3BWGA

The crystal structure of possible transcriptional regulator yydk from bacillus subtilis subsp. subtilis str. 168
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
229
structure length
223
Chain Sequence
b'QQIATEIETYIEEHQLQQGDKLPVLETLMAQFEVSKSTITKSLELLEQKGAIFQVRGSGIFVRKHKRKGYISLLSNQGDFNVTSKVIELDVRKPTPEAAENLNIGMDEDIYYVKRVRYINGQTLCYEESYYTKSIVTYLNNEIVSHSIFHYIREGLGLKIGFSDLFLHVGQLNEEEAEYLGLEAGLPKLYIESIFHLTNGQPFDYSKISYNYEQSQFVVQANS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized HTH-type transcriptional regulator yydK
publication title The crystal structure of possible transcriptional regulator YydK from Bacillus subtilis subsp. subtilis str. 168.
rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transcription regulator
total genus 58
structure length 223
sequence length 229
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
A PF07702 UTRA UTRA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bwgA01
3.40.1410.10 Alpha Beta 3-Layer(aba) Sandwich Chorismate lyase Chorismate lyase-like 3bwgA02
3HHGA 2FBIA 3J80Z 1O3TA 5F1RA 4CGZA 4EVIA 2IVMA 4CDGA 4RGXA 3COAC 1BN5A 5J8FA 3JAMK 2STWA 1XB4A 2RN7A 3GUDA 1JGSA 1U8RA 5KVRA 1XDUA 2JPBA 3K0LA 4DQ2A 2P6SA 2VBYA 4ZYEA 3ZMVA 2DPDA 1XN7A 5DDGA 1FWZA 3DF8A 4KN4X 1XGOA 3ISPA 2EFWA 2A07F 2MH9A 5LHHA 5HLGA 4UV9A 4E70A 2K02A 2HTJA 3W6KB 1LVAA 2G9WA 4RB3C 3HRMA 2M8EA 3LA3A 1U5TC 3TDZC 2QBYB 2PI0A 4KYWA 4NHJA 4I09A 4EGZA 3QU6A 4AWXB 4YG2F 2L4AA 4M73A 2Z3YA 4U0WA 3O2PE 2M1BA 5K1YA 4M6XA 3U2RA 1B59A 3R61A 5LGTA 1YYVA 5D8LB 1ZH5A 1WRJA 3I4PA 1Q1HA 1H0MA 3GF2A 1I6XA 2F2EA 3L09A 4WXHA 1V4RA 5DUIA 4RB2C 5JFRA 2NRAC 1BIBA 1O7LA 3RDIA 2ESNA 2JT1A 4Z2YA 2VE9A 1Z05A 3FM3A 1R1UA 2WWYA 4G94A 3FF5A 1BI2A 1H9GA 3CTAA 1DPUA 4AIHA 2ZXJA 5CVRA 2COMA 3I0TA 5CVUA 1W7PB 2X0LA 3TGNA 5HDKA 1WSUA 4OINF 1HW2A 2ZO4A 5BMZA 1K78A 2H6CA 4CXFA 2YSRA 2ADUA 1FT9A 5DYMA 2DLLA 2OOIA 3BDDA 1YTYA 2FBKA 2PKHA 2P7CB 3ABUA 2IPQX 1PP7U 5IT9Z 2OD5A 3DQVC 1B4AA 3F72A 2UXNA 3CNVA 4KMFA 2L3DA 1U78A 3I58A 3FM5A 2IW5A 5ICCA 3J81Z 2DW4A 2UXXA 3J7AO 2FA1A 5LGUA 4EM1A 4EMSA 5E8IA 4FX0A 3JTGA 2EV6A 2M87A 1EH8A 1U3EM 1ZRFA 1IXCA 1PP8F 4LG0B 1ZG3A 3TO6A 4OIRF 1KU7A 1IUYA 1R23A 5D6FA 1YIOA 5DCMB 3H92A 2HDCA 4M6YA 2K7LA 2DTRA 3R0JA 3ZMTA 3KP4A 3F21A 2O3FA 4YFNF 2L4MA 2D2WA 3DP7A 2ZMEA 2ZKZA 1STZA 1AOYA 1UHWA 3ECOA 1SD7A 4G7ZF 1L3LA 1FBUA 4ESFA 2OAZA 2PG4A 3E6MA 1TTYA 2DFIA 1REPC 4I0AA 1OR7A 4I01A 3BROA 3FXQA 3VFZA 1XDSA 2GAUA 1OPCA 1I27A 5FLXZ 2PMUA 5D4RA 1F1ZA 1W7PD 3CUQA 4HW0A 3T0YA 2CG4A 5ILVA 1Z1DA 3N97A 2NWIA 4IF4A 5FD5A 1PUEE 3CDHA 3MQ0A 3HRUA 2ZCWA 4LK1F 1GHCA 1O57A 2CWEA 3WTYC 2STTA 1IW7F 2RKHA 2BYVE 3WTWC 5L3DA 4WWCA 2HS5A 2XAHA 1UHMA 2RDPA 2FQ3A 2PBIA 1QO0D 3K1PA 1WWXA 4YIFA 2LDUA 4OMZA 2G7UA 2FNPA 4OOIA 3FMQA 3K1MA 4M74A 3ML6A 2D1HA 3L9FA 4RB0A 3F6VA 3WU0A 2IJLA 5FO5A 3J81K 4I7HA 1LDJA 2A68F 5JR3A 1J0RA 2B0LA 2HFHA 2NYXA 1R5HA 3RKYA 2M30A 2G7HA 2V1DA 5BPIA 1QQIA 4RGSA 1ZLJA 3P9CA 5LHGA 1FSEA 5J6XA 2ZNZA 5FGMA 5E1WA 4WX9A 2IA2A 1USSA 3W6JB 4DNCA 2QBYA 4KDPA 4LD5A 2XROA 1FBQA 1J2XA 4A5NA 1RI7A 4HF0A 4Y15A 3BWGA 4NB5A 5CYVA 2AXLA 3TKYA 3GYHX 5E18F 2A69F 3WE2A 2ESHA 1XD7A 2Q0OA 4S04A 4A2UA 4R1HA 5HS7A 5DEQA 1PDNC 1XMKA 5LLQA 3JAMZ 3HUGA 1IZ1A 4FX4A 3ERED 5DD4A 1DUXC 2DQRA 5D5VB 1H9TA 2P5LC 1V3FA 2VT2A 1ZG5A 3ZP5A 1G3SA 4U88A 2AS5F 3K69A 3RIRA 5FLXK 1GXPA 2VC1A 3ELKA 1Y0UA 2JTVA 4M72A 2P19A 5E8GA 2V1XA 2KJCA 3SFZA 2LF8A 4UUVA 3NQOA 2MD5A 5E17F 1J75A 1ZARA 4AVPA 4RGUA 2KKOA 3WTUC 1FOKA 3FWEA 3Q9SA 1IN8A 1UCRA 4KUMA 3P7NA 1SMYF 3WG9A 2YX7A 3C7JA 1W7PA 3I71A 2C6YA 3ZPLA 2FRHA 3I53A 1MDMB 2ETHA 1U5TB 3JTHA 5E1ZB 3V8JA 1YQAA 1KU9A 2FOKA 2YPRA 2EV5A 1TBXA 5CVIA 4HX8A 2P5VA 4P9FA 1IXSB 3BJOA 1DPRA 4L5JA 2LSOA 1B9NA 3HRSA 2HQRA 4EV0A 2JZYA 1R22A 4Y13A 3GX4X 2HTSA 4LFUA 4RAZA 4IRIA 3M8EA 2DU9A 1R00A 2FF4A 3QP5A 3BJAA 2VOOA 4IPAA 4ESJA 2D1VA 2MA3A 2OQRA 2K86A 4M71A 1O3QA 4HA8A 1IXRC 1IN7A 1FYMA 4LJZF 4M9ZA 2RV8A 2XKPA 5KK1A 3F8BA 3U9GA 5EEHA 2KRFA 1LNWA 4LG0A 1QZZA 4Y17A 5HDGA 5DCMA 1TW2A 5ERIA 5AIPA 4G9YA 4P5OA 3LQQA 4R8HA 2VOPA 1MD0A 3RKWA 1KQ0A 5H6RA 3I54A 4MTDA 2CW0F 3O3KA 4EQQA 2O0YA 2DK8A 2ZBKA 4PZJA 4GXOA 3RYRA 2W57A 3L5ZA 4EJOA 4ZZDA 2XGXA 3G3ZA 5ICFA 3I59B 3GFJA 1ZRDA 2EFOA 3MEXA 2LKPA 4G7OF 4S05A 1XLRA 1F4KA 2GIVA 2OZ6A 4GYIA 1RIOH 3AAFA 3RPQA 2R7FA 3IRQA 4IJAA 2Y48A 5HS9A 5L3CA 3HSRA 2QUFA 1KQ8A 1S3JA 5JI6A 5DUKA 1GVJA 3F8LA 1FP1D 2K4BA 3C1DA 1K6OA 3KFWX 3DV8A 1RNLA 4XLNF 1I5ZA 4GYGA 3EDPA 2Q8KA 2F5DA 3OV8A 1D3YA 4LK0F 4EJUA 6PAXA 1GXQA 4ENJA 3PFIA 3E97A 1XMAA 2F5FA 3B02A 2M45A 3IRRA 3M7GA 1K7AA 1MJ9A 1IAWA 4OU0A 3QP6A 4ASNA 1ZRCA 3FXUA 3GZ5A 4IRHA 2F5CA 1BBYA 1TNSA 1TW3A 1BI0A 4G6DA 4OIPF 1T6SA 1S7OA 4LGWA 2HQNA 2TDXA 1P6RA 4LB5A 3KLOA 2VE8A 1BIAA 2OU2A 3WTVC 3VB2A 1ZHFA 2ZNYA 1QZYA 4I98B 5F64A 5EEGA 1P2FA 2D45A 1BI1A 1C0WA 4KFCA 4KN7X 2LF7A 2XUBA 4L18B 5LGNA 3FHZA 4PCQA 5CVVA 4EGYA 1UB9A 5F6FA 5FD6A 1SD6A 2WTEA 4Q4ZF 3SQNA 4HDUA 4U0VA 3R4KA 2XAFA 1FX7A 4A5MA 4FT8A 3MZHA 1IF1A 3E6BA 3I64A 1HW5A 1HXDA 4EJWA 4MHGA 5A2QK 3GXOA 4Q5SF 1BC8C 2P7VB 2HZTA 3P9IA 2VN2A 3RPUA 4KIFA 3IHUA 2VBXA 3CUOA 1IN6A 2MLKA 4MNUA 1SMTA 2A6EF 4IVNA 1P4WA 1YG2A 3KP2A 1OYWA 1X3UA 4HBLA 3GW2A 1I1SA 3EYYA 2EFNA 5D5UB 4L9TA 1TT8A 1IN5A 3DPTA 1JD3A 4LMYA 1MDMA 3LSTA 1U5TA 2GA2A 1G1BA 3LHEA 2LNBA 2UWMA 3L2CA 2Q2EA 4Q47A 2F5EA 5L3BA 1QGPA 4PGGA 1EH6A 2DO7A 4ZSIA 3WGGA 1W5TA 1B1BA 3LA7A 3V7RA 1OYYA 3WGHA 1RUOA 2PMHA 1B9MA 2E7XA 2A61A 1JHFA 1BC7C 1P4XA 2RVCA 5J8CA 3HFIA 3GEZA 1KU3A 5AIQA 3DEUA 1T98A 5LRSA 3IL2A 3I5UA 3F8CA 3E5QA 3V8KA 1G3WA 5HOOA 1LQ1A 4G8XA 3H3UA 3DDVA 3NRVA 5H6QA 3QPHA 2HKOA 4L5IA 3VOEA 5D8KB 1J9IA 3BY6A 2RQPA 2X4HA 4HLXA 2PJPA 4N9HA 4ZYHA 5D5WB 4PDKA 4HV6A 2QQ9A 3R6SA 2Y75A 1KU2A 1WKMA 2FEZA 5HDNA 1O3SA 4NQWA 3QRFF 2VBWA 3EETA 2L54A 2GQQA 1O3RA 1FP2A 4U7BA 3FMRA 4BAYA 5LRRA 2BGCA 3I59A 4P55A 4BHPA 2L01A 4GCVA 2O8XA 2VBZA 1JE8A 3ABTA 4YFKF 3RTRA 1O7FA 3WGIA 2OGGA 2QYOA 2E1CA 3GFIA 3B73A 3D0SA 3QPTA 1U2WA 3KEOA 1SD4A 1Z6TA 3T1BA 2EB7A 1OYIA 1MJBA 2QM3A 4ZYDA 3GZ6A 1ON2A 3T8TA 2HYGD 1S29A 2OQGA 4JQFA 1DDNA 3BJ6A 3R0AA 4G7HF 1R7JA 3E5XA 2Z99A 4B8XA 1YS6A 3ZMSA 4XSZF 1XGNA 2K27A 3U1DA 4U7DA 3BPXA 1G4DA 3GLXA 4ZYGA 4EM2A 3KP6A 3HHHA 1TQMA 3BP8A 2V79A 4MGRA 2EWNA 1MJAA 4WCGA 3KLNA 4I2OA 4YFXF 3EUHA 1IRFA 4KICA 1MKMA 2IRFG 3OOPA 1CGPA 4OIQF 4MEXF 2KJBA 1D8JA 3F8MA 3IWZA 2PQ8A 1TLHB 3N4MA 4KIBA 5K5RA 2NNYA 1Z9CA 4AIKA 1LJ9A 3KP3A 1FLIA 4L0ZB 4MTEA 4UVCA 5DD8A 2QQBA 5K5QA 2K4JA 2MH2A 1FY7A 3HYIA 2XKOA 2XV4S 2DI3A 1I1GA 4O5VA 4F7ZA 1DP7P 4HX4A 4I02A 3TOBA 2VXZA 4HX7A 5D6EA 1FNNA 3V8LA 2O6GE 4PGHA 3LWFA 1WI9A 2OZUA 3GFLA 2BV6A 2FMLA 2VC0A 3F8NA 2JPCA 1KGSA 2V9VA 2H6BA 4ENNA 2HOEA 4IRGA 4L0YB 1R58A 2CO5A 1QNTA 2CSOA 3JSOA 1ZLKA 2ISYA 3TOAA 1HW1A 3WTSC 4JK1X 3KZZA 2DQLA 3ECHA 2MLGA 1XSVA 2A3SA 3RYPA 3WU1B 3F22A 3S2WA 2NAZA 5BQTA 2QWWA 2HR3A 3HOTA 2PLYA 1XCBA 2M5WA 1F9NA 2L02A 3C18A 2ZJ2A 5DV5A 1EV7A 2P6TA 1LDDA 5CLSA 1YW7A 5FFXA 1ODDA 2W24A 2CYYA 4RS8A 2FA5A 3ZMDA 4KA4A 4Q48A 4RGRA 3BZ6A 1SFUA 4XSXF 2MC3A 1AWCA 2QENA 1VTNC 2BE5F 1FW9A 2DT5A 2EA4A 1W4MA 1XCVA 5HS8A 3KZYA 5L3GA 3IC7A 1G3YA 3K9TA 2P8TA 2IA0A 1CF7B 2PFBA 1ONVA 2A6HF 5TRDA 2V6CA 1FC3A 3ZN1A 3Q9VA 4UVBA 2E1NA 3WTXC 4BHBA 2ISZA 1KQ9A 5ICGA 4L9NA 2A5YB 2FE3A 4KNYA 1SFXA 1XSXA 3KETA 1WQ2A 2Z9OA 1BM9A 1FBSA 2AHCA 3CO6C 2KIFA 5HLIA 4CHUA 3SHFA 3GFMA 3GO5A 4HZFA 5L3FA 1BI3A 5ED4A 4G6QA 5A2QZ 5D5XB 1Z7UA 4HYEA 3BOQA 4CICA 5LEJA 2ACJA 3QU3A 4ENMA 4GGGA 3F8FA 4LB6B 3HSEA 2EA2A 2HYFA 1XGMA 3T5XA 3ZMZA 3E3VA 4MQVA 3M1EA 4UNOA 2W85A 1SFEA 3O6BB 2UZKA 1YO5C 1E2XA 5E1XA 2GWRA 4ZZLA 2DBBA 5LEKA 2H09A 3CO7C 5LHIA 2HGCA 1L0OC 3R60A 2XVCA 3IKVA 2RA5A 1HKTA 1FYLA 4LLNA 1A04A 3FZVA 1TQIA 2CFXA 3CUQC 4EJVA 3SZPA 4FHTA 4P9UA 1SAXA 3HOSA 3JSPA 1D8KA 4O3MA 3E5UA 1U6GA 2DAOA 2EJRA 4A0ZA 1S6LA 2XAGA 2HKXA 3RKXA 3WODF 1XGSA 1S7AA 3MWMA 1R1VA 2MBFA 2ZFWA 4IHTA 1FPQA 1RUNA 3J80K 2EFQA 1YW9A 1ULYA 4ENKA 3KEQA 1OKRA 3PQKA 1P4AA 4CO8A 4N0BA 1R36A 1J7KA 5BPDA 3LAPA 5H20A 2CQKA 4QWQA 3HTSB 4ZSBA 4HDVA 2VODA 4UV8A 2OBPA 2HWVA 2VT3A 1LB2A 2XAQA 1FSHA 2VONA 1J5YA 1LEBA 2WC2A 1NHAA 4HQMA 2EV0A 2XRNA 3MZYA 4KIGA 3MFKA 3C3WA 1R5GA 3K2ZA 3M9AA 3V7SA 2EK5A 1G81A 2EFPA 3FMSA 1FZPB 1YLFA 4BH9A 1TNTA 2RNJA 2Y0MA 4XBFA 3GVAA 3F6OA 3BPVA 2JRTA 4D0PA 5HVQC 3T8RA 1RZ4A 1YFHA 1ZN2A 4A0YA 2J5OA 3LAJA 3PQJA 3WE3A 2FU4A 1HSJA 4CYDA 2H94A 1D5VA 4MQ9F 1R1TA 3HSFA 2O61A 5ILUA 4L9JA 5CVJA 5IT3A 4M9SA 4UHTA 1IN4A 3HTUA 2FXAA 3P9KA 2QZ8A 1ZREA 4AIJA 2W84A 3CJNA 4XLPF 2Z5UA 4CZZA 3DFGA 3DPLC 3F3XA 3KP5A 4MEYF 5FB2A 1T39A 4IHSA 4IXAA 4O6JA 4BNCA 1IRGA 5DCFA 1T0FA 4HV5A 4R79A 1MZBA 2FSWA 3IWFA 1HKQA 4OIOF 2IT0A 3HRTA 4L9VA 2FMYA 3TQNA 2YR2A 1ON1A 3V4GA 3SZTA 3MCZA 5K5OA 1KYWA 4K2EA 2W25A 2KIUA 1YS7A 4P96A 2E7WA 3MAJA 5AONA 3ZN0A 4LLGF 4ETSA 2GZWA 3D5LA 2Z33A 1KYZA 4U0YA 4B09A 4BHCA 4RB1A 3TDUC 4A12A 1SD5A 4UXNA 3FXRA 2GA1A 4JBAA 2DPUA 2BEOA 3V7CA 3TO7A 1F5TA 5BS6A 4WF2A 3ZQ7A 3F23A 5IT9K 4HAMA 2YX4A 1HQCA 1CF7A 2KIMA 2P5KA 2IA1A 3HIFA 4GO1A 4ON0A 1ZYRF 4KT5C 1BOAA 3FX3A 1MGTA 5D4SA 3EYIA 3QOPA 2QVOA 1J59A 3LA2A 2XHKA 4A0XA 5JHUA 2YU3A 4BXUA 4H0EA 3G73A 4BQAA 3ZMUA 2NNNA 2PN6A 3LFKA 4ESBA 1K78B 2P4WA 2IP2A 4M9XA 1ZGAA 1W5SA 3EQLF 1EH7A 4TV7A 5E20A 4HF1A 3LQRA 4WXDA 4KMUX 3CLOA 5ILSA 4HF2A 5L3EA 3TO9A 4WK8F 2JSCA 1QPMA 4N9IA 3K1NA 2RC4A 3WTZA 4A6EA 3Q5FA 2FNAA 2RGVA 3E6DA 1QBJA 4HOBA 3WTTC 1KA8A 2QLZA 2CGPA 4QLCU 4EM0B 1LDKB 4I0BA 2ELHA 1OMIA 2IKKA 4LLLA 2H27A 5LBQA 2NS0A 3GWZA 2WV0A 4WXCA 3E6CC 2O03A 1FYKA 1Z91A 1K79A 1B6AA 3L00A 2GXBA 3ROUA 3RI4A 5HLHA 2OA4A 3M8FA 2V1UA 1HSTA 2R7DA 1JHHA 4XRFA 5BOXA 1UFMA 4UVAA 2FBHA 2PEXA 2QQAA 3REOA 1E17A 1BJAA 1YW8A 4AD9A 3VEPA 4OMYA 2ZMEB 3ULQB 5JVTA 2BBYA 2XASA 3H3ZA 3DXJF 2XAJA 4HQEA 1TQPA 1JXSA 1XSDA 1T2KA 2J5PA 1Z6RA 4RAYA 3JW4A 3NEUA 5ICEA 2DK5A 4ZSKA 3QAHA 3VODA 1ZGJA 1LEAA 5TJJA 3IKTA 5FFZA 1HKSA 4YIIA 1ZG1A 2XIGA 3RJPA 1HBXG 3DKWA 3CUQB 1T38A 4BYYA 2R3SA 3KE2A 3KCCA 1P92A 1S8NA 2HEOA 5CJ9A 3KP7A 4ZH4F 4EJTA 1ZAOA 2GXGA 1USTA 1G6NA 4A6DA 3L7WA 4HLYA 3SXYA 1G3TA
chains in the Genus database with same CATH superfamily
