XV4 S;  3TBI A;  4EGY A;  3K4L A;  2D5V A;  1W5T A;  4AIH A;  2ESN A;  4ZTJ A;  4BBS J;  2O9L A;  3BJ6 A;  3OWT A;  1LDD A;  4HG2 A;  1QPM A;  4BGD A;  2PKH A;  2IRF G;  1A31 A;  2BXZ A;  5BPD A;  3BWG A;  1JJ6 C;  1U78 A;  4XKC A;  2IGN A;  2KDO A;  1NK3 P;  1DPU A;  1IRX A;  4M9X A;  4A93 J;  3V7R A;  4UV9 A;  1JHH A;  2LRE A;  2ICW G;  3MKZ A;  1JKP C;  5FLV A;  4YRV A;  2M3A A;  2DQL A;  2L9S A;  3P9C A;  3I0T A;  4AVP A;  1POG A;  1LEB A;  2GXB A;  3B6A A;  4C2U A;  4LG0 A;  2Y0M A;  1E3P A;  3ABU A;  3LAJ A;  4CZC A;  2OTL I;  4XSZ F;  2GQQ A;  3W2A A;  3CDI A;  2ZBK A;  4CYC B;  4I99 C;  4W97 A;  2X6O A;  3C2B A;  3IV5 A;  4LMY A;  3FKI J;  1ZLK A;  1HC8 A;  3RPU A;  5BMZ A;  1MGT A;  2HOS A;  1A5J A;  4RGS A;  3S2D J;  4BBR J;  2HKX A;  5K7F A;  3N4M A;  1X2N A;  3CD6 I;  1IN7 A;  2XAF A;  5JFR A;  2OQR A;  3RI4 A;  4KIT B;  1XGN A;  4B09 A;  2ZXH A;  2FQ4 A;  2XKP A;  1D1A A;  3QOE A;  5H2F C;  1W7P A;  2OTJ I;  1BI3 A;  2ZSI B;  1P6R A;  2DA1 A;  4AUX A;  1WH5 A;  1Y8Q B;  2E7X A;  1UHM A;  5D5W B;  2UV1 A;  2COM A;  2XHK A;  3HEF A;  4ON0 A;  1G3S A;  4M3G A;  1IO2 A;  2HNH A;  2UXX A;  3HRM A;  3ZQG A;  1T98 A;  2GLO A;  2RNG A;  1K4T A;  5IP6 A;  3SFI A;  1CF7 A;  3IL2 A;  2KIM A;  4R1H A;  5IP9 J;  1DU0 A;  1LNW A;  4RM3 A;  1FLI A;  3FMR A;  2VJ4 A;  1VQO I;  3F23 A;  1YS7 A;  4RGU A;  4HNU A;  5HS9 A;  1FOK A;  5LHG A;  5K7Z A;  3VOE A;  3K0L A;  1YW8 A;  3PNT A;  5K7H A;  1HW1 A;  2NNY A;  3T5X A;  1PUF A;  2ZB9 A;  2ESH A;  2ZJ2 A;  3M1C A;  4XLH A;  2M5W A;  5FD6 A;  3TKY A;  2XF6 A;  5K5O A;  4EGZ A;  4AM3 A;  1KON A;  2WWY A;  4D7N A;  2CW8 A;  5E3O A;  1T0F A;  2TRT A;  1PP7 U;  3S16 J;  1TW3 A;  2E35 A;  4FIS A;  1RUN A;  3PQJ A;  2L2O A;  4LJZ F;  4UXN A;  5C44 J;  3J80 K;  1YX5 A;  2WY8 Q;  3HBL A;  5GAG J;  3S3O A;  3SZT A;  1S8N A;  5HS8 A;  1B72 A;  1WQ2 A;  2GIZ A;  3B73 A;  2QSG X;  2KMU A;  2VBX A;  2R5Y A;  1IUY A;  1LDJ A;  1OFC X;  2NS8 A;  2K5C A;  1A6Q A;  5FFX A;  2VQL A;  3GLL A;  3HTU A;  2R93 J;  3LSI A;  2WV0 A;  2XPV A;  4HQE A;  2HVR A;  3DDV A;  2FBH A;  1BL0 A;  4MFD A;  1ZRC A;  2R7T A;  2FE3 A;  3ERE D;  1MJ9 A;  4EM1 A;  4KJZ A;  3S3N A;  2X6W A;  3U1D A;  4WWC A;  2M87 A;  1FP2 A;  2DFH A;  1TNS A;  3OYI A;  3MKY B;  2K4B A;  4G6Q A;  4CXF A;  1MW7 A;  3VSK A;  4LIV A;  3HDD A;  4PDK A;  5A2Q K;  4FET A;  2O6G E;  1VF9 A;  1OYY A;  2R7U A;  2E2I J;  4XIC A;  1ZGA A;  2JRT A;  2FSW A;  3OS1 A;  1E3H A;  4BNC A;  2M9H A;  3WU0 A;  1K61 A;  2R7W A;  3F9K A;  2EFO A;  4MNU A;  3ZQQ A;  4KFC A;  1R49 A;  4E7K A;  3K69 A;  4L5E A;  1Z05 A;  2E60 A;  4UVC A;  1W1W E;  1L3L A;  1UEL B;  2HYG D;  1SC7 A;  3R4K A;  2CQQ A;  3ASO H;  2BY0 A;  3B02 A;  1MBF A;  2LD5 A;  1TQP A;  3SQN A;  3FXK A;  2OD5 A;  4HDV A;  1S72 I;  2MLK A;  2WAQ A;  2F5C A;  3KET A;  1U9O A;  5LRR A;  3S1N J;  1ETV A;  3ABK H;  4HF1 A;  3A03 A;  2MW8 A;  3HOU J;  1TW2 A;  2A6T A;  3E5Q A;  5TIS C;  3CMM A;  1VFC A;  4XMY A;  1Z6R A;  1SMT A;  1QHH D;  1NG7 A;  2DOE A;  1IN8 A;  2DTZ A;  4DZP A;  4Y52 J;  2OGG A;  2M7B A;  3BCB A;  3W3C A;  3RQI A;  4H0E A;  2M0C A;  1DGW Y;  2HTJ A;  3R61 A;  1YJ9 I;  4RB0 A;  1K83 J;  4NQW A;  1ETQ A;  2MH9 A;  4XLC A;  1GVD A;  3R0A A;  3DEU A;  3FWE A;  4QPO A;  1CGP A;  2AXT C;  1N25 A;  2LG4 A;  4OU0 A;  3I55 I;  3BT9 A;  4NBQ A;  5B66 C;  3GTK J;  2W00 A;  4BXU A;  2ADU A;  3AAF A;  1Z91 A;  4MFE A;  3HOY J;  2LY9 A;  3ZQI A;  5J4V A;  2HYJ A;  3OL3 A;  3CDL A;  4F7Z A;  2L7Z A;  1JKO C;  1NTC A;  4PZJ A;  5IYB J;  2P6T A;  2VPR A;  3MMY B;  3FM3 A;  3NAU A;  2WAQ N;  2Q2E B;  3E3V A;  3O8H A;  2EZH A;  1IN5 A;  3RJP A;  2HVS A;  2HQA A;  3QPL A;  3CC2 I;  1ZQ3 P;  1ETK A;  4IRG A;  3G1O A;  3T1B A;  3DP7 A;  3AG4 H;  4A3L J;  3ZMD A;  4ZZD A;  3ECO A;  3C1D A;  2CV1 A;  3HSR A;  5ICE A;  2EFW A;  5JLX A;  3HL2 A;  1HKT A;  4EEF G;  3CNV A;  2LY1 A;  3ZN0 A;  2W24 A;  3FXL A;  1K7A A;  2AS5 F;  3S17 J;  3CLO A;  5D5V B;  1RZ4 A;  3WTZ A;  3L2V A;  3MAJ A;  1Z1D A;  1PJR A;  3HGY A;  2PI0 A;  2XPU A;  1KYZ A;  2AQE A;  3OYA A;  1IJW C;  3CES A;  2JA7 J;  2P4W A;  2V1D A;  1FIP A;  1IF1 A;  1PDN C;  1HSJ A;  2ZCW A;  2DN0 A;  4S05 A;  3RCO A;  3H92 A;  4Y7N J;  1ZR4 A;  3KCC A;  1JT6 A;  2DCE A;  2IPQ X;  2DA5 A;  3JCU C;  4Q48 A;  3GYH X;  2RQQ A;  4FE7 A;  2IA2 A;  2YX4 A;  4XKV A;  3Q5F A;  4MEX F;  2OZ6 A;  4IHX A;  4E7Z A;  3HHH A;  5CYV A;  4BHB A;  1OCT C;  2OCE A;  2LKP A;  2Y2Z A;  2DFE A;  4HEA 2;  5L3E A;  3HGG A;  4X1E A;  4EJV A;  