3HHGA 2FBIA 3RZOJ 3J80Z 4E7KA 1O3TA 5F1RA 3ZR8X 4CGZA 3FXOA 4EVIA 2XF6A 2XF7A 5HNFA 2IVMA 2JUCA 4CDGA 1AU7A 4RGXA 2GLOA 3COAC 2QGUA 2O5RA 1BN5A 5J8FA 3JAMK 2STWA 3DLAA 4BE0A 2WAQN 1XB4A 4BE1A 1VFCA 4XN0A 5GAEJ 5FKKA 4XLHA 2RN7A 3GUDA 1JGSA 1PVEA 1U8RA 5KVRA 4ITVA 3OYLA 1CQTA 1XX5A 3S14J 1XDUA 2JPBA 1TT5B 3K0LA 2P81A 4Y4RA 4DQ2A 3A0HC 1WGXA 2P6SA 2VBYA 4ZYEA 3ZMVA 2R7SA 2DPDA 2HZDA 1XN7A 1QPIA 5DDGA 1FWZA 3DF8A 1VQNI 4KN4X 1XGOA 2NVUB 3ISPA 4HNUA 2EFWA 5IYDJ 1BW6A 2Y2ZA 1SAUA 2MH9A 3CQZJ 5LHHA 5HLGA 2A07F 4UV9A 2LP0A 1ACIA 4E70A 3Q0VA 2K02A 3BT9A 5B1AH 2HTJA 4A3FJ 2VQLA 2VLAA 3VPRA 5GPCA 3W6KB 4DGWB 1LVAA 2G9WA 2RREA 5F04A 4RB3C 3HRMA 1LPQA 2CUEA 1VF9A 2X6OA 2M8EA 3LA3A 5EJCA 1NH3A 1NK2P 4BY1J 1U5TC 3TDZC 2QBYB 2JA8J 2PI0A 2VXDA 4IQJA 2F6CA 4JX4A 1W36D 4KYWA 4NHJA 5J47A 3K4NA 3LSRA 2VJIA 2COBA 4I09A 4EGZA 1PJRA 3HJEA 3QU6A 4AWXB 4YG2F 1R71A 2L4AA 3GTQJ 4M73A 3ABKH 5E3MA 2JMWA 2Z3YA 4U0WA 4D9JA 3O2PE 1MNEA 5KHDA 4JYKA 1VQ9I 5EG0A 2M1BA 3BR1A 1ETYA 1OR7C 2VKEA 5K1YA 4M6XA 2JA5J 3LSKA 3LFUA 1B59A 3U2RA 3R61A 4KISA 4PK4A 2M3AA 3HUGB 5LGTA 1YYVA 3QWLA 2DDAA 5D8LB 1ZH5A 1WRJA 3K4CA 1X4PA 3I4PA 1WH5A 1Q1HA 1H0MA 3GF2A 1I6XA 3MKWB 5BNGA 2F2EA 2XAUA 3L09A 4WXHA 4PJJA 1V4RA 5DUIA 2E1MC 4RB2C 1IC8A 2O8KA 3MKZA 5JFRA 2NRAC 2X6WA 1BIBA 4B3XA 3KYDB 4F52A 1O7LA 4Z6YA 3S16J 2ZJRF 2VUMJ 3RDIA 2FJ1A 4FTHA 2ESNA 5FKNA 2JT1A 1QVTA 2CV1A 4Z2YA 1XTAA 1UG0A 3I4MJ 2MD0A 3FXKA 2VE9A 1Z05A 3FM3A 1R1UA 3UKGA 4G94A 3FF5A 2WWYA 1BI2A 1H9GA 4AYBA 3CTAA 1DPUA 2DMQA 2XPWA 3RQIA 1H89C 4AIHA 2ZXJA 1IG7A 3WU2C 5CVRA 3S93A 2COMA 2RQQA 3PSFA 3I0TA 2RNGA 5CKTA 2LKXA 3I55I 5CVUA 1X4OA 2W1OA 1W7PB 3IAS2 2X0LA 3TGNA 5HDKA 1WSUA 4OINF 1HW2A 3CF2A 2ZO4A 1WHUA 2DT6A 1RESA 5BMZA 1K78A 1XC5A 3K4JA 3G1OA 5CQEA 2FD5A 2H6CA 5B1BH 1LE8A 5CQGA 3UNGC 4CXFA 1MIJA 1V5FA 2ZXWH 1HA8A 4DBQA 2YSRA 4FISA 1MBJA 2ADUA 1FT9A 5DYMA 2LOOA 2NXNB 2DLLA 3DEEA 5E3OA 2OOIA 3PUFA 1AA7A 4BGDA 4C2TA 3BDDA 1YTYA 4DYCA 1NTCA 2FBKA 1FIPA 3GBGA 1V55H 2UUZA 2PKHA 2P7CB 1JKOC 1R4NB 1MMAA 3ABUA 2KP6A 2Y30A 3S8PA 1VQ8I 2IPQX 2Y69H 3E7LA 1PP7U 5IT9Z 2OD5A 3DQVC 1B4AA 3F72A 2UXNA 4OAZA 3OYKA 3CNVA 4MIMA 4RA2A 4KMFA 2LREA 2L3DA 4F91B 3DEWA 2M4KA 3M07A 3BR0A 1U78A 4YRVA 3I58A 4YEJA 1UJ8A 3FM5A 2IW5A 3G71I 3W2AA 5ICCA 3J81Z 2DW4A 2UXXA 2XSDC 3J7AO 2FA1A 2WY7Q 5LGUA 4EM1A 2YS9A 4EMSA 3D1NI 5E8IA 1MNMC 1RKTA 4FX0A 3JTGA 2EV6A 2M87A 2K9LA 1VQ4I 1EH8A 4A3GJ 5JLWA 1U3EM 1ZRFA 3G4SI 1X1DA 1IXCA 1PP8F 4LG0B 1ZG3A 2VKDA 3B6AA 3TO6A 1TC3C 4HSRA 4OIRF 1KU7A 1IUYA 1R23A 2IGMA 5D6FA 4QIWN 1YIOA 5DCMB 3H92A 3CCJI 2HDCA 1K61A 3EUHC 4ANJA 1MW7A 4M6YA 3UR3C 1XMXA 2DTRA 2K7LA 3R0JA 3ZMTA 4IX7A 3KP4A 3F21A 2O3FA 4YFNF 5IYBJ 2L4MA 4UUSA 4BJ5C 2D2WA 4IOAF 4L5EA 3DP7A 1OCRH 2VQGA 2ZMEA 2ZKZA 1STZA 1AOYA 1R6RA 1UHWA 2VASA 3ECOA 3GMEA 1MBGA 3OYAA 1SD7A 2HDWA 2GIZA 1VQPI 2L9VA 2L9RA 4IZZA 4B48A 4G7ZF 1L3LA 2DOAA 1FTZA 2VJ5A 3BR6A 1FBUA 2CW8A 4ESFA 2OAZA 2PG4A 3E6MA 2BHZA 1TTYA 4IHXA 2DFIA 1REPC 3AG3H 3H0DA 3GTMJ 3P5JA 4I0AA 1EJ9A 3CCSI 1OR7A 2W00A 4I01A 3BROA 3LSIA 1D5YA 3FXQA 3VFZA 1XDSA 3MKLA 3PIPF 1XPXA 4IKFA 3BC8A 2GAUA 1OPCA 1I27A 2G0EA 1NK3P 5FLXZ 2M7BA 2PMUA 5D4RA 2LC2A 1F1ZA 1W7PD 3CUQA 4HW0A 3T0YA 4C3JJ 2CUJA 2CG4A 5ILVA 1Z1DA 1JI8A 3H5NA 2K3FA 3OYJA 3N97A 3HBLA 3Q0WA 2NWIA 4IF4A 5FD5A 4PFOA 3K4KA 1PUEE 3CDHA 3MQ0A 3HRUA 2ZCWA 4LK1F 1GHCA 3BZCA 4XORA 1O57A 3MVPA 4XLCA 3LOCA 2CWEA 3WTYC 2BVMA 3CP2A 3BG5A 1O4XA 2DMTA 3BTIA 3ZQFA 3PO2J 2STTA 3JRGA 1IW7F 1IJWC 5FKMA 2RKHA 2E71A 2BYVE 3WTWC 4QPQA 5L3DA 2HQAA 4WWCA 2ZJPF 2HS5A 3CESA 2XAHA 1UHMA 4G12A 3H0GJ 2RDPA 1MH3A 2VQHA 4CCLA 2FQ3A 3QPLA 1PUFB 2PBIA 1QO0D 2OTJI 2E36A 1T95A 1WWXA 2KPMA 3K1PA 4YIFA 3MN2A 2LDUA 4OMZA 2G7UA 2L7ZA 2FNPA 1ZGWA 1VNDA 4OOIA 3FMQA 1RR8C 3ZQQA 2CS3A 1T08B 3K1MA 4IL6C 4M74A 3ML6A 2D1HA 3L9FA 2MFZA 3F6VA 4RB0A 4D7MA 3WU0A 4MO7A 3FK7A 1B8IB 2IJLA 5FO5A 3J81K 4I7HA 2K3PA 1LDJA 2A68F 1PYVA 2A6TA 1XG1A 3SYTA 1VQ6I 5JR3A 1J0RA 2B0LA 4BEHB 2HFHA 2XPVA 2NYXA 1R5HA 2M30A 3RKYA 2G7HA 2V1DA 3L2QA 5BPIA 1TZLA 1QQIA 4RGSA 1XS9A 3I9V2 3VYUB 1Z3YA 1AHDP 1ZLJA 3P9CA 5LHGA 1VQLI 2JA7J 1FSEA 5J6XA 5KNLA 2ZNZA 5FGMA 1A35A 5E1WA 3BG6A 4WX9A 2IA2A 5EDNA 1X3WB 4PFPA 5GTIC 1USSA 4GRIA 3HOZJ 3DBRB 2W7NA 1MSEC 2LLKA 3W6JB 3CC7I 1X2NA 4DNCA 2QBYA 2KRHA 3FKIJ 4LD5A 2M9HA 4KDPA 2XROA 1FBQA 3J7AY 1J2XA 4A5NA 1RI7A 3DTEA 4HF0A 4Y15A 3HG9A 3BWGA 4NB5A 5CYVA 4EATA 2HVSA 2AXLA 3TKYA 2MYSA 3OOUA 4PSWA 2X1EA 2FUG2 4QSHA 3CJTB 3GYHX 2W48A 5E18F 2A69F 2K9SA 3WE2A 3FXMA 2ESHA 2M2EA 1XD7A 2Q0OA 3VYSB 4A2UA 4S04A 3OYEA 4R1HA 2XC7A 3I3LA 5HS7A 1K6YA 5DEQA 1ZR4A 1PDNC 1XMKA 3FIWA 5LLQA 2KMUA 3DLLF 4D7NA 3JAMZ 3HUGA 1IZ1A 4DYRA 4FX4A 3ERED 1I6HJ 5DD4A 1DUXC 2DQRA 5D5VB 1H9TA 2IGKA 4II2A 2P5LC 4XKWA 2R7QA 1WJCA 4RLFA 1V3FA 2VT2A 1ZG5A 2LY9A 3ZP5A 1G3SA 4U88A 1Y39A 1MMNA 1GV2A 2AS5F 3K69A 3RIRA 5FLXK 2I8DA 2F48A 1GXPA 2K9NA 2VC1A 2VKVA 1WZ2A 3ELKA 2JUGA 1Y0UA 2JTVA 4M72A 2P19A 5E8GA 4BL0B 2V1XA 2KJCA 3SFZA 2LF8A 1BR1A 4UUVA 3C2HA 3NQOA 2MD5A 4W1UA 4CUGA 5E17F 4NNJA 1J75A 1ZARA 4AVPA 4RGUA 3H1CA 4LITA 2KKOA 1OCTC 3WTUC 4F3QA 1FOKA 3FWEA 2CQXA 1JT0A 3Q9SA 1IN8A 5IOZA 3HOWJ 1UCRA 4KUMA 4RMNA 2CUFA 1JTYA 3OMYA 3P7NA 1SMYF 2IEKA 3KIOA 3WG9A 1A36A 2BY1A 2YX7A 5GP9A 2K85A 2VPLA 2XB0X 3C7JA 1W7PA 3IUOA 3CJQB 3I71A 2C6YA 3ZPLA 3PO3J 2L7MP 2FRHA 3I53A 1MDMB 2ETHA 1ETOA 2IS1A 1TWAJ 1FOWA 1U5TB 2V9PA 3JTHA 5E1ZB 2EH3A 1FEXA 3V8JA 3TW7A 1YQAA 3ZGKA 1KU9A 4DZPA 2FOKA 1D0ZA 1RKWA 2YPRA 2EV5A 1TBXA 3PNVA 5CVIA 2LKSA 2P5VA 4HX8A 1IXSB 4P9FA 3BJOA 4PJ0C 2Q2EB 4XRSG 4ABZA 1DPRA 2BXZA 4L5JA 1BW5A 2LSOA 1IDYA 3H35A 2QEXI 2NS8A 1WCMJ 1B9NA 2KQRA 3S32A 1G8XA 3HRSA 1R9TJ 2HQRA 4EV0A 2JZYA 1R22A 1TWCJ 4Y13A 1ETKA 2M34A 3GX4X 2HTSA 5B5EC 4LFUA 4RAZA 5DM7F 3G1LA 3H9QA 1JJ8C 2ID3A 4IRIA 1P9QC 2LH9A 3M8EA 2DU9A 1R00A 2FF4A 3QP5A 1GLNA 1FMVA 1ZR2A 3BJAA 2VOOA 4IPAA 4ESJA 2D1VA 2MA3A 3VSKA 2E1MB 3MD2A 2OQRA 5KAFC 2K86A 1AKHB 4M71A 2LMDA 4V2GA 2DJNA 2E34A 1O3QA 5C44J 4E6KG 3TP3A 1Z21A 3CDIA 4CSWA 1J09A 1IXRC 4HA8A 1Q1VA 1IN7A 1FYMA 4XM3A 4LJZF 4M9ZA 2JSPA 3K4BA 2RV8A 2XKPA 2X9DA 4A3LJ 3ZOBA 5KK1A 3F8BA 3U9GA 5EEHA 2WA0A 2PMZN 1Z0XA 1ZELA 2KRFA 1LNWA 5IP6A 4LG0A 1QZZA 3S1MJ 2LG4A 4CH7A 4Y17A 3HB9A 5FKOA 5HDGA 1HCRA 5DCMA 4AYBN 2R7UA 1TW2A 2JK3A 5ERIA 1ZQ3P 5AIPA 2IGNA 2IGOA 4G9YA 4P5OA 3A4CA 3LQQA 2DT7B 4R8HA 2VOPA 1MD0A 3SDBA 3RKWA 1YITI 1KQ0A 5H6RA 3I54A 4MTDA 2X51A 2CW0F 3TMOA 1MNDA 3O3KA 3S3OA 3S17J 3RZDJ 4EQQA 2O0YA 2DK8A 2ZBKA 2MGQA 4H4KC 4NQWB 3O8GA 4PZJA 4GXOA 2ZXIA 4AIDA 1VQMI 3RYRA 2W57A 3L5ZA 4EJOA 4ZZDA 3PUBA 2XGXA 3G3ZA 5ICFA 3ASNH 1VQ5I 1Z7LA 3I59B 4CCMA 3GFJA 1IV6A 3OIQA 1ZRDA 2R7XA 2ZB9A 2EFOA 2QKLB 3MEXA 3L2RA 2LKPA 3QPSA 3RPUD 3K4LA 4G7OF 2L9SA 4S05A 1XLRA 1F4KA 2GIVA 1Y0NA 4HEA2 3I56I 4FQGA 3FDYA 5GPAA 1HC8A 2DOEA 2OZ6A 4GYIA 1A6QA 3DU6A 1ORKA 1RIOH 3AAFA 2YUSA 4KT6A 4U87A 3RPQA 4E4HA 4BJ6C 2X6YA 4CCJA 2R7FA 3IRQA 1JKRC 4IJAA 2Y48A 5HS9A 5L3CA 2LD5A 3HSRA 4XLAA 5FRMA 2QUFA 2KL4A 2MC4A 1KQ8A 1S3JA 3S1QJ 5JI6A 3KEYA 3QOEA 4UY8I 4PSXA 5DUKA 1GVJA 3F8LA 1FP1D 2K4BA 3C1DA 4G6TB 4ZC3A 4BE2A 1YE9A 1K6OA 3KFWX 3PIOF 3DV8A 2A05A 1RNLA 2WY8Q 4NC8A 3GTJJ 1YJWI 1BA5A 4XLNF 1I5ZA 4GYGA 2XF5A 3VYRB 3EDPA 2Q8KA 2F5DA 2TCTA 3OV8A 1Y56A 1D3YA 3JCUC 4LK0F 4EJUA 2HI3A 1GXQA 1MBKA 1N77A 4ENJA 6PAXA 3PFIA 3E97A 1XMAA 2F5FA 1X2MA 4DYQA 4DIQA 2KZGA 3B02A 2M45A 4XR6A 3M7GA 3IRRA 1K7AA 2R7TA 1PUFA 3DPUA 5M5WJ 2E1OA 1MJ9A 5F0FA 1VQKI 1IAWA 4OU0A 4BDZA 4A3MJ 3QP6A 4I76A 3LNQA 2OPTA 2PMZA 1WVRA 2QQ8A 4ASNA 1ZRCA 3G1MA 3FXUA 1Y1VJ 2EIKH 3GZ5A 4IRHA 2F5CA 1BBYA 2PJRB 4FCYA 1B8IA 2CQ7A 1V5GA 1TNSA 1TW3A 1ETXA 2OV7A 1BI0A 3JRCA 5JVGF 5DTDA 4E7SA 4G6DA 4B47A 4M3FA 4OIPF 1T6SA 1S7OA 5F08A 1KZHA 4BEHA 4AC0A 4LGWA 2HQNA 2TDXA 5IPAA 1P6RA 4LB5A 2ZFUA 4Y33A 3KLOA 2VE8A 1BIAA 2CV0A 2OU2A 3WTVC 4DJAA 1I3AA 3GCMA 2LY2A 3VB2A 1ZHFA 2ZNYA 5EF6A 1QZYA 4I98B 2MW8A 1D0XA 5F64A 2B7EA 4IQ4A 4BKXA 5EEGA 1P2FA 2HOAA 2D45A 1ERDA 1BI1A 1C0WA 4KFCA 4KN7X 5LFAA 1HF0A 2IS4A 2LF7A 2OCEA 1IV8A 2XUBA 1X1AA 3Q3SA 5C4XJ 4L18B 2BOLA 3ABLH 4MFDA 5F1JA 3BQYA 5LGNA 2CV2A 3FHZA 4PCQA 5CVVA 4HPQA 1POGA 4EGYA 1UB9A 5F6FA 2L2OA 5FD6A 1SD6A 2WTEA 3AKZA 1QA6A 3BTCA 1T56A 4Q4ZF 5H2FC 3GLLA 3BG3A 4ZTJA 2AQEA 3SQNA 2DN0A 4HDUA 3OIOA 2DFFA 3RKQA 1T8IA 1YJ9I 3ZQGA 2EINH 4U0VA 5M3FJ 1JJ6C 3CC4I 3R4KA 2XAFA 1FX7A 2Y0SA 4A5MA 3EUAA 4FT8A 3W2VA 3MZHA 1R4MB 2L5QA 2R4GA 1D1CA 5DM6F 3NWSA 1IF1A 3E6BA 2FOWA 4BS9A 3I64A 2CFOA 4P1WA 1GVDA 1HW5A 1HXDA 5C3EJ 4EJWA 1FTTA 2JVGA 2R92J 4MHGA 2ECCA 3ZXSA 5A2QK 2DTZA 4N4NB 1IGNA 1W0TA 1N75A 3GXOA 2EQRA 4Q5SF 1BC8C 2JJ7A 2OCCH 3IH3A 2P7VB 1EA3A 2HZTA 1Z3XA 3P9IA 3KYCB 2VN2A 2H8WA 4A3JJ 3RPUA 4KIFA 3IHUA 2VBXA 3CUOA 1IN6A 1X1CA 2MLKA 4MNUA 1SMTA 5IP9J 3M4OJ 2A6EF 2Z16A 4ZTFA 4IVNA 1P4WA 1YG2A 3KP2A 4I6ZA 3CCRI 1OYWA 3HPGA 1X3UA 4HBLA 2F4OB 3GW2A 2LTPA 1I1SA 3EYYA 1MBFA 1OFCX 2EFNA 1IRZA 5D5UB 4L9TA 1TT8A 2NOJB 3OYBA 1D1BA 1YI2I 2DJIA 2VQCA 2DA4A 2XGDA 1IN5A 3DPTA 3JR9A 1JD3A 4LMYA 1MDMA 4IHVA 1E0EA 2DDBA 3LSTA 3SEZA 1U5TA 2AO9A 3AFHA 4PUSA 2GA2A 4D1QA 1G1BA 5TISC 3LHEA 2LY1A 2LNBA 2UWMA 3L2CA 1FIAA 2L9NA 2Q2EA 4Q47A 3JRIA 2F5EA 5L3BA 1QGPA 1F36A 4PGGA 1EH6A 2M0MA 2DO7A 2CUZA 3A0BC 4ZSIA 3ZCOA 3WGGA 1W5TA 1B1BA 3L2UA 3LA7A 5FRNA 3D5RC 3V7RA 3GTGJ 2OF7A 1OYYA 3WGHA 1RUOA 3CCEI 2PMHA 1B9MA 2E7XA 2A61A 4E7LA 2H8RA 1BJZA 1JHFA 2BY2A 2DA5A 1X19A 2MABA 1BC7C 3HOVJ 3HM5A 1P4XA 2RVCA 4Y7NJ 1OJLA 5J8CA 3HFIA 3M1CA 1YRNB 3GEZA 1KU3A 5AIQA 3FXJA 3DEUA 4J00A 1T98A 2ZJQF 5LRSA 2A5WA 3IL2A 4PJLA 1AKHA 1RETA 3I5UA 3F8CA 2XGEA 3BG9A 3X2QH 3E5QA 1GDTA 3V8KA 4NC6A 1G3WA 3CDLA 5HOOA 4E7JA 2E60A 1LQ1A 4G8XA 3H3UA 1HOMA 3BTLA 3MZ8A 4XKBA 1TWGJ 4DOZA 3NRVA 3DDVA 5H6QA 2Z2SB 3QPHA 3CCQI 2HKOA 1SVLA 2FQ4A 4L5IA 3VOEA 2WAFA 2DA1A 5D8KB 1J9IA 3BZKA 5K7ZA 3BY6A 2RQPA 3OSGA 1VQOI 2FX0A 5EEAA 3OWTA 2X4HA 4HLXA 2PJPA 1DQUA 4N9HA 3L2VA 4ZYHA 5D5WB 3JREA 3A2KA 3SDGA 3SEQA 3ZQHA 4PDKA 4HV6A 3OY9A 1TL8A 1IRXA 3EUKL 4XNFA 3BR3A 2E19A 1WFXA 1WI3A 2QQ9A 3R6SA 2Y75A 1KU2A 1WKMA 2FEZA 2BVLA 5HDNA 1O3SA 3TW6A 3HGYA 4NQWA 5E3NA 5EGOB 3QRFF 2VBWA 3EETA 2L54A 3DU5A 4LIUA 3RSNA 1ENHA 4IOCF 2GQQA 1O3RA 1FP2A 4NC7A 4W97A 3B6CA 4U7BA 2E5ZA 3FMRA 5IYCJ 4BAYA 3DCFA 5LRRA 2BGCA 2KIQA 3I59A 2M7AA 3BTJA 2M8GX 2F4IA 1MBEA 4P55A 3BCAA 4XIDA 1ETWA 4B4CA 4XMYA 4B43A 2L01A 4BHPA 2XGCA 4GCVA 2O8XA 1IUFA 2VBZA 1LUJB 2EZHA 2JA6J 1JE8A 2R5ZB 3CCYA 3GTPJ 1D1AA 3ABTA 4DBRA 4HG2A 4YFKF 3RTRA 3CMEI 1O7FA 4AVZA 2HDDA 4XRSA 3WGIA 2OGGA 2QYOA 3OR2C 2E1CA 3GFIA 4M3DA 1H8AC 1KONA 2HU9A 3B73A 2QSGX 3D0SA 3QPTA 1U2WA 3FBIB 1LFPA 3KEOA 1SD4A 1Z6TA 3T1BA 3HZJA 3OYMA 2EB7A 1ITYA 1OYIA 1MJBA 2QM3A 3PFYA 1G2HA 4ZYDA 3GZ6A 1ON2A 3T8TA 3S3MA 4A3KJ 2HYGD 1S29A 2JRMA 5HNHA 2OQGA 1SANA 4JQFA 1NG6A 4M6VA 1DDNA 3BJ6A 2H1LA 3R0AA 4G7HF 2B9SA 1R7JA 4UB6C 4C3IJ 3BR2A 2UV1A 2M4GA 3E5XA 4B3AA 2Z99A 4B8XA 1YS6A 3ZMSA 4XSZF 3V42A 2E35A 3VWBA 1XGNA 2K27A 2HYJA 3U1DA 1N78A 4U7DA 1OCOH 3BPXA 4J01A 1G4DA 3GLXA 2QSHX 1ZTRA 4ZYGA 1JT6A 4EM2A 4BUPA 3KP6A 2VJJA 1Y8RB 3CCLI 1SC7A 3K10A 3HHHA 1TQMA 4AU7A 3BP8A 3HOUJ 2BZTA 4XQFA 2BHYA 5J1YA 3L2WA 1WJAA 2V79A 5J3LA 4E7HA 4MGRA 3FBNB 2EWNA 1MJAA 3RCOA 1UMQA 4WCGA 4EEFG 3KLNA 4I2OA 4YFXF 3EUHA 2ELKA 5KAIC 1DU6A 2GXAA 2QKMB 2ZSHB 2NVTJ 1K83J 1IRFA 4KICA 4J19A 3AL0C 4RM2A 1MKMA 2IRFG 3OOPA 5K7HA 1CGPA 4OIQF 1LFUP 4MEXF 1UG2A 2KJBA 1P7IA 3F8MA 5TGTA 2HVRA 1D8JA 3M8JA 3IWZA 2PJRA 3IH4A 2PQ8A 3DTKA 3ESWB 1YX5A 3OL3A 3GTLJ 2X1DA 1U9OA 4XLFA 4X0GA 1TLHB 1Z77A 3CP8A 2E2IJ 2WB1A 4KJZA 3N4MA 2R7RA 3CZ6A 4KIBA 2JN6A 4S0HB 5K5RA 2NNYA 3BCBA 1Z9CA 5IY5H 4AIKA 3O8HA 1LJ9A 3KP3A 1JGGA 1FLIA 4L0ZB 4MTEA 4UVCA 5DD8A 2QQBA 1YOVB 2Y9ZA 5K5QA 2K4JA 2LBFB 1FMWA 2D5VA 2MH2A 1FY7A 3HYIA 2XKOA 1I3QJ 3HC7A 2XV4S 2IXSA 2CW7A 3DBHB 2DI3A 1I1GA 3DKYA 2Z1DA 1GV5A 3A03A 3H36A 2DFEA 4O5VA 1OISA 4F7ZA 1DP7P 4HX4A 4I02A 3PJRA 3TOBA 3HKZA 2VXZA 4HX7A 5D6EA 2ELJA 1FNNA 4XONA 4II3A 3V8LA 2O6GE 3A01B 5EZGA 3I4NJ 5DS9A 4MLOA 2DMNA 4PGHA 4XICA 3LWFA 1WI9A 1X1PA 2L7FP 5GADJ 2OZUA 3GFLA 5F0CA 4UB8C 4GFBA 2BV6A 2X6XA 2FMLA 2VC0A 4OWRB 1WJ5A 3F8NA 2MSYA 2K9MA 2LRDA 4BDYA 1Z67A 3MMYB 2JPCA 2WADA 1KGSA 5GAHJ 1BR2A 2LK2A 2V9VA 3BR5A 2H6BA 2RAEA 2HOEA 4IRGA 4ENNA 1YJNI 4L0YB 1R58A 2CQQA 2CO5A 4JP0A 4I99C 1QNTA 2V7FA 2R93J 2XRLA 2CSOA 3JSOA 1ZLKA 2JA2A 2ISYA 2OUMA 1JUMA 1BOBA 1WPKA 3TOAA 1HW1A 3WTSC 4JK1X 1GUUA 3KZZA 2DQLA 3OYHA 3ECHA 3J7ZI 2MLGA 1QVUA 1XSVA 2A3SA 4RM3A 2HPMA 3RYPA 3WU1B 3OR1C 1V5EA 3SFIA 3F22A 2N8GA 3S2WA 4PJNA 2NAZA 2XPUA 5BQTA 2QWWA 2HR3A 3HOTA 2PLYA 1XCBA 4IEJA 1SFKA 4BJTA 4D5CA 4AM3A 3S15J 2M5WA 1F9NA 1FOYA 1A6IA 1W1WE 2L02A 3C18A 1WJDA 2ZJ2A 4QPOA 1EV7A 2KLOA 5DV5A 2P6TA 4A69C 2O9LA 1LDDA 3ONQA 5CLSA 1YW7A 5FFXA 1I39A 1ODDA 3CMMA 3K7AJ 4CA0A 1G59A 2W24A 2CYYA 4RS8A 2ZXHA 2FA5A 2MG4A 3ZMDA 3JRAA 4KA4A 1T33A 4Q48A 4RGRA 4GDFA 3BZ6A 2I5UA 3A02A 4CCOA 1SFUA 4JX6A 4XSXF 2MC3A 2I10A 3HL2A 2NOGA 1AWCA 2LR8A 4CCNA 2QENA 1VTNC 2XB5A 2W82A 2BE5F 1FW9A 2DT5A 1TWHJ 1W4MA 1XCVA 2EA4A 3KZYA 3ZQIA 5HS8A 5KCMA 1QU3A 5L3GA 2R5YB 3C2BA 4F55A 3IC7A 1G3YA 2GOMA 1E3OC 3K9TA 5M5YJ 2P8TA 2IA0A 1ETQA 1CF7B 2PFBA 1EF4A 2X1CA 1ONVA 4X1EA 2A6HF 5TRDA 2V6CA 1X1BA 1FC3A 4FE4A 3ZN1A 1S9HA 3Q9VA 3TL4X 2KZVA 3LSGA 2E1NA 4UVBA 3VDXA 2DCEA 3WTXC 4BHBA 4XN3A 5M3MJ 2ISZA 1KQ9A 5ICGA 4L9NA 4RAFA 2A5YB 2FE3A 3H9GA 4KNYA 1SFXA 2DA6A 2GBYA 1XSXA 3KETA 1WQ2A 4M3EA 2H1KA 3AG4H 2XSJC 2Z9OA 1BM9A 1FBSA 2VIXA 2AHCA 3CO6C 2KIFA 5HLIA 3J7YJ 2WAEA 4CHUA 3SHFA 3GFMA 3GO5A 3WG7H 1WJFA 4B44A 1LKXA 4BU2A 4HZFA 3PL8A 5L3FA 1MH4A 1BI3A 5ED4A 1YRNA 4G6QA 4DZJA 5A2QZ 1W36C 5D5XB 1Z7UA 4HYEA 3BOQA 4CICA 3KYLA 4IHYA 2V4JC 2M0CA 5LEJA 2ACJA 3QU3A 5HLTA 4ENMA 2IBDA 2EBIA 4LG3A 4GGGA 3F8FA 3D5SC 4ZDLA 4FETA 4LB6B 3HSEA 2EA2A 2Y0SN 2ZMEC 3CCMI 3LSMA 1T0FC 2HYFA 1XGMA 3T5XA 3ZMZA 5IP7J 4A3IJ 3E3VA 2E5NA 4YIRX 4MQVA 1MBHA 3M1EA 4XKCA 4UNOA 3SJMA 2W85A 3OYIA 1U0JA 1SFEA 3LMMA 3O6BB 1QHHD 2HXOA 4KITB 2IAIA 3CC2I 4JOMA 2UZKA 1M1EB 2CJJA 3ZQCA 1YO5C 2CMPA 1E2XA 2DYSH 1OQYA 2GWRA 2EZKA 5E1XA 9ANTA 4ZZLA 2DBBA 5LEKA 2H09A 4XRMA 5F0HA 3CO7C 5LHIA 1LFBA 2HGCA 1VQ7I 1L0OC 2KT0A 3HEFA 3R60A 1H88C 2XVCA 1B72B 3MKYB 2VJ4A 4IO9F 2BXYA 3IKVA 3WHCA 2RA5A 1HKTA 3H9JA 2K9QA 1FYLA 1WJBA 4LLNA 1A04A 3FZVA 3Q0UA 1TQIA 5C4JJ 1OLTA 2CFXA 4YELA 2DMUA 1Y8QB 3CUQC 4BQQA 4EJVA 3SZPA 1Y6IA 4FHTA 3TEDA 4P9UA 2CU7A 2ID6A 1SAXA 2VPRA 3HOSA 5EGOA 1HLVA 3JSPA 1E3HA 1D8KA 2L0KA 2ME0A 2DYRH 3E5UA 1U6GA 4O3MA 2DAOA 2P0WA 1N25A 2DOFA 2EJRA 1U8BA 2DA2A 3VSLA 3PNTA 4A0ZA 1S6LA 2XAGA 2VI6A 2HKXA 3K70C 3IAM2 2E2HJ 3GZNB 3RKXA 4CYCB 3WODF 4BQOA 2HXIA 1JKPC 2WV1A 1XGSA 2WAQA 1YHQI 4OAYA 1S7AA 2DODA 3MWMA 2R5ZA 4D5FA 1R1VA 4DW6A 2MBFA 2KDOA 2V9KA 3K4MA 2ZFWA 2K40A 4IHTA 4F93B 1FPQA 4HNTA 1UZCA 1A5JA 3OYFA 3K70D 1EKEA 5F27A 1RUNA 3J80K 2EFQA 3IH2A 1YW9A 2F4MB 4BY7J 1ULYA 2OTLI 5J1RA 4ENKA 3KEQA 2HOSA 1OKRA 3PQKA 2VKHA 1P4AA 4CO8A 2K5CA 3NAUA 4N0BA 3OS0A 1R36A 1J7KA 5BPDA 3LAPA 5H20A 4BXXJ 3FKJA 2CQKA 4QWQA 3F9KA 3HTSB 4ZSBA 4HDVA 3S2HJ 3AG2H 5K7FA 2VODA 4UV8A 2OBPA 4RAGA 2HWVA 3AG1H 2VT3A 1LB2A 4RBOA 2XAQA 1FSHA 2VONA 1J5YA 1BR4A 1X3ZB 1LEBA 1S7EA 1NHAA 2WC2A 1WH7A 1Y1WJ 3GTKJ 4HQMA 2EV0A 4C9YA 1SVMA 2XRNA 3MZYA 4B1RA 4HSTA 3TP0A 3K2AA 4KIGA 2BW3B 2LYCA 3MFKA 3C3WA 1R5GA 2KHMA 5FROA 3K2ZA 1JUSA 3M9AA 4F92B 2Q1ZB 3LSJA 1I50J 1TT0A 2X85A 2HPIA 3CCUI 2QF7A 1R49A 1ZK8A 2EK5A 3V7SA 1G81A 1BL0A 2EFPA 3S1NJ 2EZIA 3FMSA 1FZPB 3U1KA 5J4YA 4Y3OA 5J1UA 3W2WA 1YLFA 3QYFA 5FKLA 1V54H 4BH9A 1VZ0A 3SZGA 1TNTA 2RNJA 5HODA 5FJ8J 2Y0MA 4XBFA 3HGGA 2QSFX 3GVAA 3F6OA 2X48A 3BPVA 2JRTA 4D0PA 3CD6I 2HVQA 3IV5A 2V6EA 1IDZA 5HVQC 1X58A 2ECBA 3T8RA 1RZ4A 1YFHA 2XDVA 3ZQLA 1ZN2A 4A0YA 5GTHC 1MSFC 2J5OA 3CF5F 4M3GA 3LAJA 3PQJA 3WE3A 2FU4A 3BQZA 1HSJA 4CYDA 4V19K 2H94A 1D5VA 1OCPA 4MQ9F 1R1TA 5E3LA 3KPHA 3HSFA 2LBFA 2O61A 5ILUA 3HOXJ 3OL4A 4L9JA 5CVJA 5FLVA 4C3HJ 5IT3A 4QTRA 2CQNA 1JKQC 4BBSJ 4V2FA 1S72I 2Y31A 4M9SA 4UHTA 3FHNA 2W4SA 1IN4A 4ZDOA 4A3CJ 3HTUA 2FXAA 3P9KA 2QZ8A 3OS1A 1LVKA 4C30A 4AIJA 1ZREA 2W84A 3CJNA 5J40A 4XLPF 4FE7A 4XL9A 3BLYA 2Z5UA 2E2JJ 4IHWA 3K6GA 4CZZA 2DMPA 1OCCH 3DFGA 3DPLC 3F3XA 3KP5A 4MEYF 5FB2A 1T39A 4IHSA 3KX2A 2AQFA 1A31A 1W5CC 4BXFA 4IXAA 4O6JA 4BNCA 1IRGA 3A01A 5DCFA 5FLMJ 1K4SA 1T0FA 4HV5A 4R79A 3ABMH 1VI0A 1MZBA 1YX3A 3JRHA 2BY3A 2QCOA 2FSWA 2ICWG 3IWFA 5EYRA 3KZIC 1UAAA 1HKQA 4Y52J 2GM4A 4OIOF 2JQ7A 2IT0A 2HQ5A 3HRTA 3OYGA 4L9VA 2FMYA 3RQ4A 3S1RJ 2AXTC 4A93J 3TQNA 2YR2A 1ON1A 3V4GA 3SZTA 3MCZA 2KRCA 5K5OA 5CPRB 1KYWA 4K2EA 3OYDA 2IS2A 2TRTA 4A3BJ 4LIVA 1RC9A 2KIUA 2W25A 1YS7A 4P96A 5EZHA 2E7WA 3MAJA 5AONA 5B66C 3ZN0A 1UHSA 4LLGF 2R7WA 2KFDA 2DFHA 3HXLA 4MFEA 4ETSA 3AL0B 2GZWA 1D0YA 3JRFA 5J4VA 1SFOJ 3S3NA 3D5LA 2Z33A 1KYZA 3DKXA 4U0YA 3BG7A 4BBRJ 4B09A 1UELB 1JTXA 4BHCA 4RB1A 3TDUC 2PX9A 4A12A 5EG0B 2ZC2A 3W3CA 1SD5A 4UXNA 3FXRA 2GA1A 4JBAA 2DPUA 2R7VA 2ZSIB 2BEOA 3V7CA 1W0UA 3H5AA 5IOYA 2WB1N 3TO7A 1F5TA 5BS6A 2DA3A 1FJLA 4WF2A 5GAGJ 5JHFA 4XK4A 2OJED 2R5YA 3ZQ7A 2JWTA 3F23A 3JRBA 5IT9K 3OIPA 4HAMA 2YX4A 1HQCA 2QA4I 1CF7A 2KIMA 2P5KA 2IA1A 2LFBA 2B63J 3HIFA 4GO1A 4ON0A 3CMYA 1ZYRF 4KT5C 3OSFA 3QODA 1HDPA 1IO2A 2WBMA 1BOAA 3FX3A 1MGTA 5D4SA 2VB6A 3G2BA 3EYIA 3QOPA 2QVOA 3HKZN 1DP3A 1J59A 3LA2A 2XHKA 3EPZA 2NS7A 4A0XA 5JHUA 2YU3A 4BXUA 4H0EA 1MMDA 3G73A 4BQAA 1ETVA 3L1PA 3U21A 2ME6A 3IP4B 3H5RA 3ZMUA 4E7ZA 2NNNA 4C2MJ 3ERMA 2PN6A 1RR7A 3LFKA 3CCVI 4ESBA 4M3BA 1K78B 2P4WA 4AUXA 2IP2A 2R0QC 1SVOA 4M9XA 1LE8B 3OYNA 2L7KA 4NBQA 5E79C 2BY0A 3DTIA 1ZGAA 3DBLB 1W5SA 2NVYJ 3EQLF 3NWTA 2AHQA 1DGRM 1EH7A 4TV7A 5E20A 4HF1A 3LQRA 4WXDA 4KMUX 3CLOA 1DU0A 1F43A 1E3PA 4JX5A 5ILSA 2EPFA 4HF2A 5L3EA 2OC6A 3G6EI 4A3EJ 3TO9A 1MMGA 3F0CA 3NARA 1B72A 2JSCA 4WK8F 1QPMA 1QRYA 3FISA 2V26A 4N9IA 3K1NA 1QZEA 2RC4A 3HOYJ 2EZLA 3WTZA 4A6EA 5B3SH 1SEUA 1APLC 1WJEA 2V1NA 4XOTA 3Q5FA 2FNAA 2RGVA 3E6DA 1QBJA 2R7ZJ 4NDLA 4HOBA 3WTTC 1KA8A 2QLZA 3FK6A 2CGPA 1U9NA 1P7JA 4QLCU 1RPWA 2EIMH 2Y9YA 4EM0B 4LOCA 1LDKB 3WHBA 3CJRB 4I0BA 4ZJZA 1NG7A 4ZYAA 2ELHA 1OMIA 3N05A 4LLLA 4BACA 2IKKA 4N4OB 2H27A 4RLQA 2NS0A 5LBQA 4UUTA 3GWZA 3PNYA 3PSIA 1TWFJ 3M3YJ 4CYCA 2WV0A 3A1YA 3LSPA 2KDZA 2LVSA 4WXCA 3E6CC 2O03A 1FYKA 3FXLA 1YIJI 1Z91A 1K79A 1B6AA 2F5VA 3TBIA 3JRDA 2O7OA 2CH0A 3L00A 2GXBA 3ROUA 4PJMA 3RI4A 3H3VK 5HLHA 3W6VA 2OA4A 3M8FA 4XKVA 2V1UA 1HSTA 3LL7A 1HDDC 2R7DA 4HRIA 1JHHA 4XRFA 3ZRGA 5BOXA 2NVQJ 1UFMA 4UVAA 5LD2C 2NVXJ 1ZKGA 1RRJA 2FBHA 2PEXA 3QYEA 2QQAA 3REOA 3LSHA 4UUSB 4X6AJ 4FASD 1TP4A 1DGWY 1E17A 1OCZH 4NUBA 1BJAA 3E0JB 3DWLE 1GT0C 1YW8A 4AD9A 3VEPA 4OMYA 2ZMEB 3ULQB 5JVTA 2R7OA 3OS2A 2GOXB 2BBYA 2XASA 3QQAA 3QYBA 2DXIA 3H3ZA 3DXJF 2XAJA 2DA7A 4HQEA 1TQPA 1JXSA 4CCKA 1K4TA 1XSDA 1T2KA 2CRGA 1FOXA 1QHGA 2J5PA 4XOPA 2HNHA 1Z6RA 2YU9J 4RAYA 5JLXA 2HOTA 3JW4A 3C2GA 3NEUA 5ICEA 2VL8A 2DK5A 4CZCA 4A3DJ 3QAHA 3VODA 4ZSKA 1ZGJA 2KISA 4C2UA 1R5ID 2EIJH 2BW3A 4ZDPA 3CLQA 1LEAA 2EILH 5TJJA 3PM1A 3IKTA 4RDUA 5FFZA 1HKSA 1MMSA 4BQNA 3HDDA 4YIIA 1ZG1A 4E7IA 3OYCA 2XIGA 2IS6A 3RJPA 1HBXG 3DKWA 3CUQB 1T38A 4BYYA 1JUPA 3HPHA 1S5LC 2JVHA 2R3SA 4HNVA 3KE2A 3KCCA 3GTOJ 3ASOH 4XLEA 1P92A 3E1SA 1S8NA 2HEOA 5CJ9A 3VYTB 3KP7A 4ZH4F 4EJTA 1ZAOA 2GXGA 1USTA 1G6NA 3S2DJ 3CMAI 4A6DA 3L7WA 5M5XJ 4HLYA 3SXYA 1G3TA
chains in the Genus database with same CATH topology
3HHGA 2FBIA 3J80Z 1O3TA 5F1RA 4CGZA 4EVIA 2IVMA 4CDGA 4RGXA 3COAC 1BN5A 5J8FA 3JAMK 2STWA 1XB4A 2RN7A 3GUDA 1JGSA 1U8RA 5KVRA 1XDUA 2JPBA 3K0LA 4DQ2A 2P6SA 2VBYA 4ZYEA 3ZMVA 2DPDA 1XN7A 5DDGA 1FWZA 3DF8A 4KN4X 1XGOA 3ISPA 2EFWA 2A07F 2MH9A 5LHHA 5HLGA 4UV9A 4E70A 2K02A 2HTJA 3W6KB 1LVAA 2G9WA 4RB3C 3HRMA 2M8EA 3LA3A 1U5TC 3TDZC 2QBYB 2PI0A 4KYWA 4NHJA 4I09A 4EGZA 3QU6A 4AWXB 4YG2F 2L4AA 4M73A 2Z3YA 4U0WA 3O2PE 2M1BA 5K1YA 4M6XA 3U2RA 1B59A 3R61A 5LGTA 1YYVA 5D8LB 1ZH5A 1WRJA 3I4PA 1Q1HA 1H0MA 3GF2A 1I6XA 2F2EA 3L09A 4WXHA 1V4RA 5DUIA 4RB2C 5JFRA 2NRAC 1BIBA 1O7LA 3RDIA 2ESNA 2JT1A 4Z2YA 2VE9A 1Z05A 3FM3A 1R1UA 2WWYA 4G94A 3FF5A 1BI2A 1H9GA 3CTAA 1DPUA 4AIHA 2ZXJA 5CVRA 2COMA 3I0TA 5CVUA 1W7PB 2X0LA 3TGNA 5HDKA 1WSUA 4OINF 1HW2A 2ZO4A 5BMZA 1K78A 2H6CA 4CXFA 2YSRA 2ADUA 1FT9A 5DYMA 2DLLA 2OOIA 3BDDA 1YTYA 2FBKA 2PKHA 2P7CB 3ABUA 2IPQX 1PP7U 5IT9Z 2OD5A 3DQVC 1B4AA 3F72A 2UXNA 3CNVA 4KMFA 2L3DA 1U78A 3I58A 3FM5A 2IW5A 5ICCA 3J81Z 2DW4A 2UXXA 3J7AO 2FA1A 5LGUA 4EM1A 4EMSA 5E8IA 4FX0A 3JTGA 2EV6A 2M87A 1EH8A 1U3EM 1ZRFA 1IXCA 1PP8F 4LG0B 1ZG3A 3TO6A 4OIRF 1KU7A 1IUYA 1R23A 5D6FA 1YIOA 5DCMB 3H92A 2HDCA 4M6YA 2K7LA 2DTRA 3R0JA 3ZMTA 3KP4A 3F21A 2O3FA 4YFNF 2L4MA 2D2WA 3DP7A 2ZMEA 2ZKZA 1STZA 1AOYA 1UHWA 3ECOA 1SD7A 4G7ZF 1L3LA 1FBUA 4ESFA 2OAZA 2PG4A 3E6MA 1TTYA 2DFIA 1REPC 4I0AA 1OR7A 4I01A 3BROA 3FXQA 3VFZA 1XDSA 2GAUA 1OPCA 1I27A 5FLXZ 2PMUA 5D4RA 1F1ZA 1W7PD 3CUQA 4HW0A 3T0YA 2CG4A 5ILVA 1Z1DA 3N97A 2NWIA 4IF4A 5FD5A 1PUEE 3CDHA 3MQ0A 3HRUA 2ZCWA 4LK1F 1GHCA 1O57A 2CWEA 3WTYC 2STTA 1IW7F 2RKHA 2BYVE 3WTWC 5L3DA 4WWCA 2HS5A 2XAHA 1UHMA 2RDPA 2FQ3A 2PBIA 1QO0D 3K1PA 1WWXA 4YIFA 2LDUA 4OMZA 2G7UA 2FNPA 4OOIA 3FMQA 3K1MA 4M74A 3ML6A 2D1HA 3L9FA 4RB0A 3F6VA 3WU0A 2IJLA 5FO5A 3J81K 4I7HA 1LDJA 2A68F 5JR3A 1J0RA 2B0LA 2HFHA 2NYXA 1R5HA 3RKYA 2M30A 2G7HA 2V1DA 5BPIA 1QQIA 4RGSA 1ZLJA 3P9CA 5LHGA 1FSEA 5J6XA 2ZNZA 5FGMA 5E1WA 4WX9A 2IA2A 1USSA 3W6JB 4DNCA 2QBYA 4KDPA 4LD5A 2XROA 1FBQA 1J2XA 4A5NA 1RI7A 4HF0A 4Y15A 3BWGA 4NB5A 5CYVA 2AXLA 3TKYA 3GYHX 5E18F 2A69F 3WE2A 2ESHA 1XD7A 2Q0OA 4S04A 4A2UA 4R1HA 5HS7A 5DEQA 1PDNC 1XMKA 5LLQA 3JAMZ 3HUGA 1IZ1A 4FX4A 3ERED 5DD4A 1DUXC 2DQRA 5D5VB 1H9TA 2P5LC 1V3FA 2VT2A 1ZG5A 3ZP5A 1G3SA 4U88A 2AS5F 3K69A 3RIRA 5FLXK 1GXPA 2VC1A 3ELKA 1Y0UA 2JTVA 4M72A 2P19A 5E8GA 2V1XA 2KJCA 3SFZA 2LF8A 4UUVA 3NQOA 2MD5A 5E17F 1J75A 1ZARA 4AVPA 4RGUA 2KKOA 3WTUC 1FOKA 3FWEA 3Q9SA 1IN8A 1UCRA 4KUMA 3P7NA 1SMYF 3WG9A 2YX7A 3C7JA 1W7PA 3I71A 2C6YA 3ZPLA 2FRHA 3I53A 1MDMB 2ETHA 1U5TB 3JTHA 5E1ZB 3V8JA 1YQAA 1KU9A 2FOKA 2YPRA 2EV5A 1TBXA 5CVIA 4HX8A 2P5VA 4P9FA 1IXSB 3BJOA 1DPRA 4L5JA 2LSOA 1B9NA 3HRSA 2HQRA 4EV0A 2JZYA 1R22A 4Y13A 3GX4X 2HTSA 4LFUA 4RAZA 4IRIA 3M8EA 2DU9A 1R00A 2FF4A 3QP5A 3BJAA 2VOOA 4IPAA 4ESJA 2D1VA 2MA3A 2OQRA 2K86A 4M71A 1O3QA 4HA8A 1IXRC 1IN7A 1FYMA 4LJZF 4M9ZA 2RV8A 2XKPA 5KK1A 3F8BA 3U9GA 5EEHA 2KRFA 1LNWA 4LG0A 1QZZA 4Y17A 5HDGA 5DCMA 1TW2A 5ERIA 5AIPA 4G9YA 4P5OA 3LQQA 4R8HA 2VOPA 1MD0A 3RKWA 1KQ0A 5H6RA 3I54A 4MTDA 2CW0F 3O3KA 4EQQA 2O0YA 2DK8A 2ZBKA 4PZJA 4GXOA 3RYRA 2W57A 3L5ZA 4EJOA 4ZZDA 2XGXA 3G3ZA 5ICFA 3I59B 3GFJA 1ZRDA 2EFOA 3MEXA 2LKPA 4G7OF 4S05A 1XLRA 1F4KA 2GIVA 2OZ6A 4GYIA 1RIOH 3AAFA 3RPQA 2R7FA 3IRQA 4IJAA 2Y48A 5HS9A 5L3CA 3HSRA 2QUFA 1KQ8A 1S3JA 5JI6A 5DUKA 1GVJA 3F8LA 1FP1D 2K4BA 3C1DA 1K6OA 3KFWX 3DV8A 1RNLA 4XLNF 1I5ZA 4GYGA 3EDPA 2Q8KA 2F5DA 