2MG4 A;  2O61 A;  2YS9 A;  3FXQ A;  3DKY A;  1K78 A;  2AQF A;  1BIA A;  1IAW A;  1U3E M;  2MH2 A;  1LB2 A;  5CQG A;  3KEO A;  5B5E C;  1AA7 A;  4RA2 A;  3QOD A;  2JJ7 A;  5GP9 A;  4A12 A;  4AU7 A;  3E97 A;  1QBJ A;  1I6H J;  3KYD B;  4RM2 A;  5FFZ A;  5D6E A;  2BXY A;  3I59 B;  3JRD A;  3SEZ A;  3CCL I;  1ZAO A;  1UMQ A;  4XRM A;  3KLO A;  3OYM A;  2F4I A;  4AYB A;  1ZKG A;  4J19 A;  2B7E A;  2V4J C;  5DV5 A;  1LDK B;  2EIL H;  2X1E A;  2Y48 A;  3KX2 A;  2B9S A;  1ULY A;  3DKW A;  2R7Z J;  5E3L A;  3FXM A;  4BS9 A;  3BLY A;  3M8F A;  4IEJ A;  2P7C B;  2D1H A;  2IGK A;  3RPU D;  2O03 A;  1ZAR A;  2CQK A;  2JRM A;  3VYR B;  1ZG1 A;  1HDD C;  2EV6 A;  1VZ0 A;  1ZHF A;  1MH3 A;  2K3F A;  2XF5 A;  5C4X J;  2ELK A;  2PG4 A;  4Y33 A;  4ZJZ A;  5DM6 F;  1MD0 A;  3A01 A;  4GO1 A;  3SEQ A;  1W7P D;  4LB6 B;  1LE8 A;  4BEH B;  1GLN A;  1EKE A;  5JVT A;  1SFO J;  5C3E J;  3RDI A;  2DDB A;  5HDG A;  1V5G A;  2DI3 A;  2DK8 A;  4DNC A;  3MWM A;  3L2Q A;  3P7N A;  4A3B J;  2P5K A;  2K86 A;  4WXH A;  4A5M A;  1K6Y A;  3ZQ7 A;  2STT A;  5KK1 A;  4EVI A;  3BG3 A;  1ZG5 A;  1JUS A;  2WAE A;  3F3X A;  4A0X A;  4HA8 A;  2JPB A;  4HLY A;  2Q1Z B;  4B48 A;  4C2T A;  2X4H A;  1S5L C;  4E7L A;  2P6S A;  4PUS A;  2BV6 A;  3C3W A;  5EG0 B;  1TL8 A;  2QQ9 A;  2L02 A;  1MDM A;  3K4B A;  5F0H A;  4HYE A;  2YU9 J;  3TO7 A;  2E34 A;  4ESJ A;  1YTY A;  3K1M A;  5M3M J;  1MMG A;  1P92 A;  4ZDO A;  2QUF A;  3LSR A;  5DDG A;  2VUM J;  3ZQF A;  1Y1V J;  4HX8 A;  1R23 A;  5L3D A;  3GUD A;  3OOP A;  4PSW A;  3L09 A;  2H8R A;  3I64 A;  2W4S A;  1MJB A;  5JI6 A;  2I8D A;  2OC6 A;  3C18 A;  4RBO A;  2IXS A;  5EZG A;  3L1P A;  1N77 A;  3F8N A;  3G1L A;  4BHP A;  1FW9 A;  2VXD A;  3DEW A;  4AWX B;  2RRE A;  4F93 B;  4OWR B;  5DM7 F;  1S9H A;  2ZSH B;  1D8J A;  2R92 J;  2WAF A;  3IH2 A;  2DT7 B;  4ZYG A;  2LDU A;  1F1Z A;  1UHW A;  4M9Z A;  1XC5 A;  3TED A;  4AVZ A;  2ME6 A;  5E3M A;  2ZME B;  2XB0 X;  2HDC A;  3FM5 A;  3W6V A;  2K7L A;  2QKM B;  3U1K A;  2Z16 A;  4HAM A;  2ACJ A;  4XK4 A;  5CVU A;  2FEZ A;  5AIP A;  3TW6 A;  2BY1 A;  2BHY A;  4C30 A;  1RI7 A;  5GPA A;  1LFU P;  2NVT J;  2EIK H;  2E19 A;  1J7K A;  2A3S A;  2PBI A;  4BYY A;  2CUE A;  2M8G X;  3O8G A;  1QZY A;  3GEZ A;  3OOU A;  4XOP A;  2FBK A;  1YG2 A;  3CME I;  5J1U A;  2XDV A;  3GVA A;  3OSF A;  2YU3 A;  1ITY A;  4OIQ F;  2FOK A;  3PFI A;  4RAF A;  4PJL A;  3TMO A;  3CCS I;  3LA3 A;  2VI6 A;  2HZT A;  2EK5 A;  2NNN A;  3L2W A;  5DYM A;  1IUF A;  4CIC A;  5LBQ A;  2CQX A;  1WJB A;  4KNY A;  3FHZ A;  3IKV A;  5M5W J;  4LOC A;  2KKO A;  1TWG J;  5IPA A;  4PJ0 C;  5HS7 A;  1ENH A;  3P9I A;  3Q0V A;  3L00 A;  3E6B A;  1HKS A;  2L9R A;  2KT0 A;  3S3M A;  4YII A;  2GXA A;  2DMP A;  4WCG A;  3AG1 H;  1P2F A;  3IAM 2;  2YPR A;  5M5Y J;  4LIU A;  1EH7 A;  4BJ6 C;  3M4O J;  4NB5 A;  3HUG A;  1XCV A;  2VT3 A;  4KIS A;  3E1S A;  4G9Y A;  3WTW C;  4HRI A;  2HVQ A;  5AON A;  3WTX C;  1YRN A;  1MIJ A;  1YHQ I;  1Q1V A;  3CCQ I;  4I98 B;  3FIS A;  3H9G A;  2DFF A;  4DJA A;  1B8I B;  3ZP5 A;  5CQE A;  2DW4 A;  3RZD J;  3I56 I;  4HDU A;  1J59 A;  4KYW A;  2YR2 A;  4V2G A;  3CLQ A;  3ZQC A;  1T38 A;  3GTJ J;  2ISZ A;  2NAZ A;  3G71 I;  2K02 A;  1YLF A;  2X1C A;  2JMW A;  4UVA A;  4WK8 F;  5IYC J;  1RR7 A;  1BI2 A;  3EYY A;  3RYP A;  3P5J A;  4AD9 A;  4IHY A;  4IOA F;  5FD5 A;  4XNF A;  3WTU C;  3E0J B;  1WHU A;  3S1Q J;  5IP7 J;  2HXI A;  4K2E A;  1I5Z A;  3C7J A;  4G6D A;  3D1N I;  3R60 A;  4PFO A;  1IV8 A;  4DQ2 A;  2H8W A;  3GFI A;  4MIM A;  4E7H A;  4UNO A;  3Q0W A;  2LYC A;  2QEX I;  3SDB A;  1VQ5 I;  5L3F A;  3IKT A;  2PLY A;  1AOY A;  4A6D A;  1IXS B;  2L0K A;  3BC8 A;  4MHG A;  3JSO A;  2R5Z B;  1PP8 F;  1AKH B;  5HLG A;  5TGT A;  1VQK I;  2LNB A;  2R0Q C;  1LKX A;  2VKD A;  3DU5 A;  3H35 A;  4M74 A;  1XD7 A;  1O3S A;  3ZN1 A;  1H88 C;  2VKH A;  4YIR X;  4Q5S F;  4R8H A;  4QPQ A;  3WHC A;  1EJ9 A;  4B8X A;  5LRS A;  1FSE A;  2DOF A;  1V4R A;  2EV5 A;  2VJI A;  2XIG A;  1V55 H;  4CCN A;  4FCY A;  3RKW A;  2IA1 A;  3DEE A;  3K70 D;  1R00 A;  3FZV A;  1LFP A;  1VQ7 I;  3C2H A;  1R7J A;  4G12 A;  4DZJ A;  5D5X B;  1ETY A;  2K85 A;  1IGN A;  2AHC A;  1XTA A;  1GVJ A;  2J5P A;  1PVE A;  1BR1 A;  2PX9 A;  2M8E A;  3S15 J;  3DLA A;  1R6R A;  1GUU A;  3PM1 A;  5DCM B;  1GV2 A;  3VPR A;  3OYG A;  1Z77 A;  5F0F A;  5DS9 A;  2XAJ A;  3K4J A;  4P1W A;  3OYD A;  1XX5 A;  3V8L A;  4UY8 I;  2PJP A;  2E36 A;  4OIO F;  3GME A;  2NS0 A;  1HF0 A;  1QVT A;  1T39 A;  2VKV A;  2JQ7 A;  2BZT A;  3AG2 H;  