3OV8A 1D3YA 4LK0F 4EJUA 6PAXA 1GXQA 4ENJA 3PFIA 3E97A 1XMAA 2F5FA 3B02A 2M45A 3IRRA 3M7GA 1K7AA 1MJ9A 1IAWA 4OU0A 3QP6A 4ASNA 1ZRCA 3FXUA 3GZ5A 4IRHA 2F5CA 1BBYA 1TNSA 1TW3A 1BI0A 4G6DA 4OIPF 1T6SA 1S7OA 4LGWA 2HQNA 2TDXA 1P6RA 4LB5A 3KLOA 2VE8A 1BIAA 2OU2A 3WTVC 3VB2A 1ZHFA 2ZNYA 1QZYA 4I98B 5F64A 5EEGA 1P2FA 2D45A 1BI1A 1C0WA 4KFCA 4KN7X 2LF7A 2XUBA 4L18B 5LGNA 3FHZA 4PCQA 5CVVA 4EGYA 1UB9A 5F6FA 5FD6A 1SD6A 2WTEA 4Q4ZF 3SQNA 4HDUA 4U0VA 3R4KA 2XAFA 1FX7A 4A5MA 4FT8A 3MZHA 1IF1A 3E6BA 3I64A 1HW5A 1HXDA 4EJWA 4MHGA 5A2QK 3GXOA 4Q5SF 1BC8C 2P7VB 2HZTA 3P9IA 2VN2A 3RPUA 4KIFA 3IHUA 2VBXA 3CUOA 1IN6A 2MLKA 4MNUA 1SMTA 2A6EF 4IVNA 1P4WA 1YG2A 3KP2A 1OYWA 1X3UA 4HBLA 3GW2A 1I1SA 3EYYA 2EFNA 5D5UB 4L9TA 1TT8A 1IN5A 3DPTA 1JD3A 4LMYA 1MDMA 3LSTA 1U5TA 2GA2A 1G1BA 3LHEA 2LNBA 2UWMA 3L2CA 2Q2EA 4Q47A 2F5EA 5L3BA 1QGPA 4PGGA 1EH6A 2DO7A 4ZSIA 3WGGA 1W5TA 1B1BA 3LA7A 3V7RA 1OYYA 3WGHA 1RUOA 2PMHA 1B9MA 2E7XA 2A61A 1JHFA 1BC7C 1P4XA 2RVCA 5J8CA 3HFIA 3GEZA 1KU3A 5AIQA 3DEUA 1T98A 5LRSA 3IL2A 3I5UA 3F8CA 3E5QA 3V8KA 1G3WA 5HOOA 1LQ1A 4G8XA 3H3UA 3DDVA 3NRVA 5H6QA 3QPHA 2HKOA 4L5IA 3VOEA 5D8KB 1J9IA 3BY6A 2RQPA 2X4HA 4HLXA 2PJPA 4N9HA 4ZYHA 5D5WB 4PDKA 4HV6A 2QQ9A 3R6SA 2Y75A 1KU2A 1WKMA 2FEZA 5HDNA 1O3SA 4NQWA 3QRFF 2VBWA 3EETA 2L54A 2GQQA 1O3RA 1FP2A 4U7BA 3FMRA 4BAYA 5LRRA 2BGCA 3I59A 4P55A 4BHPA 2L01A 4GCVA 2O8XA 2VBZA 1JE8A 3ABTA 4YFKF 3RTRA 1O7FA 3WGIA 2OGGA 2QYOA 2E1CA 3GFIA 3B73A 3D0SA 3QPTA 1U2WA 3KEOA 1SD4A 1Z6TA 3T1BA 2EB7A 1OYIA 1MJBA 2QM3A 4ZYDA 3GZ6A 1ON2A 3T8TA 2HYGD 1S29A 2OQGA 4JQFA 1DDNA 3BJ6A 3R0AA 4G7HF 1R7JA 3E5XA 2Z99A 4B8XA 1YS6A 3ZMSA 4XSZF 1XGNA 2K27A 3U1DA 4U7DA 3BPXA 1G4DA 3GLXA 4ZYGA 4EM2A 3KP6A 3HHHA 1TQMA 3BP8A 2V79A 4MGRA 2EWNA 1MJAA 4WCGA 3KLNA 4I2OA 4YFXF 3EUHA 1IRFA 4KICA 1MKMA 2IRFG 3OOPA 1CGPA 4OIQF 4MEXF 2KJBA 1D8JA 3F8MA 3IWZA 2PQ8A 1TLHB 3N4MA 4KIBA 5K5RA 2NNYA 1Z9CA 4AIKA 1LJ9A 3KP3A 1FLIA 4L0ZB 4MTEA 4UVCA 5DD8A 2QQBA 5K5QA 2K4JA 2MH2A 1FY7A 3HYIA 2XKOA 2XV4S 2DI3A 1I1GA 4O5VA 4F7ZA 1DP7P 4HX4A 4I02A 3TOBA 2VXZA 4HX7A 5D6EA 1FNNA 3V8LA 2O6GE 4PGHA 3LWFA 1WI9A 2OZUA 3GFLA 2BV6A 2FMLA 2VC0A 3F8NA 2JPCA 1KGSA 2V9VA 2H6BA 4ENNA 2HOEA 4IRGA 4L0YB 1R58A 2CO5A 1QNTA 2CSOA 3JSOA 1ZLKA 2ISYA 3TOAA 1HW1A 3WTSC 4JK1X 3KZZA 2DQLA 3ECHA 2MLGA 1XSVA 2A3SA 3RYPA 3WU1B 3F22A 3S2WA 2NAZA 5BQTA 2QWWA 2HR3A 3HOTA 2PLYA 1XCBA 2M5WA 1F9NA 2L02A 3C18A 2ZJ2A 5DV5A 1EV7A 2P6TA 1LDDA 5CLSA 1YW7A 5FFXA 1ODDA 2W24A 2CYYA 4RS8A 2FA5A 3ZMDA 4KA4A 4Q48A 4RGRA 3BZ6A 1SFUA 4XSXF 2MC3A 1AWCA 2QENA 1VTNC 2BE5F 1FW9A 2DT5A 2EA4A 1W4MA 1XCVA 5HS8A 3KZYA 5L3GA 3IC7A 1G3YA 3K9TA 2P8TA 2IA0A 1CF7B 2PFBA 1ONVA 2A6HF 5TRDA 2V6CA 1FC3A 3ZN1A 3Q9VA 4UVBA 2E1NA 3WTXC 4BHBA 2ISZA 1KQ9A 5ICGA 4L9NA 2A5YB 2FE3A 4KNYA 1SFXA 1XSXA 3KETA 1WQ2A 2Z9OA 1BM9A 1FBSA 2AHCA 3CO6C 2KIFA 5HLIA 4CHUA 3SHFA 3GFMA 3GO5A 4HZFA 5L3FA 1BI3A 5ED4A 4G6QA 5A2QZ 5D5XB 1Z7UA 4HYEA 3BOQA 4CICA 5LEJA 2ACJA 3QU3A 4ENMA 4GGGA 3F8FA 4LB6B 3HSEA 2EA2A 2HYFA 1XGMA 3T5XA 3ZMZA 3E3VA 4MQVA 3M1EA 4UNOA 2W85A 1SFEA 3O6BB 2UZKA 1YO5C 1E2XA 5E1XA 2GWRA 4ZZLA 2DBBA 5LEKA 2H09A 3CO7C 5LHIA 2HGCA 1L0OC 3R60A 2XVCA 3IKVA 2RA5A 1HKTA 1FYLA 4LLNA 1A04A 3FZVA 1TQIA 2CFXA 3CUQC 4EJVA 3SZPA 4FHTA 4P9UA 1SAXA 3HOSA 3JSPA 1D8KA 4O3MA 3E5UA 1U6GA 2DAOA 2EJRA 4A0ZA 1S6LA 2XAGA 2HKXA 3RKXA 3WODF 1XGSA 1S7AA 3MWMA 1R1VA 2MBFA 2ZFWA 4IHTA 1FPQA 1RUNA 3J80K 2EFQA 1YW9A 1ULYA 4ENKA 3KEQA 1OKRA 3PQKA 1P4AA 4CO8A 4N0BA 1R36A 1J7KA 5BPDA 3LAPA 5H20A 2CQKA 4QWQA 3HTSB 4ZSBA 4HDVA 2VODA 4UV8A 2OBPA 2HWVA 2VT3A 1LB2A 2XAQA 1FSHA 2VONA 1J5YA 1LEBA 2WC2A 1NHAA 4HQMA 2EV0A 2XRNA 3MZYA 4KIGA 3MFKA 3C3WA 1R5GA 3K2ZA 3M9AA 3V7SA 2EK5A 1G81A 2EFPA 3FMSA 1FZPB 1YLFA 4BH9A 1TNTA 2RNJA 2Y0MA 4XBFA 3GVAA 3F6OA 3BPVA 2JRTA 4D0PA 5HVQC 3T8RA 1RZ4A 1YFHA 1ZN2A 4A0YA 2J5OA 3LAJA 3PQJA 3WE3A 2FU4A 1HSJA 4CYDA 2H94A 1D5VA 4MQ9F 1R1TA 3HSFA 2O61A 5ILUA 4L9JA 5CVJA 5IT3A 4M9SA 4UHTA 1IN4A 3HTUA 2FXAA 3P9KA 2QZ8A 1ZREA 4AIJA 2W84A 3CJNA 4XLPF 2Z5UA 4CZZA 3DFGA 3DPLC 3F3XA 3KP5A 4MEYF 5FB2A 1T39A 4IHSA 4IXAA 4O6JA 4BNCA 1IRGA 5DCFA 1T0FA 4HV5A 4R79A 1MZBA 2FSWA 3IWFA 1HKQA 4OIOF 2IT0A 3HRTA 4L9VA 2FMYA 3TQNA 2YR2A 1ON1A 3V4GA 3SZTA 3MCZA 5K5OA 1KYWA 4K2EA 2W25A 2KIUA 1YS7A 4P96A 2E7WA 3MAJA 5AONA 3ZN0A 4LLGF 4ETSA 2GZWA 3D5LA 2Z33A 1KYZA 4U0YA 4B09A 4BHCA 4RB1A 3TDUC 4A12A 1SD5A 4UXNA 3FXRA 2GA1A 4JBAA 2DPUA 2BEOA 3V7CA 3TO7A 1F5TA 5BS6A 4WF2A 3ZQ7A 3F23A 5IT9K 4HAMA 2YX4A 1HQCA 1CF7A 2KIMA 2P5KA 2IA1A 3HIFA 4GO1A 4ON0A 1ZYRF 4KT5C 1BOAA 3FX3A 1MGTA 5D4SA 3EYIA 3QOPA 2QVOA 1J59A 3LA2A 2XHKA 4A0XA 5JHUA 2YU3A 4BXUA 4H0EA 3G73A 4BQAA 3ZMUA 2NNNA 2PN6A 3LFKA 4ESBA 1K78B 2P4WA 2IP2A 4M9XA 1ZGAA 1W5SA 3EQLF 1EH7A 4TV7A 5E20A 4HF1A 3LQRA 4WXDA 4KMUX 3CLOA 5ILSA 4HF2A 5L3EA 3TO9A 4WK8F 2JSCA 1QPMA 4N9IA 3K1NA 2RC4A 3WTZA 4A6EA 3Q5FA 2FNAA 2RGVA 3E6DA 1QBJA 4HOBA 3WTTC 1KA8A 2QLZA 2CGPA 4QLCU 4EM0B 1LDKB 4I0BA 2ELHA 1OMIA 2IKKA 4LLLA 2H27A 5LBQA 2NS0A 3GWZA 2WV0A 4WXCA 3E6CC 2O03A 1FYKA 1Z91A 1K79A 1B6AA 3L00A 2GXBA 3ROUA 3RI4A 5HLHA 2OA4A 3M8FA 2V1UA 1HSTA 2R7DA 1JHHA 4XRFA 5BOXA 1UFMA 4UVAA 2FBHA 2PEXA 2QQAA 3REOA 1E17A 1BJAA 1YW8A 4AD9A 3VEPA 4OMYA 2ZMEB 3ULQB 5JVTA 2BBYA 2XASA 3H3ZA 3DXJF 2XAJA 4HQEA 1TQPA 1JXSA 1XSDA 1T2KA 2J5PA 1Z6RA 4RAYA 3JW4A 3NEUA 5ICEA 2DK5A 4ZSKA 3QAHA 3VODA 1ZGJA 1LEAA 5TJJA 3IKTA 5FFZA 1HKSA 4YIIA 1ZG1A 2XIGA 3RJPA 1HBXG 3DKWA 3CUQB 1T38A 4BYYA 2R3SA 3KE2A 3KCCA 1P92A 1S8NA 2HEOA 5CJ9A 3KP7A 4ZH4F 4EJTA 1ZAOA 2GXGA 1USTA 1G6NA 4A6DA 3L7WA 4HLYA 3SXYA 1G3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HHG A;  2FBI A;  3J80 Z;  1O3T A;  5F1R A;  4CGZ A;  4EVI A;  2IVM A;  4CDG A;  4RGX A;  3COA C;  1BN5 A;  5J8F A;  3JAM K;  2STW A;  1XB4 A;  2RN7 A;  3GUD A;  1JGS A;  1U8R A;  5KVR A;  1XDU A;  2JPB A;  3K0L A;  4DQ2 A;  2P6S A;  2VBY A;  4ZYE A;  3ZMV A;  2DPD A;  1XN7 A;  5DDG A;  1FWZ A;  3DF8 A;  4KN4 X;  1XGO A;  3ISP A;  2EFW A;  2A07 F;  2MH9 A;  5LHH A;  5HLG A;  4UV9 A;  4E70 A;  2K02 A;  2HTJ A;  3W6K B;  1LVA A;  2G9W A;  4RB3 C;  3HRM A;  2M8E A;  3LA3 A;  1U5T C;  3TDZ C;  2QBY B;  2PI0 A;  4KYW A;  4NHJ A;  4I09 A;  4EGZ A;  3QU6 A;  4AWX B;  4YG2 F;  2L4A A;  4M73 A;  2Z3Y A;  4U0W A;  3O2P E;  2M1B A;  5K1Y A;  4M6X A;  3U2R A;  1B59 A;  3R61 A;  5LGT A;  1YYV A;  5D8L B;  1ZH5 A;  1WRJ A;  3I4P A;  1Q1H A;  1H0M A;  3GF2 A;  1I6X A;  2F2E A;  3L09 A;  4WXH A;  1V4R A;  5DUI A;  4RB2 C;  5JFR A;  2NRA C;  1BIB A;  1O7L A;  3RDI A;  2ESN A;  2JT1 A;  4Z2Y A;  2VE9 A;  1Z05 A;  3FM3 A;  1R1U A;  2WWY A;  4G94 A;  3FF5 A;  1BI2 A;  1H9G A;  3CTA A;  1DPU A;  4AIH A;  2ZXJ A;  5CVR A;  2COM A;  3I0T A;  5CVU A;  1W7P B;  2X0L A;  3TGN A;  5HDK A;  1WSU A;  4OIN F;  1HW2 A;  2ZO4 A;  5BMZ A;  1K78 A;  2H6C A;  4CXF A;  2YSR A;  2ADU A;  1FT9 A;  5DYM A;  2DLL A;  2OOI A;  3BDD A;  1YTY A;  2FBK A;  2PKH A;  2P7C B;  3ABU A;  2IPQ X;  1PP7 U;  5IT9 Z;  2OD5 A;  3DQV C;  1B4A A;  3F72 A;  2UXN A;  3CNV A;  4KMF A;  2L3D A;  1U78 A;  3I58 A;  3FM5 A;  2IW5 A;  5ICC A;  3J81 Z;  2DW4 A;  2UXX A;  3J7A O;  2FA1 A;  5LGU A;  4EM1 A;  4EMS A;  5E8I A;  4FX0 A;  3JTG A;  2EV6 A;  2M87 A;  1EH8 A;  1U3E M;  1ZRF A;  1IXC A;  1PP8 F;  4LG0 B;  1ZG3 A;  3TO6 A;  4OIR F;  1KU7 A;  1IUY A;  1R23 A;  5D6F A;  1YIO A;  5DCM B;  3H92 A;  2HDC A;  4M6Y A;  2K7L A;  2DTR A;  3R0J A;  3ZMT A;  3KP4 A;  3F21 A;  2O3F A;  4YFN F;  2L4M A;  2D2W A;  3DP7 A;  2ZME A;  2ZKZ A;  1STZ A;  1AOY A;  1UHW A;  3ECO A;  1SD7 A;  4G7Z F;  1L3L A;  1FBU A;  4ESF A;  2OAZ A;  2PG4 A;  3E6M A;  1TTY A;  2DFI A;  1REP C;  4I0A A;  1OR7 A;  4I01 A;  3BRO A;  3FXQ A;  3VFZ A;  1XDS A;  2GAU A;  1OPC A;  1I27 A;  5FLX Z;  2PMU A;  5D4R A;  1F1Z A;  1W7P D;  3CUQ A;  4HW0 A;  3T0Y A;  2CG4 A;  5ILV A;  1Z1D A;  3N97 A;  2NWI A;  4IF4 A;  5FD5 A;  1PUE E;  3CDH A;  3MQ0 A;  3HRU A;  2ZCW A;  4LK1 F;  1GHC A;  1O57 A;  2CWE A;  3WTY C;  2STT A;  1IW7 F;  2RKH A;  2BYV E;  3WTW C;  5L3D A;  4WWC A;  2HS5 A;  2XAH A;  1UHM A;  2RDP A;  2FQ3 A;  2PBI A;  1QO0 D;  3K1P A;  1WWX A;  4YIF A;  2LDU A;  4OMZ A;  2G7U A;  2FNP A;  4OOI A;  3FMQ A;  3K1M A;  4M74 A;  3ML6 A;  2D1H A;  3L9F A;  4RB0 A;  3F6V A;  3WU0 A;  2IJL A;  5FO5 A;  3J81 K;  4I7H A;  1LDJ A;  2A68 F;  5JR3 A;  1J0R A;  2B0L A;  2HFH A;  2NYX A;  1R5H A;  3RKY A;  2M30 A;  2G7H A;  2V1D A;  5BPI A;  1QQI A;  4RGS A;  1ZLJ A;  3P9C A;  5LHG A;  1FSE A;  5J6X A;  2ZNZ A;  5FGM A;  5E1W A;  4WX9 A;  2IA2 A;  1USS A;  3W6J B;  4DNC A;  2QBY A;  4KDP A;  4LD5 A;  2XRO A;  1FBQ A;  1J2X A;  4A5N A;  1RI7 A;  4HF0 A;  4Y15 A;  3BWG A;  4NB5 A;  5CYV A;  2AXL A;  3TKY A;  3GYH X;  5E18 F;  2A69 F;  3WE2 A;  2ESH A;  1XD7 A;  2Q0O A;  4S04 A;  4A2U A;  4R1H A;  5HS7 A;  5DEQ A;  1PDN C;  1XMK A;  5LLQ A;  3JAM Z;  3HUG A;  1IZ1 A;  4FX4 A;  3ERE D;  5DD4 A;  1DUX C;  2DQR A;  5D5V B;  1H9T A;  2P5L C;  1V3F A;  2VT2 A;  1ZG5 A;  3ZP5 A;  1G3S A;  4U88 A;  2AS5 F;  3K69 A;  3RIR A;  5FLX K;  1GXP A;  2VC1 A;  3ELK A;  1Y0U A;  2JTV A;  4M72 A;  2P19 A;  5E8G A;  2V1X A;  2KJC A;  3SFZ A;  2LF8 A;  4UUV A;  3NQO A;  2MD5 A;  5E17 F;  1J75 A;  1ZAR A;  4AVP A;  4RGU A;  2KKO A;  3WTU C;  1FOK A;  3FWE A;  3Q9S A;  1IN8 A;  1UCR A;  4KUM A;  3P7N A;  1SMY F;  3WG9 A;  2YX7 A;  3C7J A;  1W7P A;  3I71 A;  2C6Y A;  3ZPL A;  2FRH A;  3I53 A;  1MDM B;  2ETH A;  1U5T B;  3JTH A;  5E1Z B;  3V8J A;  1YQA A;  1KU9 A;  2FOK A;  2YPR A;  2EV5 A;  1TBX A;  5CVI A;  4HX8 A;  2P5V A;  4P9F A;  1IXS B;  3BJO A;  1DPR A;  4L5J A;  2LSO A;  1B9N A;  3HRS A;  2HQR A;  4EV0 A;  2JZY A;  1R22 A;  4Y13 A;  3GX4 X;  2HTS A;  4LFU A;  4RAZ A;  4IRI A;  3M8E A;  2DU9 A;  1R00 A;  2FF4 A;  3QP5 A;  3BJA A;  2VOO A;  4IPA A;  4ESJ A;  2D1V A;  2MA3 A;  2OQR A;  2K86 A;  4M71 A;  1O3Q A;  4HA8 A;  1IXR C;  1IN7 A;  1FYM A;  4LJZ F;  4M9Z A;  2RV8 A;  2XKP A;  5KK1 A;  3F8B A;  3U9G A;  5EEH A;  2KRF A;  1LNW A;  4LG0 A;  1QZZ A;  4Y17 A;  5HDG A;  5DCM A;  1TW2 A;  5ERI A;  5AIP A;  4G9Y A;  4P5O A;  3LQQ A;  4R8H A;  2VOP A;  1MD0 A;  3RKW A;  1KQ0 A;  5H6R A;  3I54 A;  4MTD A;  2CW0 F;  3O3K A;  4EQQ A;  2O0Y A;  2DK8 A;  2ZBK A;  4PZJ A;  4GXO A;  3RYR A;  2W57 A;  3L5Z A;  4EJO A;  4ZZD A;  2XGX A;  3G3Z A;  5ICF A;  3I59 B;  3GFJ A;  1ZRD A;  2EFO A;  3MEX A;  2LKP A;  4G7O F;  4S05 A;  1XLR A;  1F4K A;  2GIV A;  2OZ6 A;  4GYI A;  1RIO H;  3AAF A;  3RPQ A;  2R7F A;  3IRQ A;  4IJA A;  2Y48 A;  5HS9 A;  5L3C A;  3HSR A;  2QUF A;  1KQ8 A;  1S3J A;  5JI6 A;  5DUK A;  1GVJ A;  3F8L A;  1FP1 D;  2K4B A;  3C1D A;  1K6O A;  3KFW X;  3DV8 A;  1RNL A;  4XLN F;  1I5Z A;  4GYG A;  3EDP A;  2Q8K A;  2F5D A;  3OV8 A;  1D3Y A;  4LK0 F;  4EJU A;  6PAX A;  1GXQ A;  4ENJ A;  3PFI A;  3E97 A;  1XMA A;  2F5F A;  3B02 A;  2M45 A;  3IRR A;  3M7G A;  1K7A A;  1MJ9 A;  1IAW A;  4OU0 A;  3QP6 A;  4ASN A;  1ZRC A;  3FXU A;  3GZ5 A;  4IRH A;  2F5C A;  1BBY A;  1TNS A;  1TW3 A;  1BI0 A;  4G6D A;  4OIP F;  1T6S A;  1S7O A;  4LGW A;  2HQN A;  2TDX A;  1P6R A;  4LB5 A;  3KLO A;  2VE8 A;  1BIA A;  2OU2 A;  3WTV C;  3VB2 A;  1ZHF A;  2ZNY A;  1QZY A;  4I98 B;  5F64 A;  5EEG A;  1P2F A;  2D45 A;  1BI1 A;  1C0W A;  4KFC A;  4KN7 X;  2LF7 A;  2XUB A;  4L18 B;  5LGN A;  3FHZ A;  4PCQ A;  5CVV A;  4EGY A;  1UB9 A;  5F6F A;  5FD6 A;  1SD6 A;  2WTE A;  4Q4Z F;  3SQN A;  4HDU A;  4U0V A;  3R4K A;  2XAF A;  1FX7 A;  4A5M A;  4FT8 A;  3MZH A;  1IF1 A;  3E6B A;  3I64 A;  1HW5 A;  1HXD A;  4EJW A;  4MHG A;  5A2Q K;  3GXO A;  4Q5S F;  1BC8 C;  2P7V B;  2HZT A;  3P9I A;  2VN2 A;  3RPU A;  4KIF A;  3IHU A;  2VBX A;  3CUO A;  1IN6 A;  2MLK A;  4MNU A;  1SMT A;  2A6E F;  4IVN A;  1P4W A;  1YG2 A;  3KP2 A;  1OYW A;  1X3U A;  4HBL A;  3GW2 A;  1I1S A;  3EYY A;  2EFN A;  5D5U B;  4L9T A;  1TT8 A;  1IN5 A;  3DPT A;  1JD3 A;  4LMY A;  1MDM A;  3LST A;  1U5T A;  2GA2 A;  1G1B A;  3LHE A;  2LNB A;  2UWM A;  3L2C A;  2Q2E A;  4Q47 A;  2F5E A;  5L3B A;  1QGP A;  4PGG A;  1EH6 A;  2DO7 A;  4ZSI A;  3WGG A;  1W5T A;  1B1B A;  3LA7 A;  3V7R A;  1OYY A;  3WGH A;  1RUO A;  2PMH A;  1B9M A;  2E7X A;  2A61 A;  1JHF A;  1BC7 C;  1P4X A;  2RVC A;  5J8C A;  3HFI A;  3GEZ A;  1KU3 A;  5AIQ A;  3DEU A;  1T98 A;  5LRS A;  3IL2 A;  3I5U A;  3F8C A;  3E5Q A;  3V8K A;  1G3W A;  5HOO A;  1LQ1 A;  4G8X A;  3H3U A;  3DDV A;  3NRV A;  5H6Q A;  3QPH A;  2HKO A;  4L5I A;  3VOE A;  5D8K B;  1J9I A;  3BY6 A;  2RQP A;  2X4H A;  4HLX A;  2PJP A;  4N9H A;  4ZYH A;  5D5W B;  4PDK A;  4HV6 A;  2QQ9 A;  3R6S A;  2Y75 A;  1KU2 A;  1WKM A;  2FEZ A;  5HDN A;  1O3S A;  4NQW A;  3QRF F;  2VBW A;  3EET A;  2L54 A;  2GQQ A;  1O3R A;  1FP2 A;  4U7B A;  3FMR A;  4BAY A;  5LRR A;  2BGC A;  3I59 A;  4P55 A;  4BHP A;  2L01 A;  4GCV A;  2O8X A;  2VBZ A;  1JE8 A;  3ABT A;  4YFK F;  3RTR A;  1O7F A;  3WGI A;  2OGG A;  2QYO A;  2E1C A;  3GFI A;  3B73 A;  3D0S A;  3QPT A;  1U2W A;  3KEO A;  1SD4 A;  1Z6T A;  3T1B A;  2EB7 A;  1OYI A;  1MJB A;  2QM3 A;  4ZYD A;  3GZ6 A;  1ON2 A;  3T8T A;  2HYG D;  1S29 A;  2OQG A;  4JQF A;  1DDN A;  3BJ6 A;  3R0A A;  4G7H F;  1R7J A;  3E5X A;  2Z99 A;  4B8X A;  1YS6 A;  3ZMS A;  4XSZ F;  1XGN A;  2K27 A;  3U1D A;  4U7D A;  3BPX A;  1G4D A;  3GLX A;  4ZYG A;  4EM2 A;  3KP6 A;  3HHH A;  1TQM A;  3BP8 A;  2V79 A;  4MGR A;  2EWN A;  1MJA A;  4WCG A;  3KLN A;  4I2O A;  4YFX F;  3EUH A;  1IRF A;  4KIC A;  1MKM A;  2IRF G;  3OOP A;  1CGP A;  4OIQ F;  4MEX F;  2KJB A;  1D8J A;  3F8M A;  3IWZ A;  2PQ8 A;  1TLH B;  3N4M A;  4KIB A;  5K5R A;  2NNY A;  1Z9C A;  4AIK A;  1LJ9 A;  3KP3 A;  1FLI A;  4L0Z B;  4MTE A;  4UVC A;  5DD8 A;  2QQB A;  5K5Q A;  2K4J A;  2MH2 A;  1FY7 A;  3HYI A;  2XKO A;  2XV4 S;  2DI3 A;  1I1G A;  4O5V A;  4F7Z A;  1DP7 P;  4HX4 A;  4I02 A;  3TOB A;  2VXZ A;  4HX7 A;  5D6E A;  1FNN A;  3V8L A;  2O6G E;  4PGH A;  3LWF A;  1WI9 A;  2OZU A;  3GFL A;  2BV6 A;  2FML A;  2VC0 A;  3F8N A;  2JPC A;  1KGS A;  2V9V A;  2H6B A;  4ENN A;  2HOE A;  4IRG A;  4L0Y B;  1R58 A;  2CO5 A;  1QNT A;  2CSO A;  3JSO A;  1ZLK A;  2ISY A;  3TOA A;  1HW1 A;  3WTS C;  4JK1 X;  3KZZ A;  2DQL A;  3ECH A;  2MLG A;  1XSV A;  2A3S A;  3RYP A;  3WU1 B;  3F22 A;  3S2W A;  2NAZ A;  5BQT A;  2QWW A;  2HR3 A;  3HOT A;  2PLY A;  1XCB A;  2M5W A;  1F9N A;  2L02 A;  3C18 A;  2ZJ2 A;  5DV5 A;  1EV7 A;  2P6T A;  1LDD A;  5CLS A;  1YW7 A;  5FFX A;  1ODD A;  2W24 A;  2CYY A;  4RS8 A;  2FA5 A;  3ZMD A;  4KA4 A;  4Q48 A;  4RGR A;  3BZ6 A;  1SFU A;  4XSX F;  2MC3 A;  1AWC A;  2QEN A;  1VTN C;  2BE5 F;  1FW9 A;  2DT5 A;  2EA4 A;  1W4M A;  1XCV A;  5HS8 A;  3KZY A;  5L3G A;  3IC7 A;  1G3Y A;  3K9T A;  2P8T A;  2IA0 A;  1CF7 B;  2PFB A;  1ONV A;  2A6H F;  5TRD A;  2V6C A;  1FC3 A;  3ZN1 A;  3Q9V A;  4UVB A;  2E1N A;  3WTX C;  4BHB A;  2ISZ A;  1KQ9 A;  5ICG A;  4L9N A;  2A5Y B;  2FE3 A;  4KNY A;  1SFX A;  1XSX A;  3KET A;  1WQ2 A;  2Z9O A;  1BM9 A;  1FBS A;  2AHC A;  3CO6 C;  2KIF A;  5HLI A;  4CHU A;  3SHF A;  3GFM A;  3GO5 A;  4HZF A;  5L3F A;  1BI3 A;  5ED4 A;  4G6Q A;  5A2Q Z;  5D5X B;  1Z7U A;  4HYE A;  3BOQ A;  4CIC A;  5LEJ A;  2ACJ A;  3QU3 A;  4ENM A;  4GGG A;  3F8F A;  4LB6 B;  3HSE A;  2EA2 A;  2HYF A;  1XGM A;  3T5X A;  3ZMZ A;  3E3V A;  4MQV A;  3M1E A;  4UNO A;  2W85 A;  1SFE A;  3O6B B;  2UZK A;  1YO5 C;  1E2X A;  5E1X A;  2GWR A;  4ZZL A;  2DBB A;  5LEK A;  2H09 A;  3CO7 C;  5LHI A;  2HGC A;  1L0O C;  3R60 A;  2XVC A;  3IKV A;  2RA5 A;  1HKT A;  1FYL A;  4LLN A;  1A04 A;  3FZV A;  1TQI A;  2CFX A;  3CUQ C;  4EJV A;  3SZP A;  4FHT A;  4P9U A;  1SAX A;  3HOS A;  3JSP A;  1D8K A;  4O3M A;  3E5U A;  1U6G A;  2DAO A;  2EJR A;  4A0Z A;  1S6L A;  2XAG A;  2HKX A;  3RKX A;  3WOD F;  1XGS A;  1S7A A;  3MWM A;  1R1V A;  2MBF A;  2ZFW A;  4IHT A;  1FPQ A;  1RUN A;  3J80 K;  2EFQ A;  1YW9 A;  1ULY A;  4ENK A;  3KEQ A;  1OKR A;  3PQK A;  1P4A A;  4CO8 A;  4N0B A;  1R36 A;  1J7K A;  5BPD A;  3LAP A;  5H20 A;  2CQK A;  4QWQ A;  3HTS B;  4ZSB A;  4HDV A;  2VOD A;  4UV8 A;  2OBP A;  2HWV A;  2VT3 A;  1LB2 A;  2XAQ A;  1FSH A;  2VON A;  1J5Y A;  1LEB A;  2WC2 A;  1NHA A;  4HQM A;  2EV0 A;  2XRN A;  3MZY A;  4KIG A;  3MFK A;  3C3W A;  1R5G A;  3K2Z A;  3M9A A;  3V7S A;  2EK5 A;  1G81 A;  2EFP A;  3FMS A;  1FZP B;  1YLF A;  4BH9 A;  1TNT A;  2RNJ A;  2Y0M A;  4XBF A;  3GVA A;  3F6O A;  3BPV A;  2JRT A;  4D0P A;  5HVQ C;  3T8R A;  1RZ4 A;  1YFH A;  1ZN2 A;  4A0Y A;  2J5O A;  3LAJ A;  3PQJ A;  3WE3 A;  2FU4 A;  1HSJ A;  4CYD A;  2H94 A;  1D5V A;  4MQ9 F;  1R1T A;  3HSF A;  2O61 A;  5ILU A;  4L9J A;  5CVJ A;  5IT3 A;  4M9S A;  4UHT A;  1IN4 A;  3HTU A;  2FXA A;  3P9K A;  2QZ8 A;  1ZRE A;  4AIJ A;  2W84 A;  3CJN A;  4XLP F;  2Z5U A;  4CZZ A;  3DFG A;  3DPL C;  3F3X A;  3KP5 A;  4MEY F;  5FB2 A;  1T39 A;  4IHS A;  4IXA A;  4O6J A;  4BNC A;  1IRG A;  5DCF A;  1T0F A;  4HV5 A;  4R79 A;  1MZB A;  2FSW A;  3IWF A;  1HKQ A;  4OIO F;  2IT0 A;  3HRT A;  4L9V A;  2FMY A;  3TQN A;  2YR2 A;  1ON1 A;  3V4G A;  3SZT A;  3MCZ A;  5K5O A;  1KYW A;  4K2E A;  2W25 A;  2KIU A;  1YS7 A;  4P96 A;  2E7W A;  3MAJ A;  5AON A;  3ZN0 A;  4LLG F;  4ETS A;  2GZW A;  3D5L A;  2Z33 A;  1KYZ A;  4U0Y A;  4B09 A;  4BHC A;  4RB1 A;  3TDU C;  4A12 A;  1SD5 A;  4UXN A;  3FXR A;  2GA1 A;  4JBA A;  2DPU A;  2BEO A;  3V7C A;  3TO7 A;  1F5T A;  5BS6 A;  4WF2 A;  3ZQ7 A;  3F23 A;  5IT9 K;  4HAM A;  2YX4 A;  1HQC A;  1CF7 A;  2KIM A;  2P5K A;  2IA1 A;  3HIF A;  4GO1 A;  4ON0 A;  1ZYR F;  4KT5 C;  1BOA A;  3FX3 A;  1MGT A;  5D4S A;  3EYI A;  3QOP A;  2QVO A;  1J59 A;  3LA2 A;  2XHK A;  4A0X A;  5JHU A;  2YU3 A;  4BXU A;  4H0E A;  3G73 A;  4BQA A;  3ZMU A;  2NNN A;  2PN6 A;  3LFK A;  4ESB A;  1K78 B;  2P4W A;  2IP2 A;  4M9X A;  1ZGA A;  1W5S A;  3EQL F;  1EH7 A;  4TV7 A;  5E20 A;  4HF1 A;  3LQR A;  4WXD A;  4KMU X;  3CLO A;  5ILS A;  4HF2 A;  5L3E A;  3TO9 A;  4WK8 F;  2JSC A;  1QPM A;  4N9I A;  3K1N A;  2RC4 A;  3WTZ A;  4A6E A;  3Q5F A;  2FNA A;  2RGV A;  3E6D A;  1QBJ A;  4HOB A;  3WTT C;  1KA8 A;  2QLZ A;  2CGP A;  4QLC U;  4EM0 B;  1LDK B;  4I0B A;  2ELH A;  1OMI A;  2IKK A;  4LLL A;  2H27 A;  5LBQ A;  2NS0 A;  3GWZ A;  2WV0 A;  4WXC A;  3E6C C;  2O03 A;  1FYK A;  1Z91 A;  1K79 A;  1B6A A;  3L00 A;  2GXB A;  3ROU A;  3RI4 A;  5HLH A;  2OA4 A;  3M8F A;  2V1U A;  1HST A;  2R7D A;  1JHH A;  4XRF A;  5BOX A;  1UFM A;  4UVA A;  2FBH A;  2PEX A;  2QQA A;  3REO A;  1E17 A;  1BJA A;  1YW8 A;  4AD9 A;  3VEP A;  4OMY A;  2ZME B;  3ULQ B;  5JVT A;  2BBY A;  2XAS A;  3H3Z A;  3DXJ F;  2XAJ A;  4HQE A;  1TQP A;  1JXS A;  1XSD A;  1T2K A;  2J5P A;  1Z6R A;  4RAY A;  3JW4 A;  3NEU A;  5ICE A;  2DK5 A;  4ZSK A;  3QAH A;  3VOD A;  1ZGJ A;  1LEA A;  5TJJ A;  3IKT A;  5FFZ A;  1HKS A;  4YII A;  1ZG1 A;  2XIG A;  3RJP A;  1HBX G;  3DKW A;  3CUQ B;  1T38 A;  4BYY A;  2R3S A;  3KE2 A;  3KCC A;  1P92 A;  1S8N A;  2HEO A;  5CJ9 A;  3KP7 A;  4ZH4 F;  4EJT A;  1ZAO A;  2GXG A;  1UST A;  1G6N A;  4A6D A;  3L7W A;  4HLY A;  3SXY A;  1G3T A; 
#chains in the Genus database with same CATH topology
 3HHG A;  2FBI A;  3RZO J;  3J80 Z;  4E7K A;  1O3T A;  5F1R A;  3ZR8 X;  4CGZ A;  3FXO A;  4EVI A;  2XF6 A;  2XF7 A;  5HNF A;  2IVM A;  2JUC A;  4CDG A;  1AU7 A;  4RGX A;  2GLO A;  3COA C;  2QGU A;  2O5R A;  1BN5 A;  5J8F A;  3JAM K;  2STW A;  3DLA A;  4BE0 A;  2WAQ N;  1XB4 A;  4BE1 A;  1VFC A;  4XN0 A;  5GAE J;  5FKK A;  4XLH A;  2RN7 A;  3GUD A;  1JGS A;  1PVE A;  1U8R A;  5KVR A;  4ITV A;  3OYL A;  1CQT A;  1XX5 A;  3S14 J;  1XDU A;  2JPB A;  1TT5 B;  3K0L A;  2P81 A;  4Y4R A;  4DQ2 A;  3A0H C;  1WGX A;  2P6S A;  2VBY A;  4ZYE A;  3ZMV A;  2R7S A;  2DPD A;  2HZD A;  1XN7 A;  1QPI A;  5DDG A;  1FWZ A;  3DF8 A;  1VQN I;  4KN4 X;  1XGO A;  2NVU B;  3ISP A;  4HNU A;  2EFW A;  5IYD J;  1BW6 A;  2Y2Z A;  1SAU A;  2MH9 A;  3CQZ J;  5LHH A;  5HLG A;  2A07 F;  4UV9 A;  2LP0 A;  1ACI A;  4E70 A;  3Q0V A;  2K02 A;  3BT9 A;  5B1A H;  2HTJ A;  4A3F J;  2VQL A;  2VLA A;  3VPR A;  5GPC A;  3W6K B;  4DGW B;  1LVA A;  2G9W A;  2RRE A;  5F04 A;  4RB3 C;  3HRM A;  1LPQ A;  2CUE A;  1VF9 A;  2X6O A;  2M8E A;  3LA3 A;  5EJC A;  1NH3 A;  1NK2 P;  4BY1 J;  1U5T C;  3TDZ C;  2QBY B;  2JA8 J;  2PI0 A;  2VXD A;  4IQJ A;  2F6C A;  4JX4 A;  1W36 D;  4KYW A;  4NHJ A;  5J47 A;  3K4N A;  3LSR A;  2VJI A;  2COB A;  4I09 A;  4EGZ A;  1PJR A;  3HJE A;  3QU6 A;  4AWX B;  4YG2 F;  1R71 A;  2L4A A;  3GTQ J;  4M73 A;  3ABK H;  5E3M A;  2JMW A;  2Z3Y A;  4U0W A;  4D9J A;  3O2P E;  1MNE A;  5KHD A;  4JYK A;  1VQ9 I;  5EG0 A;  2M1B A;  3BR1 A;  1ETY A;  1OR7 C;  2VKE A;  5K1Y A;  4M6X A;  2JA5 J;  3LSK A;  3LFU A;  1B59 A;  3U2R A;  3R61 A;  4KIS A;  4PK4 A;  2M3A A;  3HUG B;  5LGT A;  1YYV A;  3QWL A;  2DDA A;  5D8L B;  1ZH5 A;  1WRJ A;  3K4C A;  1X4P A;  3I4P A;  1WH5 A;  1Q1H A;  1H0M A;  3GF2 A;  1I6X A;  3MKW B;  5BNG A;  2F2E A;  2XAU A;  3L09 A;  4WXH A;  4PJJ A;  1V4R A;  5DUI A;  2E1M C;  4RB2 C;  1IC8 A;  2O8K A;  3MKZ A;  5JFR A;  2NRA C;  2X6W A;  1BIB A;  4B3X A;  3KYD B;  4F52 A;  1O7L A;  4Z6Y A;  3S16 J;  2ZJR F;  2VUM J;  3RDI A;  2FJ1 A;  4FTH A;  2ESN A;  5FKN A;  2JT1 A;  1QVT A;  2CV1 A;  4Z2Y A;  1XTA A;  1UG0 A;  3I4M J;  2MD0 A;  3FXK A;  2VE9 A;  1Z05 A;  3FM3 A;  1R1U A;  3UKG A;  4G94 A;  3FF5 A;  2WWY A;  1BI2 A;  1H9G A;  4AYB A;  3CTA A;  1DPU A;  2DMQ A;  2XPW A;  3RQI A;  1H89 C;  4AIH A;  2ZXJ A;  1IG7 A;  3WU2 C;  5CVR A;  3S93 A;  2COM A;  2RQQ A;  3PSF A;  3I0T A;  2RNG A;  5CKT A;  2LKX A;  3I55 I;  5CVU A;  1X4O A;  2W1O A;  1W7P B;  3IAS 2;  2X0L A;  3TGN A;  5HDK A;  1WSU A;  4OIN F;  1HW2 A;  3CF2 A;  2ZO4 A;  1WHU A;  2DT6 A;  1RES A;  5BMZ A;  1K78 A;  1XC5 A;  3K4J A;  3G1O A;  5CQE A;  2FD5 A;  2H6C A;  5B1B