4BXX J;  2GIV A;  3C2G A;  2ELH A;  2LK2 A;  4DYQ A;  1SD6 A;  2XAH A;  1VQ8 I;  1ZYR F;  1GXP A;  2P19 A;  3H3U A;  4MTD A;  4YG2 F;  1JT0 A;  4ABZ A;  4IQ4 A;  1H8A C;  2IS4 A;  3SFZ A;  2P7V B;  1WZ2 A;  3K7A J;  4JP0 A;  2XPW A;  1A36 A;  3J7Y J;  4HSR A;  2ZXI A;  2VPL A;  1O7L A;  2DMU A;  1D0Y A;  1UST A;  4U0V A;  4IHV A;  2DU9 A;  1OMI A;  4FE4 A;  1XMA A;  4GYI A;  2E5Z A;  2MC4 A;  5BPI A;  4II2 A;  1Z21 A;  5KNL A;  4BU2 A;  4KMF A;  3K4C A;  2CH0 A;  2EFQ A;  3BJA A;  1OIS A;  2JWT A;  4RAZ A;  1MMD A;  4ZSK A;  2AHQ A;  4C3H J;  1EH6 A;  1DDN A;  2KP6 A;  4NC8 A;  4CCM A;  3GZN B;  4IL6 C;  3JAM Z;  1FC3 A;  3NRV A;  1D8K A;  1X4P A;  2W82 A;  2XAG A;  3BG9 A;  1RKT A;  4UUS B;  1UG0 A;  3ELK A;  3NWT A;  4XSX F;  3FHN A;  3WGI A;  1SEU A;  3J7A Y;  1P4A A;  2EBI A;  1GHC A;  4G6T B;  3M1E A;  1FX7 A;  2XAQ A;  2DA6 A;  3EQL F;  3I54 A;  3DXJ F;  1NK2 P;  3BOQ A;  3HOT A;  1OYI A;  5IT9 Z;  1BN5 A;  2L5Q A;  1X1D A;  1HQC A;  1R36 A;  2R7R A;  4J00 A;  2PJR A;  2M0M A;  4EQQ A;  1TNT A;  1IN4 A;  2CWE A;  2EV0 A;  3EUA A;  2O8K A;  3S1M J;  1MBG A;  3DBH B;  1D1C A;  1FOY A;  2JK3 A;  2IKK A;  4OOI A;  4BXF A;  2WB1 A;  4KIB A;  3PSF A;  3I3L A;  1WCM J;  3TOB A;  5FLM J;  2QWW A;  4RLF A;  1S7A A;  2KPM A;  2K3P A;  3HSE A;  3CMA I;  2QGU A;  1Z7U A;  1ON1 A;  4LFU A;  2EIN H;  5EEA A;  1E0E A;  4BJ5 C;  2VN2 A;  5CKT A;  2KIS A;  3HC7 A;  3PQK A;  1Y8R B;  2Y9Z A;  3G2B A;  2V1N A;  4M6X A;  3JW4 A;  4FTH A;  1QGP A;  4QWQ A;  1IRG A;  1QNT A;  1HXD A;  4KIF A;  1OKR A;  3U2R A;  4D5C A;  4BQA A;  1X1C A;  1XB4 A;  2EFP A;  1T8I A;  2GZW A;  1BI0 A;  3LSM A;  5C4J J;  4OIP F;  4JK1 X;  2ZFW A;  4CA0 A;  5KHD A;  2FBI A;  4N9I A;  2E2J J;  1T56 A;  4I76 A;  3TOA A;  5LLQ A;  4IHT A;  1J75 A;  2HDW A;  3ISP A;  5CVR A;  4L9J A;  3PNV A;  2H94 A;  1YE9 A;  3ABM H;  5ED4 A;  1Z9C A;  2WB1 N;  3L2R A;  2O3F A;  3F8M A;  3F72 A;  4CZZ A;  3H3Z A;  3F22 A;  3IH4 A;  1WGX A;  1DGR M;  3WG7 H;  1K4S A;  3OL4 A;  4RAY A;  5D5U B;  4CCJ A;  4HST A;  2XGE A;  3A0H C;  3JRB A;  1FY7 A;  3WTT C;  3OYE A;  1JXS A;  3K10 A;  3K1N A;  5GTH C;  2DQR A;  1FTZ A;  1UHS A;  2Z33 A;  1Y56 A;  3QU3 A;  4BKX A;  2EIJ H;  4YFK F;  1V5E A;  4DYR A;  4ESB A;  2IA0 A;  4G94 A;  4B4C A;  2M1B A;  1OPC A;  1JGG A;  4LG0 B;  4H4K C;  4EJU A;  3WE2 A;  2OUM A;  4I09 A;  3IUO A;  5H20 A;  3CDH A;  4CCK A;  1FPQ A;  3BTC A;  1AU7 A;  2CFX A;  1MBK A;  3HOV J;  2ECC A;  1KU9 A;  4MGR A;  1WJC A;  3BY6 A;  3DTE A;  3ZXS A;  3REO A;  1GXQ A;  2LF8 A;  3T8R A;  5L3B A;  3UKG A;  3WTS C;  1X1B A;  3CJR B;  4HX7 A;  2LVS A;  2KRF A;  4FQG A;  2H6B A;  3KFW X;  4NHJ A;  4UV8 A;  1F43 A;  1W7P B;  2WC2 A;  4BAY A;  1ZG3 A;  2FXA A;  1YX3 A;  2WBM A;  5DCF A;  1Z0X A;  2V1U A;  1TT8 A;  1KU3 A;  3HOS A;  3L7W A;  4ENK A;  4ENN A;  1KU7 A;  2KIU A;  4MEY F;  2Z99 A;  2FF4 A;  4OAZ A;  4IHW A;  1BW5 A;  2M45 A;  3DPT A;  3ECH A;  4LLG F;  4D1Q A;  5ICG A;  1CF7 B;  1PYV A;  2QSF X;  2RDP A;  5ILU A;  1ZN2 A;  1MMA A;  2HI3 A;  1DPR A;  4A0Y A;  4CHU A;  4I0B A;  3TP3 A;  1KZH A;  3A02 A;  3E7L A;  2JA8 J;  4ZSB A;  2LFB A;  2L54 A;  4N4O B;  2OV7 A;  2F5D A;  5FO5 A;  2IVM A;  4PGG A;  2LH9 A;  4FT8 A;  2V26 A;  5IOZ A;  1FBS A;  2OF7 A;  2A69 F;  3ABL H;  2HFH A;  1SFX A;  4KIC A;  3RYR A;  2E71 A;  2OPT A;  3MZH A;  3QWL A;  1MBE A;  2PMU A;  1PUF B;  3FMQ A;  3FMS A;  1FMV A;  4BL0 B;  2V7F A;  2KJB A;  1ERD A;  3ZQH A;  3JRF A;  3G73 A;  1UAA A;  4DYC A;  4Y15 A;  2LTP A;  2DO7 A;  3OV8 A;  3ROU A;  2ZJR F;  5EGO A;  2Q8K A;  5HDK A;  3KP6 A;  4HW0 A;  1B9M A;  2HXO A;  3H0G J;  2KDZ A;  1APL C;  4XQF A;  1UB9 A;  3CUQ A;  4O6J A;  3BR2 A;  1QQI A;  1B72 B;  2JPC A;  5HVQ C;  4UHT A;  3K70 C;  1BOB A;  4JX5 A;  4KN4 X;  3MKL A;  4M3E A;  2R5Y B;  3N05 A;  1JTY A;  1ZGJ A;  1QU3 A;  3CCV I;  1R5H A;  2QBY A;  1MZB A;  5E3N A;  1WJF A;  2F2E A;  5B3S H;  5LFA A;  4IOC F;  1S7O A;  1I1S A;  1U6G A;  3QYF A;  1IV6 A;  2ZME C;  3FXJ A;  1FBQ A;  1X3U A;  2A6E F;  1XGM A;  3CCR I;  3MCZ A;  3BP8 A;  2ID6 A;  3J81 Z;  3NWS A;  5GTI C;  4QIW N;  1YQA A;  5ILV A;  1WFX A;  3OYK A;  1JD3 A;  1SMY F;  2DFI A;  4OMY A;  5IT3 A;  1G3T A;  1XMK A;  2A68 F;  2LBF A;  4Z6Y A;  4DOZ A;  5FLX Z;  1FOW A;  3PNY A;  2Z3Y A;  4ESF A;  5JHU A;  3F8B A;  2WY7 Q;  4HZF A;  3QRF F;  3HTS B;  2EH3 A;  2DLL A;  2FML A;  4CH7 A;  2PMZ A;  2D2W A;  1OR7 C;  3BR0 A;  2FRH A;  1Y39 A;  3CJN A;  3KZZ A;  1YI2 I;  2EIM H;  2WV1 A;  3LHE A;  2G7H A;  