H;  1LE8 A;  5CQG A;  3UNG C;  4CXF A;  1MIJ A;  1V5F A;  2ZXW H;  1HA8 A;  4DBQ A;  2YSR A;  4FIS A;  1MBJ A;  2ADU A;  1FT9 A;  5DYM A;  2LOO A;  2NXN B;  2DLL A;  3DEE A;  5E3O A;  2OOI A;  3PUF A;  1AA7 A;  4BGD A;  4C2T A;  3BDD A;  1YTY A;  4DYC A;  1NTC A;  2FBK A;  1FIP A;  3GBG A;  1V55 H;  2UUZ A;  2PKH A;  2P7C B;  1JKO C;  1R4N B;  1MMA A;  3ABU A;  2KP6 A;  2Y30 A;  3S8P A;  1VQ8 I;  2IPQ X;  2Y69 H;  3E7L A;  1PP7 U;  5IT9 Z;  2OD5 A;  3DQV C;  1B4A A;  3F72 A;  2UXN A;  4OAZ A;  3OYK A;  3CNV A;  4MIM A;  4RA2 A;  4KMF A;  2LRE A;  2L3D A;  4F91 B;  3DEW A;  2M4K A;  3M07 A;  3BR0 A;  1U78 A;  4YRV A;  3I58 A;  4YEJ A;  1UJ8 A;  3FM5 A;  2IW5 A;  3G71 I;  3W2A A;  5ICC A;  3J81 Z;  2DW4 A;  2UXX A;  2XSD C;  3J7A O;  2FA1 A;  2WY7 Q;  5LGU A;  4EM1 A;  2YS9 A;  4EMS A;  3D1N I;  5E8I A;  1MNM C;  1RKT A;  4FX0 A;  3JTG A;  2EV6 A;  2M87 A;  2K9L A;  1VQ4 I;  1EH8 A;  4A3G J;  5JLW A;  1U3E M;  1ZRF A;  3G4S I;  1X1D A;  1IXC A;  1PP8 F;  4LG0 B;  1ZG3 A;  2VKD A;  3B6A A;  3TO6 A;  1TC3 C;  4HSR A;  4OIR F;  1KU7 A;  1IUY A;  1R23 A;  2IGM A;  5D6F A;  4QIW N;  1YIO A;  5DCM B;  3H92 A;  3CCJ I;  2HDC A;  1K61 A;  3EUH C;  4ANJ A;  1MW7 A;  4M6Y A;  3UR3 C;  1XMX A;  2DTR A;  2K7L A;  3R0J A;  3ZMT A;  4IX7 A;  3KP4 A;  3F21 A;  2O3F A;  4YFN F;  5IYB J;  2L4M A;  4UUS A;  4BJ5 C;  2D2W A;  4IOA F;  4L5E A;  3DP7 A;  1OCR H;  2VQG A;  2ZME A;  2ZKZ A;  1STZ A;  1AOY A;  1R6R A;  1UHW A;  2VAS A;  3ECO A;  3GME A;  1MBG A;  3OYA A;  1SD7 A;  2HDW A;  2GIZ A;  1VQP I;  2L9V A;  2L9R A;  4IZZ A;  4B48 A;  4G7Z F;  1L3L A;  2DOA A;  1FTZ A;  2VJ5 A;  3BR6 A;  1FBU A;  2CW8 A;  4ESF A;  2OAZ A;  2PG4 A;  3E6M A;  2BHZ A;  1TTY A;  4IHX A;  2DFI A;  1REP C;  3AG3 H;  3H0D A;  3GTM J;  3P5J A;  4I0A A;  1EJ9 A;  3CCS I;  1OR7 A;  2W00 A;  4I01 A;  3BRO A;  3LSI A;  1D5Y A;  3FXQ A;  3VFZ A;  1XDS A;  3MKL A;  3PIP F;  1XPX A;  4IKF A;  3BC8 A;  2GAU A;  1OPC A;  1I27 A;  2G0E A;  1NK3 P;  5FLX Z;  2M7B A;  2PMU A;  5D4R A;  2LC2 A;  1F1Z A;  1W7P D;  3CUQ A;  4HW0 A;  3T0Y A;  4C3J J;  2CUJ A;  2CG4 A;  5ILV A;  1Z1D A;  1JI8 A;  3H5N A;  2K3F A;  3OYJ A;  3N97 A;  3HBL A;  3Q0W A;  2NWI A;  4IF4 A;  5FD5 A;  4PFO A;  3K4K A;  1PUE E;  3CDH A;  3MQ0 A;  3HRU A;  2ZCW A;  4LK1 F;  1GHC A;  3BZC A;  4XOR A;  1O57 A;  3MVP A;  4XLC A;  3LOC A;  2CWE A;  3WTY C;  2BVM A;  3CP2 A;  3BG5 A;  1O4X A;  2DMT A;  3BTI A;  3ZQF A;  3PO2 J;  2STT A;  3JRG A;  1IW7 F;  1IJW C;  5FKM A;  2RKH A;  2E71 A;  2BYV E;  3WTW C;  4QPQ A;  5L3D A;  2HQA A;  4WWC A;  2ZJP F;  2HS5 A;  3CES A;  2XAH A;  1UHM A;  4G12 A;  3H0G J;  2RDP A;  1MH3 A;  2VQH A;  4CCL A;  2FQ3 A;  3QPL A;  1PUF B;  2PBI A;  1QO0 D;  2OTJ I;  2E36 A;  1T95 A;  1WWX A;  2KPM A;  3K1P A;  4YIF A;  3MN2 A;  2LDU A;  4OMZ A;  2G7U A;  2L7Z A;  2FNP A;  1ZGW A;  1VND A;  4OOI A;  3FMQ A;  1RR8 C;  3ZQQ A;  2CS3 A;  1T08 B;  3K1M A;  4IL6 C;  4M74 A;  3ML6 A;  2D1H A;  3L9F A;  2MFZ A;  3F6V A;  4RB0 A;  4D7M A;  3WU0 A;  4MO7 A;  3FK7 A;  1B8I B;  2IJL A;  5FO5 A;  3J81 K;  4I7H A;  2K3P A;  1LDJ A;  2A68 F;  1PYV A;  2A6T A;  1XG1 A;  3SYT A;  1VQ6 I;  5JR3 A;  1J0R A;  2B0L A;  4BEH B;  2HFH A;  2XPV A;  2NYX A;  1R5H A;  2M30 A;  3RKY A;  2G7H A;  2V1D A;  3L2Q A;  5BPI A;  1TZL A;  1QQI A;  4RGS A;  1XS9 A;  3I9V 2;  3VYU B;  1Z3Y A;  1AHD P;  1ZLJ A;  3P9C A;  5LHG A;  1VQL I;  2JA7 J;  1FSE A;  5J6X A;  5KNL A;  2ZNZ A;  5FGM A;  1A35 A;  5E1W A;  3BG6 A;  4WX9 A;  2IA2 A;  5EDN A;  1X3W B;  4PFP A;  5GTI C;  1USS A;  4GRI A;  3HOZ J;  3DBR B;  2W7N A;  1MSE C;  2LLK A;  3W6J B;  3CC7 I;  1X2N A;  4DNC A;  2QBY A;  2KRH A;  3FKI J;  4LD5 A;  2M9H A;  4KDP A;  2XRO A;  1FBQ A;  3J7A Y;  1J2X A;  4A5N A;  1RI7 A;  3DTE A;  4HF0 A;  4Y15 A;  3HG9 A;  3BWG A;  4NB5 A;  5CYV A;  4EAT A;  2HVS A;  2AXL A;  3TKY A;  2MYS A;  3OOU A;  4PSW A;  2X1E A;  2FUG 2;  4QSH A;  3CJT B;  3GYH X;  2W48 A;  5E18 F;  2A69 F;  2K9S A;  3WE2 A;  3FXM A;  2ESH A;  2M2E A;  1XD7 A;  2Q0O A;  3VYS B;  4A2U A;  4S04 A;  3OYE A;  4R1H A;  2XC7 A;  3I3L A;  5HS7 A;  1K6Y A;  5DEQ A;  1ZR4 A;  1PDN C;  1XMK A;  3FIW A;  5LLQ A;  2KMU A;  3DLL F;  4D7N A;  3JAM Z;  3HUG A;  1IZ1 A;  4DYR A;  4FX4 A;  3ERE D;  1I6H J;  5DD4 A;  1DUX C;  2DQR A;  5D5V B;  1H9T A;  2IGK A;  4II2 A;  2P5L C;  4XKW A;  2R7Q A;  1WJC A;  4RLF A;  1V3F A;  2VT2 A;  1ZG5 A;  2LY9 A;  3ZP5 A;  1G3S A;  4U88 A;  1Y39 A;  1MMN A;  1GV2 A;  2AS5 F;  3K69 A;  3RIR A;  5FLX K;  2I8D A;  2F48 A;  1GXP A;  2K9N A;  2VC1 A;  2VKV A;  1WZ2 A;  3ELK A;  2JUG A;  1Y0U A;  2JTV A;  4M72 A;  2P19 A;  5E8G A;  4BL0 B;  2V1X A;  2KJC A;  3SFZ A;  2LF8 A;  1BR1 A;  4UUV A;  3C2H A;  3NQO A;  2MD5 A;  4W1U A;  4CUG A;  5E17 F;  4NNJ A;  1J75 A;  1ZAR A;  4AVP A;  4RGU A;  3H1C A;  4LIT A;  2KKO A;  1OCT C;  3WTU C;  4F3Q A;  1FOK A;  3FWE A;  2CQX A;  1JT0 A;  3Q9S A;  1IN8 A;  5IOZ A;  3HOW J;  1UCR A;  4KUM A;  4RMN A;  2CUF A;  1JTY A;  3OMY A;  3P7N A;  1SMY F;  2IEK A;  3KIO A;  3WG9 A;  1A36 A;  2BY1 A;  2YX7 A;  5GP9 A;  2K85 A;  2VPL A;  2XB0 X;  3C7J A;  1W7P A;  3IUO A;  3CJQ B;  3I71 A;  2C6Y A;  3ZPL A;  3PO3 J;  2L7M P;  2FRH A;  3I53 A;  1MDM B;  2ETH A;  1ETO A;  2IS1 A;  1TWA J;  1FOW A;  1U5T B;  2V9P A;  3JTH A;  5E1Z B;  2EH3 A;  1FEX A;  3V8J A;  3TW7 A;  1YQA A;  3ZGK A;  1KU9 A;  4DZP A;  2FOK A;  1D0Z A;  1RKW A;  2YPR A;  2EV5 A;  1TBX A;  3PNV A;  5CVI A;  2LKS A;  2P5V A;  4HX8 A;  1IXS B;  4P9F A;  3BJO A;  4PJ0 C;  2Q2E B;  4XRS G;  4ABZ A;  1DPR A;  2BXZ A;  4L5J A;  1BW5 A;  2LSO A;  1IDY A;  3H35 A;  2QEX I;  2NS8 A;  1WCM J;  1B9N A;  2KQR A;  3S32 A;  1G8X A;  3HRS A;  1R9T J;  2HQR A;  4EV0 A;  2JZY A;  1R22 A;  1TWC J;  4Y13 A;  1ETK A;  2M34 A;  3GX4 X;  2HTS A;  5B5E C;  4LFU A;  4RAZ A;  5DM7 F;  3G1L A;  3H9Q A;  1JJ8 C;  2ID3 A;  4IRI A;  1P9Q C;  2LH9 A;  3M8E A;  2DU9 A;  1R00 A;  2FF4 A;  3QP5 A;  1GLN A;  1FMV A;  1ZR2 A;  3BJA A;  2VOO A;  4IPA A;  4ESJ A;  2D1V A;  2MA3 A;  3VSK A;  2E1M B;  3MD2 A;  2OQR A;  5KAF C;  2K86 A;  1AKH B;  4M71 A;  2LMD A;  4V2G A;  2DJN A;  2E34 A;  1O3Q A;  5C44 J;  4E6K G;  3TP3 A;  1Z21 A;  3CDI A;  4CSW A;  1J09 A;  1IXR C;  4HA8 A;  1Q1V A;  1IN7 A;  1FYM A;  4XM3 A;  4LJZ F;  4M9Z A;  2JSP A;  3K4B A;  2RV8 A;  2XKP A;  2X9D A;  4A3L J;  3ZOB A;  5KK1 A;  3F8B A;  3U9G A;  5EEH A;  2WA0 A;  2PMZ N;  1Z0X A;  1ZEL A;  2KRF A;  1LNW A;  5IP6 A;  4LG0 A;  1QZZ A;  3S1M J;  2LG4 A;  4CH7 A;  4Y17 A;  3HB9 A;  5FKO A;  5HDG A;  1HCR A;  5DCM A;  4AYB N;  2R7U A;  1TW2 A;  2JK3 A;  5ERI A;  1ZQ3 P;  5AIP A;  2IGN A;  2IGO A;  4G9Y A;  4P5O A;  3A4C A;  3LQQ A;  2DT7 B;  4R8H A;  2VOP A;  1MD0 A;  3SDB A;  3RKW A;  1YIT I;  1KQ0 A;  5H6R A;  3I54 A;  4MTD A;  2X51 A;  2CW0 F;  3TMO A;  1MND A;  3O3K A;  3S3O A;  3S17 J;  3RZD J;  4EQQ A;  2O0Y A;  2DK8 A;  2ZBK A;  2MGQ A;  4H4K C;  4NQW B;  3O8G A;  4PZJ A;  4GXO A;  2ZXI A;  4AID A;  1VQM I;  3RYR A;  2W57 A;  3L5Z A;  4EJO A;  4ZZD A;  3PUB A;  2XGX A;  3G3Z A;  5ICF A;  3ASN H;  1VQ5 I;  1Z7L A;  3I59 B;  4CCM A;  3GFJ A;  1IV6 A;  3OIQ A;  1ZRD A;  2R7X A;  2ZB9 A;  2EFO A;  2QKL B;  3MEX A;  3L2R A;  2LKP A;  3QPS A;  3RPU D;  3K4L A;  4G7O F;  2L9S A;  4S05 A;  1XLR A;  1F4K A;  2GIV A;  1Y0N A;  4HEA 2;  3I56 I;  4FQG A;  3FDY A;  5GPA A;  1HC8 A;  2DOE A;  2OZ6 A;  4GYI A;  1A6Q A;  3DU6 A;  1ORK A;  1RIO H;  3AAF A;  2YUS A;  4KT6 A;  4U87 A;  3RPQ A;  4E4H A;  4BJ6 C;  2X6Y A;  4CCJ A;  2R7F A;  3IRQ A;  1JKR C;  4IJA A;  2Y48 A;  5HS9 A;  5L3C A;  2LD5 A;  3HSR A;  4XLA A;  5FRM A;  2QUF A;  2KL4 A;  2MC4 A;  1KQ8 A;  1S3J A;  3S1Q J;  5JI6 A;  3KEY A;  3QOE A;  4UY8 I;  4PSX A;  5DUK A;  1GVJ A;  3F8L A;  1FP1 D;  2K4B A;  3C1D A;  4G6T B;  4ZC3 A;  4BE2 A;  1YE9 A;  1K6O A;  3KFW X;  3PIO F;  3DV8 A;  2A05 A;  1RNL A;  2WY8 Q;  4NC8 A;  3GTJ J;  1YJW I;  1BA5 A;  4XLN F;  1I5Z A;  4GYG A;  2XF5 A;  3VYR B;  3EDP A;  2Q8K A;  2F5D A;  2TCT A;  3OV8 A;  1Y56 A;  1D3Y A;  3JCU C;  4LK0 F;  4EJU A;  2HI3 A;  1GXQ A;  1MBK A;  1N77 A;  4ENJ A;  6PAX A;  3PFI A;  3E97 A;  1XMA A;  2F5F A;  1X2M A;  4DYQ A;  4DIQ A;  2KZG A;  3B02 A;  2M45 A;  4XR6 A;  3M7G A;  3IRR A;  1K7A A;  2R7T A;  1PUF A;  3DPU A;  5M5W J;  2E1O A;  1MJ9 A;  5F0F A;  1VQK I;  1IAW A;  4OU0 A;  4BDZ A;  4A3M J;  3QP6 A;  4I76 A;  3LNQ A;  2OPT A;  2PMZ A;  1WVR A;  2QQ8 A;  4ASN A;  1ZRC A;  3G1M A;  3FXU A;  1Y1V J;  2EIK H;  3GZ5 A;  4IRH A;  2F5C A;  1BBY A;  2PJR B;  4FCY A;  1B8I A;  2CQ7 A;  1V5G A;  1TNS A;  1TW3 A;  1ETX A;  2OV7 A;  1BI0 A;  3JRC A;  5JVG F;  5DTD A;  4E7S A;  4G6D A;  4B47 A;  4M3F A;  4OIP F;  1T6S A;  1S7O A;  5F08 A;  1KZH A;  4BEH A;  4AC0 A;  4LGW A;  2HQN A;  2TDX A;  5IPA A;  1P6R A;  4LB5 A;  2ZFU A;  4Y33 A;  3KLO A;  2VE8 A;  1BIA A;  2CV0 A;  2OU2 A;  3WTV C;  4DJA A;  1I3A A;  3GCM A;  2LY2 A;  3VB2 A;  1ZHF A;  2ZNY A;  5EF6 A;  1QZY A;  4I98 B;  2MW8 A;  1D0X A;  5F64 A;  2B7E A;  4IQ4 A;  4BKX A;  5EEG A;  1P2F A;  2HOA A;  2D45 A;  1ERD A;  1BI1 A;  1C0W A;  4KFC A;  4KN7 X;  5LFA A;  1HF0 A;  2IS4 A;  2LF7 A;  2OCE A;  1IV8 A;  2XUB A;  1X1A A;  3Q3S A;  5C4X J;  4L18 B;  2BOL A;  3ABL H;  4MFD A;  5F1J A;  3BQY A;  5LGN A;  2CV2 A;  3FHZ A;  4PCQ A;  5CVV A;  4HPQ A;  1POG A;  4EGY A;  1UB9 A;  5F6F A;  2L2O A;  5FD6 A;  1SD6 A;  2WTE A;  3AKZ A;  1QA6 A;  3BTC A;  1T56 A;  4Q4Z F;  5H2F C;  3GLL A;  3BG3 A;  4ZTJ A;  2AQE A;  3SQN A;  2DN0 A;  4HDU A;  3OIO A;  2DFF A;  3RKQ A;  1T8I A;  1YJ9 I;  3ZQG A;  2EIN H;  4U0V A;  5M3F J;  1JJ6 C;  3CC4 I;  3R4K A;  2XAF A;  1FX7 A;  2Y0S A;  4A5M A;  3EUA A;  4FT8 A;  3W2V A;  3MZH A;  1R4M B;  2L5Q A;  2R4G A;  1D1C A;  5DM6 F;  3NWS A;  1IF1 A;  3E6B A;  2FOW A;  4BS9 A;  3I64 A;  2CFO A;  4P1W A;  1GVD A;  1HW5 A;  1HXD A;  5C3E J;  4EJW A;  1FTT A;  2JVG A;  2R92 J;  4MHG A;  2ECC A;  3ZXS A;  5A2Q K;  2DTZ A;  4N4N B;  1IGN A;  1W0T A;  1N75 A;  3GXO A;  2EQR A;  4Q5S F;  1BC8 C;  2JJ7 A;  2OCC H;  3IH3 A;  2P7V B;  1EA3 A;  2HZT A;  1Z3X A;  3P9I A;  3KYC B;  2VN2 A;  2H8W A;  4A3J J;  3RPU A;  4KIF A;  3IHU A;  2VBX A;  3CUO A;  1IN6 A;  1X1C A;  2MLK A;  4MNU A;  1SMT A;  5IP9 J;  3M4O J;  2A6E F;  2Z16 A;  4ZTF A;  4IVN A;  1P4W A;  1YG2 A;  3KP2 A;  4I6Z A;  3CCR I;  1OYW A;  3HPG A;  1X3U A;  4HBL A;  2F4O B;  3GW2 A;  2LTP A;  1I1S A;  3EYY A;  1MBF A;  1OFC X;  2EFN A;  1IRZ A;  5D5U B;  4L9T A;  1TT8 A;  2NOJ B;  3OYB A;  1D1B A;  1YI2 I;  2DJI A;  2VQC A;  2DA4 A;  2XGD A;  1IN5 A;  3DPT A;  3JR9 A;  1JD3 A;  4LMY A;  1MDM A;  4IHV A;  1E0E A;  2DDB A;  3LST A;  3SEZ A;  1U5T A;  2AO9 A;  3AFH A;  4PUS A;  2GA2 A;  4D1Q A;  1G1B A;  5TIS C;  3LHE A;  2LY1 A;  2LNB A;  2UWM A;  3L2C A;  1FIA A;  2L9N A;  2Q2E A;  4Q47 A;  3JRI A;  2F5E A;  5L3B A;  1QGP A;  1F36 A;  4PGG A;  1EH6 A;  2M0M A;  2DO7 A;  2CUZ A;  3A0B C;  4ZSI A;  3ZCO A;  3WGG A;  1W5T A;  1B1B A;  3L2U A;  3LA7 A;  5FRN A;  3D5R C;  3V7R A;  3GTG J;  2OF7 A;  1OYY A;  3WGH A;  1RUO A;  3CCE I;  2PMH A;  1B9M A;  2E7X A;  2A61 A;  4E7L A;  2H8R A;  1BJZ A;  1JHF A;  2BY2 A;  2DA5 A;  1X19 A;  2MAB A;  1BC7 C;  3HOV J;  3HM5 A;  1P4X A;  2RVC A;  4Y7N J;  1OJL A;  5J8C A;  3HFI A;  3M1C A;  1YRN B;  3GEZ A;  1KU3 A;  5AIQ A;  3FXJ A;  3DEU A;  4J00 A;  1T98 A;  2ZJQ F;  5LRS A;  2A5W A;  3IL2 A;  4PJL A;  1AKH A;  1RET A;  3I5U A;  3F8C A;  2XGE A;  3BG9 A;  3X2Q H;  3E5Q A;  1GDT A;  3V8K A;  4NC6 A;  1G3W A;  3CDL A;  5HOO A;  4E7J A;  2E60 A;  1LQ1 A;  4G8X A;  3H3U A;  1HOM A;  3BTL A;  3MZ8 A;  4XKB A;  1TWG J;  4DOZ A;  3NRV A;  3DDV A;  5H6Q A;  2Z2S B;  3QPH A;  3CCQ I;  2HKO A;  1SVL A;  2FQ4 A;  4L5I A;  3VOE A;  2WAF A;  2DA1 A;  5D8K B;  1J9I A;  3BZK A;  5K7Z A;  3BY6 A;  2RQP A;  3OSG A;  1VQO I;  2FX0 A;  5EEA A;  3OWT A;  2X4H A;  4HLX A;  2PJP A;  1DQU A;  4N9H A;  3L2V A;  4ZYH A;  5D5W B;  3JRE A;  3A2K A;  3SDG A;  3SEQ A;  3ZQH A;  4PDK A;  4HV6 A;  3OY9 A;  1TL8 A;  1IRX A;  3EUK L;  4XNF A;  3BR3 A;  2E19 A;  1WFX A;  1WI3 A;  2QQ9 A;  3R6S A;  2Y75 A;  1KU2 A;  1WKM A;  2FEZ A;  2BVL A;  5HDN A;  1O3S A;  3TW6 A;  3HGY A;  4NQW A;  5E3N A;  5EGO B;  3QRF F;  2VBW A;  3EET A;  2L54 A;  3DU5 A;  4LIU A;  3RSN A;  1ENH A;  4IOC F;  2GQQ A;  1O3R A;  1FP2 A;  4NC7 A;  4W97 A;  3B6C A;  4U7B A;  2E5Z A;  3FMR A;  5IYC J;  4BAY A;  3DCF A;  5LRR A;  2BGC A;  2KIQ A;  3I59 A;  2M7A A;  3BTJ A;  2M8G X;  2F4I A;  1MBE A;  4P55 A;  3BCA A;  4XID A;  1ETW A;  4B4C A;  4XMY A;  4B43 A;  2L01 A;  4BHP A;  2XGC A;  4GCV A;  2O8X A;  1IUF A;  2VBZ A;  1LUJ B;  2EZH A;  2JA6 J;  1JE8 A;  2R5Z B;  3CCY A;  3GTP J;  1D1A A;  3ABT A;  4DBR A;  4HG2 A;  4YFK F;  3RTR A;  3CME I;  1O7F A;  4AVZ A;  2HDD A;  4XRS A;  3WGI A;  2OGG A;  2QYO A;  3OR2 C;  2E1C A;  3GFI A;  4M3D A;  1H8A C;  1KON A;  2HU9 A;  3B73 A;  2QSG X;  3D0S A;  3QPT A;  1U2W A;  3FBI B;  1LFP A;  3KEO A;  1SD4 A;  1Z6T A;  3T1B A;  3HZJ A;  3OYM A;  2EB7 A;  1ITY A;  1OYI A;  1MJB A;  2QM3 A;  3PFY A;  1G2H A;  4ZYD A;  3GZ6 A;  1ON2 A;  3T8T A;  3S3M A;  4A3K J;  2HYG D;  1S29 A;  2JRM A;  5HNH A;  2OQG A;  1SAN A;  4JQF A;  1NG6 A;  4M6V A;  1DDN A;  3BJ6 A;  2H1L A;  3R0A A;  4G7H F;  2B9S A;  1R7J A;  4UB6 C;  4C3I J;  3BR2 A;  2UV1 A;  2M4G A;  3E5X A;  4B3A A;  2Z99 A;  4B8X A;  1YS6 A;  3ZMS A;  4XSZ F;  3V42 A;  2E35 A;  3VWB A;  1XGN A;  2K27 A;  2HYJ A;  3U1D A;  1N78 A;  4U7D A;  1OCO H;  3BPX A;  4J01 A;  1G4D A;  3GLX A;  2QSH X;  1ZTR A;  4ZYG A;  1JT6 A;  4EM2 A;  4BUP A;  3KP6 A;  2VJJ A;  1Y8R B;  3CCL I;  1SC7 A;  3K10 A;  3HHH A;  1TQM A;  4AU7 A;  3BP8 A;  3HOU J;  2BZT A;  4XQF A;  2BHY A;  5J1Y A;  3L2W A;  1WJA A;  2V79 A;  5J3L A;  4E7H A;  4MGR A;  3FBN B;  2EWN A;  1MJA A;  3RCO A;  1UMQ A;  4WCG A;  4EEF G;  3KLN A;  4I2O A;  4YFX F;  3EUH A;  2ELK A;  5KAI C;  1DU6 A;  2GXA A;  2QKM B;  2ZSH B;  2NVT J;  1K83 J;  1IRF A;  4KIC A;  4J19 A;  3AL0 C;  4RM2 A;  1MKM A;  2IRF G;  3OOP A;  5K7H A;  1CGP A;  4OIQ F;  1LFU P;  4MEX F;  1UG2 A;  2KJB A;  1P7I A;  3F8M A;  5TGT A;  2HVR A;  1D8J A;  3M8J A;  3IWZ A;  2PJR A;  3IH4 A;  2PQ8 A;  3DTK A;  3ESW B;  1YX5 A;  3OL3 A;  3GTL J;  2X1D A;  1U9O A;  4XLF A;  4X0G A;  1TLH B;  1Z77 A;  3CP8 A;  2E2I J;  2WB1 A;  4KJZ A;  3N4M A;  2R7R A;  3CZ6 A;  4KIB A;  2JN6 A;  4S0H B;  5K5R A;  2NNY A;  3BCB A;  1Z9C A;  5IY5 H;  4AIK A;  3O8H A;  1LJ9 A;  3KP3 A;  1JGG A;  1FLI A;  4L0Z B;  4MTE A;  4UVC A;  5DD8 A;  2QQB A;  1YOV B;  2Y9Z A;  5K5Q A;  2K4J A;  2LBF B;  1FMW A;  2D5V A;  2MH2 A;  1FY7 A;  3HYI A;  2XKO A;  1I3Q J;  3HC7 A;  2XV4 S;  2IXS A;  2CW7 A;  3DBH B;  2DI3 A;  1I1G A;  3DKY A;  2Z1D A;  1GV5 A;  3A03 A;  3H36 A;  2DFE A;  4O5V A;  1OIS A;  4F7Z A;  1DP7 P;  4HX4 A;  4I02 A;  3PJR A;  3TOB A;  3HKZ A;  2VXZ A;  4HX7 A;  5D6E A;  2ELJ A;  1FNN A;  4XON A;  4II3 A;  3V8L A;  2O6G E;  3A01 B;  5EZG A;  3I4N J;  5DS9 A;  4MLO A;  2DMN A;  4PGH A;  4XIC A;  3LWF A;  1WI9 A;  1X1P A;  2L7F P;  5GAD J;  2OZU A;  3GFL A;  5F0C A;  4UB8 C;  4GFB A;  2BV6 A;  2X6X A;  2FML A;  2VC0 A;  4OWR B;  1WJ5 A;  3F8N A;  2MSY A;  2K9M A;  2LRD A;  4BDY A;  1Z67 A;  3MMY B;  2JPC A;  2WAD A;  1KGS A;  5GAH J;  1BR2 A;  2LK2 A;  2V9V A;  3BR5 A;  2H6B A;  2RAE A;  2HOE A;  4IRG A;  4ENN A;  1YJN I;  4L0Y B;  1R58 A;  2CQQ A;  2CO5 A;  4JP0 A;  4I99 C;  1QNT A;  2V7F A;  2R93 J;  2XRL A;  2CSO A;  3JSO A;  1ZLK A;  2JA2 A;  2ISY A;  2OUM A;  1JUM A;  1BOB A;  1WPK A;  3TOA A;  1HW1 A;  3WTS C;  4JK1 X;  1GUU A;  3KZZ A;  2DQL A;  3OYH A;  3ECH A;  3J7Z I;  2MLG A;  1QVU A;  1XSV A;  2A3S A;  4RM3 A;  2HPM A;  3RYP A;  3WU1 B;  3OR1 C;  1V5E A;  3SFI A;  3F22 A;  2N8G A;  3S2W A;  4PJN A;  2NAZ A;  2XPU A;  5BQT A;  2QWW A;  2HR3 A;  3HOT A;  2PLY A;  1XCB A;  4IEJ A;  1SFK A;  4BJT A;  4D5C A;  4AM3 A;  3S15 J;  2M5W A;  1F9N A;  1FOY A;  1A6I A;  1W1W E;  2L02 A;  3C18 A;  1WJD A;  2ZJ2 A;  4QPO A;  1EV7 A;  2KLO A;  5DV5 A;  2P6T A;  4A69 C;  2O9L A;  1LDD A;  3ONQ A;  5CLS A;  1YW7 A;  5FFX A;  1I39 A;  1ODD A;  3CMM A;  3K7A J;  4CA0 A;  1G59 A;  2W24 A;  2CYY A;  4RS8 A;  2ZXH A;  2FA5 A;  2MG4 A;  3ZMD A;  3JRA A;  4KA4 A;  1T33 A;  4Q48 A;  4RGR A;  4GDF A;  3BZ6 A;  2I5U A;  3A02 A;  4CCO A;  1SFU A;  4JX6 A;  4XSX F;  2MC3 A;  2I10 A;  3HL2 A;  2NOG A;  1AWC A;  2LR8 A;  4CCN A;  2QEN A;  1VTN C;  2XB5 A;  2W82 A;  2BE5 F;  1FW9 A;  2DT5 A;  1TWH J;  1W4M A;  1XCV A;  2EA4 A;  3KZY A;  3ZQI A;  5HS8 A;  5KCM A;  1QU3 A;  5L3G A;  2R5Y B;  3C2B A;  4F55 A;  3IC7 A;  1G3Y A;  2GOM A;  1E3O C;  3K9T A;  5M5Y J;  2P8T A;  2IA0 A;  1ETQ A;  1CF7 B;  2PFB A;  1EF4 A;  2X1C A;  1ONV A;  4X1E A;  2A6H F;  5TRD A;  2V6C A;  1X1B A;  1FC3 A;  4FE4 A;  3ZN1 A;  1S9H A;  3Q9V A;  3TL4 X;  2KZV A;  3LSG A;  2E1N A;  4UVB A;  3VDX A;  2DCE A;  3WTX C;  4BHB A;  4XN3 A;  5M3M J;  2ISZ A;  1KQ9 A;  5ICG A;  4L9N A;  4RAF A;  2A5Y B;  2FE3 A;  3H9G A;  4KNY A;  1SFX A;  2DA6 A;  2GBY A;  1XSX A;  3KET A;  1WQ2 A;  4M3E A;  2H1K A;  3AG4 H;  2XSJ C;  2Z9O A;  1BM9 A;  1FBS A;  2VIX A;  2AHC A;  3CO6 C;  2KIF A;  5HLI A;  3J7Y J;  2WAE A;  4CHU A;  3SHF A;  3GFM A;  3GO5 A;  3WG7 H;  1WJF A;  4B44 A;  1LKX A;  4BU2 A;  4HZF A;  3PL8 A;  5L3F A;  1MH4 A;  1BI3 A;  5ED4 A;  1YRN A;  4G6Q A;  4DZJ A;  5A2Q Z;  1W36 C;  5D5X B;  1Z7U A;  4HYE A;  3BOQ A;  4CIC A;  3KYL A;  4IHY A;  2V4J C;  2M0C A;  5LEJ A;  2ACJ A;  3QU3 A;  5HLT A;  4ENM A;  2IBD A;  2EBI A;  4LG3 A;  4GGG A;  3F8F A;  3D5S C;  4ZDL A;  4FET A;  4LB6 B;  3HSE A;  2EA2 A;  2Y0S N;  2ZME C;  3CCM I;  3LSM A;  1T0F C;  2HYF A;  1XGM A;  3T5X A;  3ZMZ A;  5IP7 J;  4A3I J;  3E3V A;  2E5N A;  4YIR X;  4MQV A;  1MBH A;  3M1E A;  4XKC A;  4UNO A;  3SJM A;  2W85 A;  3OYI A;  1U0J A;  1SFE A;  3LMM A;  3O6B B;  1QHH D;  2HXO A;  4KIT B;  2IAI A;  3CC2 I;  4JOM A;  2UZK A;  1M1E B;  2CJJ A;  3ZQC A;  1YO5 C;  2CMP A;  1E2X A;  2DYS H;  1OQY A;  2GWR A;  2EZK A;  5E1X A;  9ANT A;  4ZZL A;  2DBB A;  5LEK A;  2H09 A;  4XRM A;  5F0H A;  3CO7 C;  5LHI A;  1LFB A;  2HGC A;  1VQ7 I;  1L0O C;  2KT0 A;  3HEF A;  3R60 A;  1H88 C;  2XVC A;  1B72 B;  3MKY B;  2VJ4 A;  4IO9 F;  2BXY A;  3IKV A;  3WHC A;  2RA5 A;  1HKT A;  3H9J A;  2K9Q A;  1FYL A;  1WJB A;  4LLN A;  1A04 A;  3FZV A;  3Q0U A;  1TQI A;  5C4J J;  1OLT A;  2CFX A;  4YEL A;  2DMU A;  1Y8Q B;  3CUQ C;  4BQQ A;  4EJV A;  3SZP A;  1Y6I A;  4FHT A;  3TED A;  4P9U A;  2CU7 A;  2ID6 A;  1SAX A;  2VPR A;  3HOS A;  5EGO A;  1HLV A;  3JSP A;  1E3H A;  1D8K A;  2L0K A;  2ME0 A;  2DYR H;  3E5U A;  1U6G A;  4O3M A;  2DAO A;  2P0W A;  1N25 A;  2DOF A;  2EJR A;  1U8B A;  2DA2 A;  3VSL A;  3PNT A;  4A0Z A;  1S6L A;  2XAG A;  2VI6 A;  2HKX A;  3K70 C;  3IAM 2;  2E2H J;  3GZN B;  3RKX A;  4CYC B;  3WOD F;  4BQO A;  2HXI A;  1JKP C;  2WV1 A;  1XGS A;  2WAQ A;  1YHQ I;  4OAY A;  1S7A A;  2DOD A;  3MWM A;  2R5Z A;  4D5F A;  1R1V A;  4DW6 A;  2MBF A;  2KDO A;  2V9K A;  3K4M A;  2ZFW A;  2K40 A;  4IHT A;  4F93 B;  1FPQ A;  4HNT A;  1UZC A;  1A5J A;  3OYF A;  3K70 D;  1EKE A;  5F27 A;  1RUN A;  3J80 K;  2EFQ A;  3IH2 A;  1YW9 A;  2F4M B;  4BY7 J;  1ULY A;  2OTL I;  5J1R A;  4ENK A;  3KEQ A;  2HOS A;  1OKR A;  3PQK A;  2VKH A;  1P4A A;  4CO8 A;  2K5C A;  3NAU A;  4N0B A;  3OS0 A;  1R36 A;  1J7K A;  5BPD A;  3LAP A;  5H20 A;  4BXX J;  3FKJ A;  2CQK A;  4QWQ A;  3F9K A;  3HTS B;  4ZSB A;  4HDV A;  3S2H J;  3AG2 H;  5K7F A;  2VOD A;  4UV8 A;  2OBP A;  4RAG A;  2HWV A;  3AG1 H;  2VT3 A;  1LB2 A;  4RBO A;  2XAQ A;  1FSH A;  2VON A;  1J5Y A;  1BR4 A;  1X3Z B;  1LEB A;  1S7E A;  1NHA A;  2WC2 A;  1WH7 A;  1Y1W J;  3GTK J;  4HQM A;  2EV0 A;  4C9Y A;  1SVM A;  2XRN A;  3MZY A;  4B1R A;  4HST A;  3TP0 A;  3K2A A;  4KIG A;  2BW3 B;  2LYC A;  3MFK A;  3C3W A;  1R5G A;  2KHM A;  5FRO A;  3K2Z A;  1JUS A;  3M9A A;  4F92 B;  2Q1Z B;  3LSJ A;  1I50 J;  1TT0 A;  2X85 A;  2HPI A;  3CCU I;  2QF7 A;  1R49 A;  1ZK8 A;  2EK5 A;  3V7S A;  1G81 A;  1BL0 A;  2EFP A;  3S1N J;  2EZI A;  3FMS A;  1FZP B;  3U1K A;  5J4Y A;  4Y3O A;  5J1U A;  3W2W A;  1YLF A;  3QYF A;  5FKL A;  1V54 H;  4BH9 A;  1VZ0 A;  3SZG A;  1TNT A;  2RNJ A;  5HOD A;  5FJ8 J;  2Y0M A;  4XBF A;  3HGG A;  2QSF X;  3GVA A;  3F6O A;  2X48 A;  3BPV A;  2JRT A;  4D0P A;  3CD6 I;  2HVQ A;  3IV5 A;  2V6E A;  1IDZ A;  5HVQ C;  1X58 A;  2ECB A;  3T8R A;  1RZ4 A;  1YFH A;  2XDV A;  3ZQL A;  1ZN2 A;  4A0Y A;  5GTH C;  1MSF C;  2J5O A;  3CF5 F;  4M3G A;  3LAJ A;  3PQJ A;  3WE3 A;  2FU4 A;  3BQZ A;  1HSJ A;  4CYD A;  4V19 K;  2H94 A;  1D5V A;  1OCP A;  4MQ9 F;  1R1T A;  5E3L A;  3KPH A;  3HSF A;  2LBF A;  2O61 A;  5ILU A;  3HOX J;  3OL4 A;  4L9J A;  5CVJ A;  5FLV A;  4C3H J;  5IT3 A;  4QTR A;  2CQN A;  1JKQ C;  4BBS J;  4V2F A;  1S72 I;  2Y31 A;  4M9S A;  4UHT A;  3FHN A;  2W4S A;  1IN4 A;  4ZDO A;  4A3C J;  3HTU A;  2FXA A;  3P9K A;  2QZ8 A;  3OS1 A;  1LVK A;  4C30 A;  4AIJ A;  1ZRE A;  2W84 A;  3CJN A;  5J40 A;  4XLP F;  4FE7 A;  4XL9 A;  3BLY A;  2Z5U A;  2E2J J;  4IHW A;  3K6G A;  4CZZ A;  2DMP A;  1OCC H;  3DFG A;  3DPL C;  3F3X A;  3KP5 A;  4MEY F;  5FB2 A;  1T39 A;  4IHS A;  3KX2 A;  2AQF A;  1A31 A;  1W5C C;  4BXF A;  4IXA A;  4O6J A;  4BNC A;  1IRG A;  3A01 A;  5DCF A;  5FLM J;  1K4S A;  1T0F A;  4HV5 A;  4R79 A;  3ABM H;  1VI0 A;  1MZB A;  1YX3 A;  3JRH A;  2BY3 A;  2QCO A;  2FSW A;  2ICW G;  3IWF A;  5EYR A;  3KZI C;  1UAA A;  1HKQ A;  4Y52 J;  2GM4 A;  4OIO F;  2JQ7 A;  2IT0 A;  2HQ5 A;  3HRT A;  3OYG A;  4L9V A;  2FMY A;  3RQ4 A;  3S1R J;  