3G1M A;  1K6O A;  1U5T C;  2MGQ A;  3CCY A;  4CCO A;  1JKQ C;  5IYD J;  2QKL B;  2J5O A;  4BY7 J;  4BE2 A;  4HPQ A;  2CW0 F;  3CTA A;  2BHZ A;  1XSD A;  3LNQ A;  2JVH A;  4F55 A;  2CUZ A;  2A5Y B;  1T33 A;  2HQN A;  2XGD A;  2Y69 H;  2ZXJ A;  1YJW I;  1OYW A;  2VL8 A;  1ACI A;  4XKB A;  2Z2S B;  2VON A;  4ZYE A;  1KQ8 A;  4NQW B;  2Y75 A;  3HKZ A;  2XRO A;  3KYL A;  5D8L B;  4XLE A;  4NNJ A;  1YIO A;  3I4P A;  1YS6 A;  1IRZ A;  4UUV A;  4L18 B;  2EJR A;  5FJ8 J;  3PIO F;  1RRJ A;  4GDF A;  2W25 A;  1D3Y A;  4ZYD A;  4F92 B;  2L4A A;  1ETO A;  4HV6 A;  2JTV A;  1FP1 D;  2NVY J;  2HEO A;  1LVK A;  1WJD A;  2PQ8 A;  5LHH A;  2KZV A;  3DQV C;  1WVR A;  3F0C A;  3WTY C;  4ENJ A;  4U0W A;  3MN2 A;  2PMH A;  2GOM A;  4M3F A;  2ZNZ A;  2IP2 A;  1XDU A;  1MND A;  2DOD A;  2F5E A;  3D5R C;  2X85 A;  3N97 A;  2NS7 A;  3MVP A;  5FKL A;  3H36 A;  1I50 J;  4UUT A;  1GDT A;  2JSP A;  1A35 A;  1YW7 A;  4F91 B;  2DA3 A;  1B4A A;  1ETW A;  5LD2 C;  4NDL A;  2D45 A;  5E1X A;  3ZR8 X;  2MLG A;  3WE3 A;  4DBR A;  2E7W A;  2H1L A;  2FJ1 A;  1O4X A;  2E1M B;  4AYB N;  3HKZ N;  5EJC A;  4AC0 A;  2R7Q A;  4XLP F;  4B3X A;  1IG7 A;  1EA3 A;  1QZZ A;  3V7S A;  2A61 A;  3A0B C;  4RDU A;  1ZK8 A;  3HIF A;  1YFH A;  1UG2 A;  5HOD A;  3K9T A;  2MSY A;  2B0L A;  1WI3 A;  3FK6 A;  1KU2 A;  3HFI A;  5M3F J;  4EJW A;  3HRT A;  3OYF A;  1GT0 C;  3AL0 B;  3P9K A;  2OA4 A;  4KMU X;  1J09 A;  1FNN A;  1SD7 A;  3UR3 C;  2RA5 A;  5LGT A;  1RIO H;  3I53 A;  3M9A A;  3NQO A;  4A3J J;  4PJM A;  5F64 A;  4XR6 A;  1JUM A;  4GCV A;  2L3D A;  3ESW B;  1O3T A;  2F4M B;  3WGH A;  1O3R A;  3FIW A;  3GTL J;  4AIK A;  4A3K J;  3BQZ A;  2DJN A;  4EJO A;  4L5I A;  1P9Q C;  5E20 A;  2IT0 A;  2XVC A;  2CQN A;  3SHF A;  3GX4 X;  1Z3Y A;  4F3Q A;  2CRG A;  3JRI A;  2V79 A;  2KFD A;  3IH3 A;  4FAS D;  3ABT A;  4I2O A;  3BTI A;  1K78 B;  3K1P A;  2QEN A;  1S29 A;  3GO5 A;  5F1R A;  2RV8 A;  1D5V A;  2OCC H;  2BYV E;  1OCO H;  4XRF A;  3M8E A;  4ETS A;  3DLL F;  2LSO A;  3BTJ A;  5E1Z B;  3LQR A;  1W5C C;  2RAE A;  1N78 A;  2QQB A;  3PL8 A;  4FHT A;  3S32 A;  4CDG A;  3PO2 J;  2QYO A;  3TGN A;  4EM0 B;  3VWB A;  5LGN A;  3VYU B;  4ZYH A;  2GOX B;  4KUM A;  3CO6 C;  2BEO A;  3LFU A;  3CMY A;  3ULQ B;  1MMN A;  2FD5 A;  1EV7 A;  1X1P A;  2Y0S A;  2Q0O A;  3CCM I;  2VJ5 A;  4XRS G;  2DMQ A;  3MD2 A;  1LFB A;  4ZC3 A;  2HS5 A;  2VBW A;  4M73 A;  4Z2Y A;  2BW3 A;  4HF0 A;  1J9I A;  1VQN I;  3PUF A;  3X2Q H;  5IY5 H;  2KZG A;  2KRH A;  3BG5 A;  3W2V A;  1RNL A;  3KP4 A;  4LD5 A;  1NHA A;  3FF5 A;  3H5N A;  1L0O C;  1F36 A;  1ODD A;  2X51 A;  3QU6 A;  2LC2 A;  4GYG A;  3PJR A;  4LB5 A;  3A2K A;  1U5T B;  2GAU A;  2O0Y A;  4LIT A;  4HX4 A;  4I01 A;  5D4S A;  2EZI A;  5AIQ A;  1D0X A;  4HLX A;  1OCZ H;  5J3L A;  1QZE A;  2WA0 A;  3RQ4 A;  5DTD A;  2DA4 A;  1MJA A;  3M07 A;  4B1R A;  5GAD J;  2VLA A;  3BPX A;  2V9P A;  3BG6 A;  2EFN A;  3CJQ B;  5E1W A;  3A01 B;  1XGO A;  3E5X A;  3QYE A;  2BE5 F;  1LE8 B;  2MC3 A;  3GZ6 A;  2BGC A;  2W85 A;  5EDN A;  4YEL A;  5FB2 A;  4IO9 F;  2R7V A;  2LMD A;  1WWX A;  9ANT A;  3WU2 C;  3FX3 A;  2JUG A;  1ZLJ A;  5K1Y A;  1W4M A;  3LSK A;  1OLT A;  2FA1 A;  3J7A O;  2GBY A;  2TCT A;  2VBZ A;  4A2U A;  2IJL A;  3JR9 A;  4LK0 F;  2ZC2 A;  1C0W A;  3V42 A;  3HXL A;  3OIP A;  4YFN F;  1CQT A;  3F6O A;  2LKX A;  1OCR H;  2ZXW H;  2CV0 A;  3ZCO A;  4P55 A;  1Z7L A;  1O7F A;  1MMS A;  4ASN A;  3BPV A;  2O5R A;  3DCF A;  1S6L A;  3LSG A;  1G8X A;  2CO5 A;  2RVC A;  4HQM A;  4MQ9 F;  3CCE I;  4CO8 A;  2VAS A;  3WU1 B;  3ZQL A;  1MH4 A;  1JHF A;  2L7F P;  5J6X A;  5TRD A;  2CSO A;  3GTM J;  3AG3 H;  3V8K A;  5IOY A;  2ZJQ F;  3W6J B;  4CCL A;  1X2M A;  1VTN C;  3PSI A;  2V6C A;  1Y0N A;  1OQY A;  3O2P E;  5KCM A;  5JVG F;  4O5V A;  2EA2 A;  4FX4 A;  5K5Q A;  3OYH A;  2XRL A;  4Y17 A;  2EQR A;  2R7D A;  3WTV C;  4Q47 A;  1TWF J;  4A3M J;  2E1O A;  4N4N B;  1LQ1 A;  2IGM A;  3BCA A;  5HOO A;  5B1B H;  1BW6 A;  4V2F A;  2FOW A;  3DPU A;  5CVI A;  1LPQ A;  5L3C A;  1ZRE A;  2BVM A;  4CYC A;  1FJL A;  5J47 A;  3A4C A;  2AXL A;  2XGX A;  2X0L A;  4V19 K;  3WHB A;  1YIJ I;  2DA2 A;  1D1B A;  5JLW A;  4D0P A;  5H6Q A;  1JKR C;  3OYL A;  2V1X A;  3T0Y A;  1IXR C;  2M4G A;  2MAB A;  1ZEL A;  3AKZ A;  2COB A;  1LVA A;  2HOA A;  3Q3S A;  4RGX A;  4TV7 A;  2KIQ A;  4BQN A;  2NXN B;  1BIB A;  1JE8 A;  4B47 A;  3EPZ A;  1RET A;  3QAH A;  1TTY A;  3FK7 A;  1ZGW A;  5CVV A;  2FA5 A;  3ML6 A;  3L5Z A;  1M1E B;  3HG9 A;  4S0H B;  3JRC A;  4ZZL A;  4BQQ A;  1SD5 A;  2JSC A;  3FBN B;  2HWV A;  1X19 A;  3KP2 A;  1E17 A;  1SVL A;  4XM3 A;  2XKO A;  1HCR A;  4F52 A;  5D8K B;  4L9T A;  4RMN A;  2ZFU A;  1P4X A;  4NC6 A;  2CUJ A;  2DAO A;  2JA5 J;  2KQR A;  3HUG B;  3D5S C;  4KIG A;  1USS A;  2QVO A;  1RPW A;  2FNA A;  1YRN B;  6PAX A;  1IN6 A;  2VE8 A;  1G4D A;  2BY2 A;  3GFM A;  3DFG A;  2F5F A;  1BBY A;  1TQI A;  2V9V A;  1TT0 A;  4G7H F;  1VI0 A;  4IPA A;  2VB6 A;  4IX7 A;  3K2Z A;  3M8J A;  4Y4R A;  5B1A H;  1PUE E;  2V9K A;  3DV8 A;  4L0Z B;  4KN7 X;  2E5N A;  2VQC A;  1DP3 A;  4XN0 A;  2QLZ A;  4G8X A;  1BC7 C;  1HKQ A;  1KYW A;  1LJ9 A;  3DBL B;  2K9L A;  4U0Y A;  3IAS 2;  4CUG A;  1ETX A;  1OJL A;  1RR8 C;  5BOX A;  4BY1 J;  5M5X J;  2DTR A;  3S1R J;  1FYK A;  3NEU A;  3V7C A;  4HNV A;  3U21 A;  3MFK A;  2UUZ A;  1BR4 A;  1TWC J;  2A5W A;  3VEP A;  2R7O A;  3CO7 C;  3JRH A;  3GBG A;  2NOG A;  4UB8 C;  4M6Y A;  2NOJ B;  3EUH A;  2XF7 A;  3KPH A;  4GRI A;  2W7N A;  1F4K A;  2RNJ A;  5LHI A;  5K5R A;  2LF7 A;  4U7D A;  3SDG A;  1RC9 A;  4EJT A;  3LAP A;  2R7F A;  3I4M J;  2MBF A;  3VYT B;  1WH7 A;  3JAM K;  1WJ5 A;  4BDY A;  1LEA A;  2L01 A;  3GFJ A;  1UJ8 A;  3ZOB A;  3ZMU A;  1ZRF A;  1T0F C;  4JX6 A;  3GFL A;  1X3W B;  3BQY A;  2CV2 A;  1RES A;  3V8J A;  2XAS A;  1FWZ A;  1G3W A;  3CF2 A;  4YFX F;  1XPX A;  4C3I J;  2OOI A;  1IW7 F;  2X9D A;  1HBX G;  2E2H J;  5ICC A;  2MD5 A;  1SVO A;  1XCB A;  3OR1 C;  3GTG J;  2DBB A;  4ZTF A;  3JRE A;  3LA7 A;  1VND A;  2E1C A;  1YJN I;  1J5Y A;  4JX4 A;  1FMW A;  3BR3 A;  5IT9 K;  3M7G A;  2DK5 A;  3FXO A;  3QPS A;  3VDX A;  1A6I A;  4PGH A;  3GW2 A;  1VQ4 I;  3F8F A;  3ZPL A;  2H1K A;  3H5A A;  4PJJ A;  1ZRD A;  1TLH B;  2KIF A;  4A69 C;  4JOM A;  5F1J A;  5J8F A;  3CCU I;  2DYR H;  2KL4 A;  2KLO A;  2XSD C;  3RSN A;  5LEJ A;  1G81 A;  5BQT A;  2OZU A;  3DKX A;  3D0S A;  2AO9 A;  4XLA A;  4G7O F;  4C2M J;  4XLN F;  3SJM A;  1R1U A;  4Y13 A;  1SVM A;  4BE1 A;  4E70 A;  1GV5 A;  2M4K A;  2VC0 A;  1K79 A;  3A1Y A;  2PEX A;  4NC7 A;  4NUB A;  3J80 Z;  2M34 A;  1T6S A;  1FYM A;  3MQ0 A;  2L7K A;  4GGG A;  4HOB A;  3CCJ I;  2HDD A;  3W2W A;  5HLI A;  3TQN A;  1U0J A;  4M6V A;  4XOT A;  4U88 A;  5GAE J;  3OY9 A;  2VC1 A;  3F8C A;  3MZ8 A;  4LGW A;  3HPG A;  4KA4 A;  4HBL A;  4Y3O A;  2ID3 A;  3FXU A;  2Q2E A;  4MLO A;  2F4O B;  2CJJ A;  2K9M A;  3OYJ A;  2R7X A;  2X1D A;  2NWI A;  4A3I J;  3D5L A;  3RKQ A;  1REP C;  4ZYA A;  1KGS A;  4LK1 F;  1RKW A;  3DBR B;  4LLL A;  4A3G J;  4ZSI A;  1TZL A;  4KT5 C;  1R1T A;  2M7A A;  4Q4Z F;  2HQR A;  1P4W A;  5J4Y A;  3TW7 A;  1FT9 A;  1F5T A;  1F9N A;  5DUI A;  4A5N A;  5A2Q Z;  1U8B A;  2WAD A;  3LOC A;  1BA5 A;  2Y31 A;  3F21 A;  4IJA A;  3FDY A;  3CJT B;  2KJC A;  3HB9 A;  1DU6 A;  1VQL I;  4E4H A;  3G3Z A;  1TWA J;  2VQH A;  4IF4 A;  1J0R A;  5F0C A;  4LLN A;  2B63 J;  4RB1 A;  2UZK A;  1T08 B;  4P9U A;  2EB7 A;  4L5J A;  3DPL C;  3GLX A;  1MNE A;  3AFH A;  3KE2 A;  1SAN A;  2RQP A;  1LUJ B;  3RKX A;  1JUP A;  2LKS A;  1FYL A;  1N75 A;  3HRU A;  4HF2 A;  2A05 A;  2JT1 A;  1YYV A;  3GTO J;  3BR6 A;  1TQM A;  2X6X A;  2PJR B;  4IKF A;  2G9W A;  3IWF A;  2P0W A;  2IAI A;  2FX0 A;  2A6H F;  2L9V A;  3ASN H;  4D7M A;  2K27 A;  1NH3 A;  2X6Y A;  1XLR A;  4M9S A;  3SZP A;  1JTX A;  3NAR A;  1B59 A;  4EM2 A;  3CUQ C;  3RIR A;  1FZP B;  2XB5 A;  3PUB A;  4P5O A;  1E3O C;  1XSX A;  1G1B A;  1ONV A;  1Z6T A;  3KP5 A;  1HST A;  2EWN A;  1D5Y A;  3LQQ A;  2E1M C;  5FRO A;  5J8C A;  3EDP A;  4IRI A;  5D6F A;  5FRN A;  1BOA A;  2VE9 A;  2IGO A;  5F04 A;  1WPK A;  1IZ1 A;  2DJI A;  1JJ8 C;  3I59 A;  1QRY A;  3KP7 A;  4IVN A;  3S8P A;  4BH9 A;  1VQP I;  1DUX C;  2OAZ A;  4P96 A;  1XGS A;  2X48 A;  3AL0 C;  4J01 A;  2HOE A;  3HPH A;  1I3A A;  4ITV A;  5DUK A;  4A3D J;  4ZDL A;  1W36 D;  2QM3 A;  1B6A A;  3PFY A;  3EET A;  2DA7 A;  5KAF C;  2MYS A;  3K6G A;  3GXO A;  4PFP A;  4A0Z A;  4A6E A;  2R7S A;  2LY2 A;  3VSL A;  2K9S A;  1QO0 D;  2OBP A;  2OU2 A;  3L2U A;  1VQM I;  1EH8 A;  4L9V A;  5EEH A;  3BZ6 A;  2H6C A;  5KVR A;  3I4N J;  2O7O A;  3LWF A;  2R3S A;  2WTE A;  1NG6 A;  1I6X A;  1YIT I;  1R71 A;  4P9F A;  4BEH A;  4XBF A;  5LGU A;  3RPQ A;  4BJT A;  3VFZ A;  1XS9 A;  3GTQ J;  4WXC A;  2ISY A;  3MZY A;  1G2H A;  3HRS A;  5H6R A;  1WRJ A;  1FOX A;  3OYN A;  3I9V 2;  2GM4 A;  1JI8 A;  2IW5 A;  1S7E A;  1YW9 A;  2OQG A;  5F08 A;  3LSH A;  4QSH A;  4L0Y B;  1X3Z B;  3EUK L;  2VQG A;  3WGG A;  3HOZ J;  4HV5 A;  1Y0U A;  2JA6 J;  3TO9 A;  2BVL A;  1B1B A;  4BHC A;  1E2X A;  4QLC U;  4B44 A;  2G0E A;  4WXD A;  3G4S I;  4OIR F;  2KHM A;  5EG0 A;  3JRA A;  3JTG A;  2W57 A;  1YO5 C;  3TDZ C;  3JTH A;  2V6E A;  3OMY A;  2EA4 A;  4CGZ A;  3J81 K;  5GPC A;  4BDZ A;  2DT5 A;  1MBH A;  4CSW A; 
#chains in the Genus database with same CATH homology
 3QP5 A;  3Q9V A;  3LA2 A;  1B9N A;  3TO6 A;  2FQ3 A;  4IRH A;  2MA3 A;  4IXA A;  1JGS A;  5CLS A;  1WSU A;  4U7B A;  5FLX K;  3U9G A;  2XUB A;  3F6V A;  4RS8 A;  3HSF A;  1G3Y A;  1TBX A;  3BRO A;  3O3K A;  3FXR A;  5DD4 A;  2VT2 A;  2VOD A;  3BDD A;  3QPT A;  4PCQ A;  1SFU A;  2ZME A;  3KLN A;  2FU4 A;  1ON2 A;  5EEG A;  4YIF A;  4WX9 A;  5DD8 A;  1XDS A;  4FX0 A;  4UVB A;  1H9G A;  4KDP A;  5DEQ A;  2PN6 A;  1J2X A;  4MTE A;  3IHU A;  3KEQ A;  3HYI A;  4I0A A;  1OR7 A;  2NYX A;  1RUO A;  4O3M A;  1O3Q A;  4WF2 A;  3CUQ B;  1U5T A;  2FMY A;  2GA1 A;  2GXG A;  1FBU A;  3E6D A;  2VOO A;  3ZMS A;  4N0B A;  2A07 F;  2P5L C;  1S3J A;  2QBY B;  3I5U A;  3E6M A;  2W84 A;  1STZ A;  4R79 A;  1H0M A;  2VXZ A;  3ZMV A;  4AIJ A;  2RGV A;  5E8G A;  1U2W A;  3LFK A;  3WG9 A;  4JBA A;  3GWZ A;  3ZMT A;  5ILS A;  3GZ5 A;  3LST A;  4M71 A;  4ZH4 F;  1I27 A;  3VOD A;  1HW2 A;  1W5S A;  1G6N A;  2QQA A;  2VOP A;  3Q9S A;  2UXN A;  2PFB A;  1V3F A;  2VBY A;  2NRA C;  2L4M A;  1SFE A;  1R58 A;  4N9H A;  3RTR A;  1FSH A;  3I71 A;  5FGM A;  2GWR A;  2BBY A;  3GF2 A;  3R0J A;  3IWZ A;  3T8T A;  3S2W A;  3IRQ A;  1WI9 A;  2HTS A;  3EYI A;  4ENM A;  4I02 A;  3V4G A;  4CYD A;  2D1V A;  2H27 A;  3QOP A;  2G7U A;  5ICF A;  2HR3 A;  3COA C;  2UWM A;  4RB2 C;  1WKM A;  2HGC A;  3IRR A;  3W6K B;  2TDX A;  2CG4 A;  3L9F A;  2STW A;  4EMS A;  1KQ0 A;  4S04 A;  1DP7 P;  1KQ9 A;  5DCM A;  2H09 A;  3TDU C;  3QP6 A;  2ZKZ A;  1KA8 A;  1ZH5 A;  1MDM B;  2JZY A;  5E18 F;  5HLH A;  1BC8 C;  1IXC A;  1UFM A;  3BJO A;  3HHG A;  5L3G A;  1U8R A;  1XN7 A;  3F8L A;  2YSR A;  2CGP A;  5HDN A;  4M72 A;  1R5G A;  2ZNY A;  5ERI A;  4OMZ A;  1T2K A;  3JSP A;  3KP3 A;  1H9T A;  3RKY A;  3QPH A;  3WOD F;  3L2C A;  2RKH A;  3MEX A;  2RN7 A;  2HKO A;  2O8X A;  1Q1H A;  3VB2 A;  2DPD A;  3O6B B;  1MKM A;  2K4J A;  5CJ9 A;  2Z9O A;  4IHS A;  5F6F A;  5CVJ A;  3R6S A;  2XRN A;  2RC4 A;  5JR3 A;  5D4R A;  1UCR A;  1AWC A;  3E5U A;  1BI1 A;  2CYY A;  1R22 A;  3IC7 A;  4G7Z F;  1IRF A;  1XSV A;  1BM9 A;  2GA2 A;  5TJJ A;  3DF8 A;  1SAX A;  2ZO4 A;  5E17 F;  3KZY A;  5LEK A;  4RB3 C;  3E6C C;  4GXO A;  3I58 A;  4OIN F;  5E8I A;  2P5V A;  3ZMZ A;  1BJA A;  4EV0 A;  4RGR A;  3SXY A;  1O57 A;  2HYF A;  1I1G A;  2C6Y A;  2YX7 A;  1HW5 A;  1SD4 A;  2P8T A;  2FNP A;  2ETH A;  4L9N A;  1R1V A;  5BS6 A;  4MQV A;  2M30 A;  2QZ8 A;  2DPU A;  2Z5U A;  2E1N A;  3CUO A;  4I7H A;  4JQF A;  1A04 A;  4EGY A;  2XV4 S;  1W5T A;  4AIH A;  2ESN A;  3BJ6 A;  1LDD A;  1QPM A;  2PKH A;  2IRF G;  5BPD A;  3BWG A;  1U78 A;  1DPU A;  4M9X A;  3V7R A;  4UV9 A;  1JHH A;  2DQL A;  3P9C A;  3I0T A;  4AVP A;  1LEB A;  2GXB A;  4LG0 A;  2Y0M A;  3ABU A;  3LAJ A;  4XSZ F;  2GQQ A;  2ZBK A;  4LMY A;  1ZLK A;  3RPU A;  5BMZ A;  1MGT A;  4RGS A;  2HKX A;  3N4M A;  1IN7 A;  2XAF A;  5JFR A;  2OQR A;  3RI4 A;  1XGN A;  4B09 A;  2XKP A;  1W7P A;  1BI3 A;  1P6R A;  2E7X A;  1UHM A;  5D5W B;  2COM A;  2XHK A;  4ON0 A;  1G3S A;  2UXX A;  3HRM A;  1T98 A;  1CF7 A;  3IL2 A;  2KIM A;  4R1H A;  1LNW A;  1FLI A;  3FMR A;  3F23 A;  1YS7 A;  4RGU A;  1FOK A;  5HS9 A;  5LHG A;  3VOE A;  3K0L A;  1YW8 A;  1HW1 A;  2NNY A;  3T5X A;  2ZJ2 A;  2ESH A;  5FD6 A;  2M5W A;  5K5O A;  3TKY A;  4EGZ A;  2WWY A;  1PP7 U;  1T0F A;  1TW3 A;  1RUN A;  3PQJ A;  4LJZ F;  4UXN A;  3J80 K;  3SZT A;  1S8N A;  5HS8 A;  1WQ2 A;  3B73 A;  2VBX A;  1IUY A;  1LDJ A;  5FFX A;  3HTU A;  2WV0 A;  4HQE A;  3DDV A;  2FBH A;  1ZRC A;  2FE3 A;  3ERE D;  1MJ9 A;  4EM1 A;  3U1D A;  4WWC A;  2M87 A;  1FP2 A;  1TNS A;  2K4B A;  4G6Q A;  4CXF A;  4PDK A;  5A2Q K;  2O6G E;  1OYY A;  1ZGA A;  2JRT A;  2FSW A;  4BNC A;  3WU0 A;  2EFO A;  4MNU A;  4KFC A;  3K69 A;  1Z05 A;  4UVC A;  1L3L A;  2HYG D;  3R4K A;  3B02 A;  1TQP A;  3SQN A;  2OD5 A;  4HDV A;  2MLK A;  2F5C A;  3KET A;  5LRR A;  4HF1 A;  1TW2 A;  3E5Q A;  1Z6R A;  1SMT A;  1IN8 A;  2OGG A;  4H0E A;  2HTJ A;  3R61 A;  4RB0 A;  4NQW A;  2MH9 A;  3R0A A;  3DEU A;  3FWE A;  1CGP A;  4OU0 A;  4BXU A;  2ADU A;  3AAF A;  1Z91 A;  4F7Z A;  4PZJ A;  2P6T A;  3FM3 A;  3E3V A;  1IN5 A;  3RJP A;  4IRG A;  3T1B A;  3DP7 A;  3ZMD A;  4ZZD A;  3ECO A;  3C1D A;  3HSR A;  5ICE A;  2EFW A;  1HKT A;  3CNV A;  3ZN0 A;  2W24 A;  1K7A A;  2AS5 F;  3CLO A;  5D5V B;  1RZ4 A;  3WTZ A;  3MAJ A;  1Z1D A;  2PI0 A;  1KYZ A;  2P4W A;  2V1D A;  1IF1 A;  1PDN C;  1HSJ A;  2ZCW A;  4S05 A;  3H92 A;  3KCC A;  2IPQ X;  4Q48 A;  3GYH X;  2IA2 A;  2YX4 A;  3Q5F A;  4MEX F;  2OZ6 A;  3HHH A;  5CYV A;  4BHB A;  2LKP A;  5L3E A;  4EJV A;  2O61 A;  3FXQ A;  1K78 A;  1BIA A;  1IAW A;  1U3E M;  2MH2 A;  1LB2 A;  3KEO A;  4A12 A;  3E97 A;  1QBJ A;  5FFZ A;  5D6E A;  3I59 B;  1ZAO A;  3KLO A;  5DV5 A;  1LDK B;  2Y48 A;  1ULY A;  3DKW A;  3M8F A;  2P7C B;  2D1H A;  2O03 A;  1ZAR A;  2CQK A;  1ZG1 A;  2EV6 A;  1ZHF A;  2PG4 A;  1MD0 A;  4GO1 A;  1W7P D;  4LB6 B;  5JVT A;  3RDI A;  5HDG A;  2DI3 A;  2DK8 A;  4DNC A;  3MWM A;  3P7N A;  2P5K A;  2K86 A;  4WXH A;  4A5M A;  3ZQ7 A;  2STT A;  5KK1 A;  4EVI A;  1ZG5 A;  3F3X A;  4A0X A;  4HA8 A;  2JPB A;  4HLY A;  2X4H A;  2P6S A;  2BV6 A;  3C3W A;  2QQ9 A;  2L02 A;  1MDM A;  4HYE A;  3TO7 A;  4ESJ A;  1YTY A;  3K1M A;  1P92 A;  2QUF A;  5DDG A;  4HX8 A;  1R23 A;  5L3D A;  3GUD A;  3OOP A;  3L09 A;  3I64 A;  1MJB A;  5JI6 A;  3C18 A;  3F8N A;  4BHP A;  1FW9 A;  4AWX B;  1D8J A;  4ZYG A;  2LDU A;  1F1Z A;  1UHW A;  4M9Z A;  2ZME B;  2HDC A;  3FM5 A;  2K7L A;  4HAM A;  2ACJ A;  5CVU A;  2FEZ A;  5AIP A;  1RI7 A;  1J7K A;  2A3S A;  2PBI A;  4BYY A;  1QZY A;  3GEZ A;  2FBK A;  1YG2 A;  3GVA A;  2YU3 A;  4OIQ F;  2FOK A;  3PFI A;  3LA3 A;  2HZT A;  2EK5 A;  2NNN A;  5DYM A;  4CIC A;  5LBQ A;  4KNY A;  3FHZ A;  3IKV A;  2KKO A;  5HS7 A;  3P9I A;  3L00 A;  3E6B A;  1HKS A;  4YII A;  4WCG A;  1P2F A;  2YPR A;  1EH7 A;  4NB5 A;  3HUG A;  1XCV A;  2VT3 A;  4G9Y A;  3WTW C;  5AON A;  3WTX C;  4I98 B;  3ZP5 A;  2DW4 A;  4KYW A;  4HDU A;  1J59 A;  2YR2 A;  1T38 A;  2ISZ A;  2NAZ A;  2K02 A;  1YLF A;  4UVA A;  4WK8 F;  3EYY A;  1BI2 A;  3RYP A;  4AD9 A;  5FD5 A;  3WTU C;  4K2E A;  1I5Z A;  3C7J A;  4G6D A;  3R60 A;  4DQ2 A;  3GFI A;  4UNO A;  5L3F A;  3IKT A;  2PLY A;  1AOY A;  4A6D A;  1IXS B;  4MHG A;  3JSO A;  1PP8 F;  5HLG A;  2LNB A;  1O3S A;  4M74 A;  1XD7 A;  3ZN1 A;  4Q5S F;  4R8H A;  4B8X A;  5LRS A;  1FSE A;  1V4R A;  2EV5 A;  2XIG A;  3RKW A;  2IA1 A;  1R00 A;  3FZV A;  1R7J A;  5D5X B;  2AHC A;  1GVJ A;  2J5P A;  2M8E A;  5DCM B;  2XAJ A;  3V8L A;  2PJP A;  4OIO F;  2NS0 A;  1T39 A;  2GIV A;  2ELH A;  1SD6 A;  2XAH A;  1ZYR F;  1GXP A;  2P19 A;  3H3U A;  4MTD A;  4YG2 F;  3SFZ A;  2P7V B;  1O7L A;  1UST A;  4U0V A;  2DU9 A;  1OMI A;  1XMA A;  4GYI A;  5BPI A;  4KMF A;  2EFQ A;  3BJA A;  4RAZ A;  4ZSK A;  1EH6 A;  1DDN A;  3JAM Z;  1FC3 A;  3NRV A;  1D8K A;  2XAG A;  3ELK A;  4XSX F;  3WGI A;  1P4A A;  1GHC A;  3M1E A;  1FX7 A;  2XAQ A;  3EQL F;  3I54 A;  3DXJ F;  3BOQ A;  3HOT A;  1OYI A;  5IT9 Z;  1BN5 A;  1HQC A;  1R36 A;  4EQQ A;  1TNT A;  1IN4 A;  2CWE A;  2EV0 A;  2IKK A;  4OOI A;  4KIB A;  3TOB A;  2QWW A;  1S7A A;  3HSE A;  1Z7U A;  1ON1 A;  4LFU A;  2VN2 A;  3PQK A;  4M6X A;  3JW4 A;  1QGP A;  4QWQ A;  1IRG A;  1QNT A;  1HXD A;  4KIF A;  1OKR A;  3U2R A;  4BQA A;  1XB4 A;  2EFP A;  2GZW A;  1BI0 A;  4OIP F;  4JK1 X;  2ZFW A;  2FBI A;  4N9I A;  3TOA A;  5LLQ A;  4IHT A;  1J75 A;  3ISP A;  5CVR A;  4L9J A;  2H94 A;  5ED4 A;  1Z9C A;  2O3F A;  3F8M A;  3F72 A;  4CZZ A;  3H3Z A;  3F22 A;  4RAY A;  5D5U B;  1FY7 A;  3WTT C;  1JXS A;  3K1N A;  2DQR A;  2Z33 A;  3QU3 A;  4YFK F;  4ESB A;  2IA0 A;  4G94 A;  2M1B A;  1OPC A;  4LG0 B;  4EJU A;  3WE2 A;  4I09 A;  5H20 A;  3CDH A;  1FPQ A;  2CFX A;  1KU9 A;  4MGR A;  3BY6 A;  3REO A;  1GXQ A;  2LF8 A;  3T8R A;  5L3B A;  3WTS C;  4HX7 A;  2KRF A;  2H6B A;  3KFW X;  4NHJ A;  4UV8 A;  1W7P B;  2WC2 A;  4BAY A;  1ZG3 A;  2FXA A;  5DCF A;  2V1U A;  1TT8 A;  1KU3 A;  3HOS A;  3L7W A;  4ENK A;  4ENN A;  1KU7 A;  2KIU A;  4MEY F;  2Z99 A;  2FF4 A;  2M45 A;  3DPT A;  3ECH A;  4LLG F;  5ICG A;  1CF7 B;  2RDP A;  5ILU A;  1ZN2 A;  1DPR A;  4A0Y A;  4CHU A;  4I0B A;  4ZSB A;  2L54 A;  2F5D A;  5FO5 A;  2IVM A;  4PGG A;  4FT8 A;  1FBS A;  2A69 F;  2HFH A;  1SFX A;  4KIC A;  3RYR A;  3MZH A;  2PMU A;  3FMQ A;  3FMS A;  2KJB A;  3G73 A;  4Y15 A;  2DO7 A;  3OV8 A;  3ROU A;  2Q8K A;  5HDK A;  3KP6 A;  4HW0 A;  1B9M A;  1UB9 A;  3CUQ A;  4O6J A;  1QQI A;  2JPC A;  5HVQ C;  4UHT A;  4KN4 X;  1ZGJ A;  1R5H A;  2QBY A;  1MZB A;  2F2E A;  1S7O A;  1I1S A;  1U6G A;  1FBQ A;  1X3U A;  2A6E F;  1XGM A;  3MCZ A;  3BP8 A;  3J81 Z;  1JD3 A;  1YQA A;  5ILV A;  1SMY F;  2DFI A;  4OMY A;  5IT3 A;  1G3T A;  1XMK A;  2A68 F;  5FLX Z;  4ESF A;  2Z3Y A;  5JHU A;  3F8B A;  4HZF A;  3QRF F;  3HTS B;  2DLL A;  2FML A;  2D2W A;  2FRH A;  3CJN A;  3KZZ A;  3LHE A;  2G7H A;  1K6O A;  1U5T C;  2J5O A;  2CW0 F;  3CTA A;  1XSD A;  2A5Y B;  2HQN A;  2ZXJ A;  1OYW A;  2VON A;  4ZYE A;  1KQ8 A;  2Y75 A;  2XRO A;  5D8L B;  1YIO A;  3I4P A;  1YS6 A;  4UUV A;  4L18 B;  2EJR A;  2W25 A;  1D3Y A;  4ZYD A;  2L4A A;  4HV6 A;  2JTV A;  1FP1 D;  2HEO A;  2PQ8 A;  5LHH A;  3DQV C;  3WTY C;  4ENJ A;  4U0W A;  2PMH A;  2IP2 A;  2ZNZ A;  1XDU A;  2F5E A;  3N97 A;  1YW7 A;  1B4A A;  2D45 A;  5E1X A;  2MLG A;  3WE3 A;  2E7W A;  4XLP F;  1QZZ A;  3V7S A;  2A61 A;  3HIF A;  1YFH A;  3K9T A;  2B0L A;  1KU2 A;  3HFI A;  4EJW A;  3HRT A;  3P9K A;  2OA4 A;  4KMU X;  1FNN A;  1SD7 A;  2RA5 A;  5LGT A;  1RIO H;  3I53 A;  3M9A A;  3NQO A;  5F64 A;  4GCV A;  2L3D A;  1O3T A;  3WGH A;  1O3R A;  4AIK A;  4EJO A;  4L5I A;  5E20 A;  2IT0 A;  2XVC A;  3SHF A;  3GX4 X;  2V79 A;  3ABT A;  4I2O A;  1K78 B;  3K1P A;  2QEN A;  1S29 A;  3GO5 A;  5F1R A;  2RV8 A;  1D5V A;  2BYV E;  4XRF A;  3M8E A;  4ETS A;  2LSO A;  5E1Z B;  3LQR A;  2QQB A;  4FHT A;  4CDG A;  2QYO A;  3TGN A;  4EM0 B;  5LGN A;  4ZYH A;  3CO6 C;  4KUM A;  2BEO A;  3ULQ B;  1EV7 A;  2Q0O A;  2HS5 A;  2VBW A;  4M73 A;  4Z2Y A;  4HF0 A;  1J9I A;  1RNL A;  3KP4 A;  4LD5 A;  1NHA A;  3FF5 A;  1L0O C;  1ODD A;  3QU6 A;  4GYG A;  4LB5 A;  1U5T B;  2GAU A;  2O0Y A;  4HX4 A;  4I01 A;  5D4S A;  5AIQ A;  4HLX A;  1MJA A;  3BPX A;  2EFN A;  5E1W A;  1XGO A;  3E5X A;  2BE5 F;  2MC3 A;  3GZ6 A;  2BGC A;  2W85 A;  5FB2 A;  1WWX A;  3FX3 A;  1ZLJ A;  5K1Y A;  1W4M A;  2FA1 A;  3J7A O;  2VBZ A;  4A2U A;  2IJL A;  4LK0 F;  1C0W A;  4YFN F;  3F6O A;  4P55 A;  1O7F A;  4ASN A;  3BPV A;  1S6L A;  2CO5 A;  4HQM A;  2RVC A;  4MQ9 F;  4CO8 A;  3WU1 B;  1JHF A;  5J6X A;  5TRD A;  2CSO A;  3V8K A;  3W6J B;  1VTN C;  2V6C A;  3O2P E;  4O5V A;  2EA2 A;  4FX4 A;  5K5Q A;  4Y17 A;  2R7D A;  3WTV C;  4Q47 A;  1LQ1 A;  5HOO A;  5CVI A;  5L3C A;  1ZRE A;  2AXL A;  2XGX A;  2X0L A;  4D0P A;  5H6Q A;  2V1X A;  3T0Y A;  1IXR C;  1LVA A;  4RGX A;  4TV7 A;  1BIB A;  1JE8 A;  3QAH A;  1TTY A;  5CVV A;  2FA5 A;  3ML6 A;  3L5Z A;  4ZZL A;  1SD5 A;  2JSC A;  2HWV A;  3KP2 A;  1E17 A;  2XKO A;  5D8K B;  4L9T A;  1P4X A;  2DAO A;  4KIG A;  1USS A;  2QVO A;  2FNA A;  6PAX A;  1IN6 A;  2VE8 A;  1G4D A;  3GFM A;  3DFG A;  2F5F A;  1BBY A;  1TQI A;  2V9V A;  4G7H F;  4IPA A;  3K2Z A;  1PUE E;  3DV8 A;  4L0Z B;  4KN7 X;  2QLZ A;  4G8X A;  1BC7 C;  1HKQ A;  1KYW A;  1LJ9 A;  4U0Y A;  5BOX A;  2DTR A;  1FYK A;  3NEU A;  3V7C A;  3MFK A;  3CO7 C;  3VEP A;  4M6Y A;  3EUH A;  1F4K A;  2RNJ A;  5LHI A;  5K5R A;  4U7D A;  2LF7 A;  4EJT A;  3LAP A;  2R7F A;  2MBF A;  3JAM K;  1LEA A;  2L01 A;  3GFJ A;  3ZMU A;  1ZRF A;  3GFL A;  3V8J A;  2XAS A;  1FWZ A;  1G3W A;  4YFX F;  2OOI A;  1IW7 F;  1HBX G;  5ICC A;  2MD5 A;  1XCB A;  2DBB A;  3LA7 A;  2E1C A;  1J5Y A;  5IT9 K;  3M7G A;  2DK5 A;  4PGH A;  3GW2 A;  3ZPL A;  3F8F A;  1ZRD A;  1TLH B;  2KIF A;  5J8F A;  5LEJ A;  1G81 A;  5BQT A;  2OZU A;  3D0S A;  4G7O F;  4XLN F;  1R1U A;  4Y13 A;  4E70 A;  2VC0 A;  1K79 A;  2PEX A;  3J80 Z;  1T6S A;  1FYM A;  3MQ0 A;  4GGG A;  4HOB A;  5HLI A;  3TQN A;  4U88 A;  2VC1 A;  3F8C A;  4LGW A;  4KA4 A;  4HBL A;  3FXU A;  2Q2E A;  2NWI A;  3D5L A;  1REP C;  1KGS A;  4LK1 F;  4LLL A;  4ZSI A;  4KT5 C;  1R1T A;  4Q4Z F;  2HQR A;  1P4W A;  1FT9 A;  1F5T A;  1F9N A;  5DUI A;  4A5N A;  5A2Q Z;  3F21 A;  4IJA A;  2KJC A;  3G3Z A;  4IF4 A;  1J0R A;  4LLN A;  4RB1 A;  2UZK A;  4P9U A;  2EB7 A;  4L5J A;  3DPL C;  3GLX A;  3KE2 A;  2RQP A;  3RKX A;  1FYL A;  3HRU A;  4HF2 A;  2JT1 A;  1YYV A;  1TQM A;  2G9W A;  3IWF A;  2A6H F;  2K27 A;  1XLR A;  4EM2 A;  4M9S A;  3SZP A;  1B59 A;  3CUQ C;  3RIR A;  1FZP B;  4P5O A;  1XSX A;  1G1B A;  1ONV A;  1Z6T A;  3KP5 A;  1HST A;  2EWN A;  3LQQ A;  5J8C A;  3EDP A;  4IRI A;  5D6F A;  1BOA A;  2VE9 A;  1IZ1 A;  3I59 A;  3KP7 A;  4IVN A;  4BH9 A;  1DUX C;  2OAZ A;  4P96 A;  1XGS A;  2HOE A;  5DUK A;  2QM3 A;  1B6A A;  3EET A;  3GXO A;  4A0Z A;  4A6E A;  1QO0 D;  2OBP A;  2OU2 A;  1EH8 A;  4L9V A;  5EEH A;  3BZ6 A;  2H6C A;  5KVR A;  3LWF A;  2R3S A;  2WTE A;  1I6X A;  4P9F A;  4XBF A;  5LGU A;  3RPQ A;  3VFZ A;  4WXC A;  2ISY A;  3MZY A;  3HRS A;  5H6R A;  1WRJ A;  2IW5 A;  1YW9 A;  2OQG A;  4L0Y B;  3WGG A;  4HV5 A;  1Y0U A;  3TO9 A;  4QLC U;  1B1B A;  1E2X A;  4BHC A;  4WXD A;  4OIR F;  3JTG A;  2W57 A;  1YO5 C;  3TDZ C;  3JTH A;  2EA4 A;  4CGZ A;  3J81 K;  2DT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...