2AXT C;  4A93 J;  3TQN A;  2YR2 A;  1ON1 A;  3V4G A;  3SZT A;  3MCZ A;  2KRC A;  5K5O A;  5CPR B;  1KYW A;  4K2E A;  3OYD A;  2IS2 A;  2TRT A;  4A3B J;  4LIV A;  1RC9 A;  2KIU A;  2W25 A;  1YS7 A;  4P96 A;  5EZH A;  2E7W A;  3MAJ A;  5AON A;  5B66 C;  3ZN0 A;  1UHS A;  4LLG F;  2R7W A;  2KFD A;  2DFH A;  3HXL A;  4MFE A;  4ETS A;  3AL0 B;  2GZW A;  1D0Y A;  3JRF A;  5J4V A;  1SFO J;  3S3N A;  3D5L A;  2Z33 A;  1KYZ A;  3DKX A;  4U0Y A;  3BG7 A;  4BBR J;  4B09 A;  1UEL B;  1JTX A;  4BHC A;  4RB1 A;  3TDU C;  2PX9 A;  4A12 A;  5EG0 B;  2ZC2 A;  3W3C A;  1SD5 A;  4UXN A;  3FXR A;  2GA1 A;  4JBA A;  2DPU A;  2R7V A;  2ZSI B;  2BEO A;  3V7C A;  1W0U A;  3H5A A;  5IOY A;  2WB1 N;  3TO7 A;  1F5T A;  5BS6 A;  2DA3 A;  1FJL A;  4WF2 A;  5GAG J;  5JHF A;  4XK4 A;  2OJE D;  2R5Y A;  3ZQ7 A;  2JWT A;  3F23 A;  3JRB A;  5IT9 K;  3OIP A;  4HAM A;  2YX4 A;  1HQC A;  2QA4 I;  1CF7 A;  2KIM A;  2P5K A;  2IA1 A;  2LFB A;  2B63 J;  3HIF A;  4GO1 A;  4ON0 A;  3CMY A;  1ZYR F;  4KT5 C;  3OSF A;  3QOD A;  1HDP A;  1IO2 A;  2WBM A;  1BOA A;  3FX3 A;  1MGT A;  5D4S A;  2VB6 A;  3G2B A;  3EYI A;  3QOP A;  2QVO A;  3HKZ N;  1DP3 A;  1J59 A;  3LA2 A;  2XHK A;  3EPZ A;  2NS7 A;  4A0X A;  5JHU A;  2YU3 A;  4BXU A;  4H0E A;  1MMD A;  3G73 A;  4BQA A;  1ETV A;  3L1P A;  3U21 A;  2ME6 A;  3IP4 B;  3H5R A;  3ZMU A;  4E7Z A;  2NNN A;  4C2M J;  3ERM A;  2PN6 A;  1RR7 A;  3LFK A;  3CCV I;  4ESB A;  4M3B A;  1K78 B;  2P4W A;  4AUX A;  2IP2 A;  2R0Q C;  1SVO A;  4M9X A;  1LE8 B;  3OYN A;  2L7K A;  4NBQ A;  5E79 C;  2BY0 A;  3DTI A;  1ZGA A;  3DBL B;  1W5S A;  2NVY J;  3EQL F;  3NWT A;  2AHQ A;  1DGR M;  1EH7 A;  4TV7 A;  5E20 A;  4HF1 A;  3LQR A;  4WXD A;  4KMU X;  3CLO A;  1DU0 A;  1F43 A;  1E3P A;  4JX5 A;  5ILS A;  2EPF A;  4HF2 A;  5L3E A;  2OC6 A;  3G6E I;  4A3E J;  3TO9 A;  1MMG A;  3F0C A;  3NAR A;  1B72 A;  2JSC A;  4WK8 F;  1QPM A;  1QRY A;  3FIS A;  2V26 A;  4N9I A;  3K1N A;  1QZE A;  2RC4 A;  3HOY J;  2EZL A;  3WTZ A;  4A6E A;  5B3S H;  1SEU A;  1APL C;  1WJE A;  2V1N A;  4XOT A;  3Q5F A;  2FNA A;  2RGV A;  3E6D A;  1QBJ A;  2R7Z J;  4NDL A;  4HOB A;  3WTT C;  1KA8 A;  2QLZ A;  3FK6 A;  2CGP A;  1U9N A;  1P7J A;  4QLC U;  1RPW A;  2EIM H;  2Y9Y A;  4EM0 B;  4LOC A;  1LDK B;  3WHB A;  3CJR B;  4I0B A;  4ZJZ A;  1NG7 A;  4ZYA A;  2ELH A;  1OMI A;  3N05 A;  4LLL A;  4BAC A;  2IKK A;  4N4O B;  2H27 A;  4RLQ A;  2NS0 A;  5LBQ A;  4UUT A;  3GWZ A;  3PNY A;  3PSI A;  1TWF J;  3M3Y J;  4CYC A;  2WV0 A;  3A1Y A;  3LSP A;  2KDZ A;  2LVS A;  4WXC A;  3E6C C;  2O03 A;  1FYK A;  3FXL A;  1YIJ I;  1Z91 A;  1K79 A;  1B6A A;  2F5V A;  3TBI A;  3JRD A;  2O7O A;  2CH0 A;  3L00 A;  2GXB A;  3ROU A;  4PJM A;  3RI4 A;  3H3V K;  5HLH A;  3W6V A;  2OA4 A;  3M8F A;  4XKV A;  2V1U A;  1HST A;  3LL7 A;  1HDD C;  2R7D A;  4HRI A;  1JHH A;  4XRF A;  3ZRG A;  5BOX A;  2NVQ J;  1UFM A;  4UVA A;  5LD2 C;  2NVX J;  1ZKG A;  1RRJ A;  2FBH A;  2PEX A;  3QYE A;  2QQA A;  3REO A;  3LSH A;  4UUS B;  4X6A J;  4FAS D;  1TP4 A;  1DGW Y;  1E17 A;  1OCZ H;  4NUB A;  1BJA A;  3E0J B;  3DWL E;  1GT0 C;  1YW8 A;  4AD9 A;  3VEP A;  4OMY A;  2ZME B;  3ULQ B;  5JVT A;  2R7O A;  3OS2 A;  2GOX B;  2BBY A;  2XAS A;  3QQA A;  3QYB A;  2DXI A;  3H3Z A;  3DXJ F;  2XAJ A;  2DA7 A;  4HQE A;  1TQP A;  1JXS A;  4CCK A;  1K4T A;  1XSD A;  1T2K A;  2CRG A;  1FOX A;  1QHG A;  2J5P A;  4XOP A;  2HNH A;  1Z6R A;  2YU9 J;  4RAY A;  5JLX A;  2HOT A;  3JW4 A;  3C2G A;  3NEU A;  5ICE A;  2VL8 A;  2DK5 A;  4CZC A;  4A3D J;  3QAH A;  3VOD A;  4ZSK A;  1ZGJ A;  2KIS A;  4C2U A;  1R5I D;  2EIJ H;  2BW3 A;  4ZDP A;  3CLQ A;  1LEA A;  2EIL H;  5TJJ A;  3PM1 A;  3IKT A;  4RDU A;  5FFZ A;  1HKS A;  1MMS A;  4BQN A;  3HDD A;  4YII A;  1ZG1 A;  4E7I A;  3OYC A;  2XIG A;  2IS6 A;  3RJP A;  1HBX G;  3DKW A;  3CUQ B;  1T38 A;  4BYY A;  1JUP A;  3HPH A;  1S5L C;  2JVH A;  2R3S A;  4HNV A;  3KE2 A;  3KCC A;  3GTO J;  3ASO H;  4XLE A;  1P92 A;  3E1S A;  1S8N A;  2HEO A;  5CJ9 A;  3VYT B;  3KP7 A;  4ZH4 F;  4EJT A;  1ZAO A;  2GXG A;  1UST A;  1G6N A;  3S2D J;  3CMA I;  4A6D A;  3L7W A;  5M5X J;  4HLY A;  3SXY A;  1G3T A; 
#chains in the Genus database with same CATH homology
 3HHG A;  2FBI A;  3J80 Z;  1O3T A;  5F1R A;  4CGZ A;  4EVI A;  2IVM A;  4CDG A;  4RGX A;  3COA C;  1BN5 A;  5J8F A;  3JAM K;  2STW A;  1XB4 A;  2RN7 A;  3GUD A;  1JGS A;  1U8R A;  5KVR A;  1XDU A;  2JPB A;  3K0L A;  4DQ2 A;  2P6S A;  2VBY A;  4ZYE A;  3ZMV A;  2DPD A;  1XN7 A;  5DDG A;  1FWZ A;  3DF8 A;  4KN4 X;  1XGO A;  3ISP A;  2EFW A;  2A07 F;  2MH9 A;  5LHH A;  5HLG A;  4UV9 A;  4E70 A;  2K02 A;  2HTJ A;  3W6K B;  1LVA A;  2G9W A;  4RB3 C;  3HRM A;  2M8E A;  3LA3 A;  1U5T C;  3TDZ C;  2QBY B;  2PI0 A;  4KYW A;  4NHJ A;  4I09 A;  4EGZ A;  3QU6 A;  4AWX B;  4YG2 F;  2L4A A;  4M73 A;  2Z3Y A;  4U0W A;  3O2P E;  2M1B A;  5K1Y A;  4M6X A;  3U2R A;  1B59 A;  3R61 A;  5LGT A;  1YYV A;  5D8L B;  1ZH5 A;  1WRJ A;  3I4P A;  1Q1H A;  1H0M A;  3GF2 A;  1I6X A;  2F2E A;  3L09 A;  4WXH A;  1V4R A;  5DUI A;  4RB2 C;  5JFR A;  2NRA C;  1BIB A;  1O7L A;  3RDI A;  2ESN A;  2JT1 A;  4Z2Y A;  2VE9 A;  1Z05 A;  3FM3 A;  1R1U A;  2WWY A;  4G94 A;  3FF5 A;  1BI2 A;  1H9G A;  3CTA A;  1DPU A;  4AIH A;  2ZXJ A;  5CVR A;  2COM A;  3I0T A;  5CVU A;  1W7P B;  2X0L A;  3TGN A;  5HDK A;  1WSU A;  4OIN F;  1HW2 A;  2ZO4 A;  5BMZ A;  1K78 A;  2H6C A;  4CXF A;  2YSR A;  2ADU A;  1FT9 A;  5DYM A;  2DLL A;  2OOI A;  3BDD A;  1YTY A;  2FBK A;  2PKH A;  2P7C B;  3ABU A;  2IPQ X;  1PP7 U;  5IT9 Z;  2OD5 A;  3DQV C;  1B4A A;  3F72 A;  2UXN A;  3CNV A;  4KMF A;  2L3D A;  1U78 A;  3I58 A;  3FM5 A;  2IW5 A;  5ICC A;  3J81 Z;  2DW4 A;  2UXX A;  3J7A O;  2FA1 A;  5LGU A;  4EM1 A;  4EMS A;  5E8I A;  4FX0 A;  3JTG A;  2EV6 A;  2M87 A;  1EH8 A;  1U3E M;  1ZRF A;  1IXC A;  1PP8 F;  4LG0 B;  1ZG3 A;  3TO6 A;  4OIR F;  1KU7 A;  1IUY A;  1R23 A;  5D6F A;  1YIO A;  5DCM B;  3H92 A;  2HDC A;  4M6Y A;  2K7L A;  2DTR A;  3R0J A;  3ZMT A;  3KP4 A;  3F21 A;  2O3F A;  4YFN F;  2L4M A;  2D2W A;  3DP7 A;  2ZME A;  2ZKZ A;  1STZ A;  1AOY A;  1UHW A;  3ECO A;  1SD7 A;  4G7Z F;  1L3L A;  1FBU A;  4ESF A;  2OAZ A;  2PG4 A;  3E6M A;  1TTY A;  2DFI A;  1REP C;  4I0A A;  1OR7 A;  4I01 A;  3BRO A;  3FXQ A;  3VFZ A;  1XDS A;  2GAU A;  1OPC A;  1I27 A;  5FLX Z;  2PMU A;  5D4R A;  1F1Z A;  1W7P D;  3CUQ A;  4HW0 A;  3T0Y A;  2CG4 A;  5ILV A;  1Z1D A;  3N97 A;  2NWI A;  4IF4 A;  5FD5 A;  1PUE E;  3CDH A;  3MQ0 A;  3HRU A;  2ZCW A;  4LK1 F;  1GHC A;  1O57 A;  2CWE A;  3WTY C;  2STT A;  1IW7 F;  2RKH A;  2BYV E;  3WTW C;  5L3D A;  4WWC A;  2HS5 A;  2XAH A;  1UHM A;  2RDP A;  2FQ3 A;  2PBI A;  1QO0 D;  3K1P A;  1WWX A;  4YIF A;  2LDU A;  4OMZ A;  2G7U A;  2FNP A;  4OOI A;  3FMQ A;  3K1M A;  4M74 A;  3ML6 A;  2D1H A;  3L9F A;  4RB0 A;  3F6V A;  3WU0 A;  2IJL A;  5FO5 A;  3J81 K;  4I7H A;  1LDJ A;  2A68 F;  5JR3 A;  1J0R A;  2B0L A;  2HFH A;  2NYX A;  1R5H A;  3RKY A;  2M30 A;  2G7H A;  2V1D A;  5BPI A;  1QQI A;  4RGS A;  1ZLJ A;  3P9C A;  5LHG A;  1FSE A;  5J6X A;  2ZNZ A;  5FGM A;  5E1W A;  4WX9 A;  2IA2 A;  1USS A;  3W6J B;  4DNC A;  2QBY A;  4KDP A;  4LD5 A;  2XRO A;  1FBQ A;  1J2X A;  4A5N A;  1RI7 A;  4HF0 A;  4Y15 A;  3BWG A;  4NB5 A;  5CYV A;  2AXL A;  3TKY A;  3GYH X;  5E18 F;  2A69 F;  3WE2 A;  2ESH A;  1XD7 A;  2Q0O A;  4S04 A;  4A2U A;  4R1H A;  5HS7 A;  5DEQ A;  1PDN C;  1XMK A;  5LLQ A;  3JAM Z;  3HUG A;  1IZ1 A;  4FX4 A;  3ERE D;  5DD4 A;  1DUX C;  2DQR A;  5D5V B;  1H9T A;  2P5L C;  1V3F A;  2VT2 A;  1ZG5 A;  3ZP5 A;  1G3S A;  4U88 A;  2AS5 F;  3K69 A;  3RIR A;  5FLX K;  1GXP A;  2VC1 A;  3ELK A;  1Y0U A;  2JTV A;  4M72 A;  2P19 A;  5E8G A;  2V1X A;  2KJC A;  3SFZ A;  2LF8 A;  4UUV A;  3NQO A;  2MD5 A;  5E17 F;  1J75 A;  1ZAR A;  4AVP A;  4RGU A;  2KKO A;  3WTU C;  1FOK A;  3FWE A;  3Q9S A;  1IN8 A;  1UCR A;  4KUM A;  3P7N A;  1SMY F;  3WG9 A;  2YX7 A;  3C7J A;  1W7P A;  3I71 A;  2C6Y A;  3ZPL A;  2FRH A;  3I53 A;  1MDM B;  2ETH A;  1U5T B;  3JTH A;  5E1Z B;  3V8J A;  1YQA A;  1KU9 A;  2FOK A;  2YPR A;  2EV5 A;  1TBX A;  5CVI A;  4HX8 A;  2P5V A;  4P9F A;  1IXS B;  3BJO A;  1DPR A;  4L5J A;  2LSO A;  1B9N A;  3HRS A;  2HQR A;  4EV0 A;  2JZY A;  1R22 A;  4Y13 A;  3GX4 X;  2HTS A;  4LFU A;  4RAZ A;  4IRI A;  3M8E A;  2DU9 A;  1R00 A;  2FF4 A;  3QP5 A;  3BJA A;  2VOO A;  4IPA A;  4ESJ A;  2D1V A;  2MA3 A;  2OQR A;  2K86 A;  4M71 A;  1O3Q A;  4HA8 A;  1IXR C;  1IN7 A;  1FYM A;  4LJZ F;  4M9Z A;  2RV8 A;  2XKP A;  5KK1 A;  3F8B A;  3U9G A;  5EEH A;  2KRF A;  1LNW A;  4LG0 A;  1QZZ A;  4Y17 A;  5HDG A;  5DCM A;  1TW2 A;  5ERI A;  5AIP A;  4G9Y A;  4P5O A;  3LQQ A;  4R8H A;  2VOP A;  1MD0 A;  3RKW A;  1KQ0 A;  5H6R A;  3I54 A;  4MTD A;  2CW0 F;  3O3K A;  4EQQ A;  2O0Y A;  2DK8 A;  2ZBK A;  4PZJ A;  4GXO A;  3RYR A;  2W57 A;  3L5Z A;  4EJO A;  4ZZD A;  2XGX A;  3G3Z A;  5ICF A;  3I59 B;  3GFJ A;  1ZRD A;  2EFO A;  3MEX A;  2LKP A;  4G7O F;  4S05 A;  1XLR A;  1F4K A;  2GIV A;  2OZ6 A;  4GYI A;  1RIO H;  3AAF A;  3RPQ A;  2R7F A;  3IRQ A;  4IJA A;  2Y48 A;  5HS9 A;  5L3C A;  3HSR A;  2QUF A;  1KQ8 A;  1S3J A;  5JI6 A;  5DUK A;  1GVJ A;  3F8L A;  1FP1 D;  2K4B A;  3C1D A;  1K6O A;  3KFW X;  3DV8 A;  1RNL A;  4XLN F;  1I5Z A;  4GYG A;  3EDP A;  2Q8K A;  2F5D A;  3OV8 A;  1D3Y A;  4LK0 F;  4EJU A;  6PAX A;  1GXQ A;  4ENJ A;  3PFI A;  3E97 A;  1XMA A;  2F5F A;  3B02 A;  2M45 A;  3IRR A;  3M7G A;  1K7A A;  1MJ9 A;  1IAW A;  4OU0 A;  3QP6 A;  4ASN A;  1ZRC A;  3FXU A;  3GZ5 A;  4IRH A;  2F5C A;  1BBY A;  1TNS A;  1TW3 A;  1BI0 A;  4G6D A;  4OIP F;  1T6S A;  1S7O A;  4LGW A;  2HQN A;  2TDX A;  1P6R A;  4LB5 A;  3KLO A;  2VE8 A;  1BIA A;  2OU2 A;  3WTV C;  3VB2 A;  1ZHF A;  2ZNY A;  1QZY A;  4I98 B;  5F64 A;  5EEG A;  1P2F A;  2D45 A;  1BI1 A;  1C0W A;  4KFC A;  4KN7 X;  2LF7 A;  2XUB A;  4L18 B;  5LGN A;  3FHZ A;  4PCQ A;  5CVV A;  4EGY A;  1UB9 A;  5F6F A;  5FD6 A;  1SD6 A;  2WTE A;  4Q4Z F;  3SQN A;  4HDU A;  4U0V A;  3R4K A;  2XAF A;  1FX7 A;  4A5M A;  4FT8 A;  3MZH A;  1IF1 A;  3E6B A;  3I64 A;  1HW5 A;  1HXD A;  4EJW A;  4MHG A;  5A2Q K;  3GXO A;  4Q5S F;  1BC8 C;  2P7V B;  2HZT A;  3P9I A;  2VN2 A;  3RPU A;  4KIF A;  3IHU A;  2VBX A;  3CUO A;  1IN6 A;  2MLK A;  4MNU A;  1SMT A;  2A6E F;  4IVN A;  1P4W A;  1YG2 A;  3KP2 A;  1OYW A;  1X3U A;  4HBL A;  3GW2 A;  1I1S A;  3EYY A;  2EFN A;  5D5U B;  4L9T A;  1TT8 A;  1IN5 A;  3DPT A;  1JD3 A;  4LMY A;  1MDM A;  3LST A;  1U5T A;  2GA2 A;  1G1B A;  3LHE A;  2LNB A;  2UWM A;  3L2C A;  2Q2E A;  4Q47 A;  2F5E A;  5L3B A;  1QGP A;  4PGG A;  1EH6 A;  2DO7 A;  4ZSI A;  3WGG A;  1W5T A;  1B1B A;  3LA7 A;  3V7R A;  1OYY A;  3WGH A;  1RUO A;  2PMH A;  1B9M A;  2E7X A;  2A61 A;  1JHF A;  1BC7 C;  1P4X A;  2RVC A;  5J8C A;  3HFI A;  3GEZ A;  1KU3 A;  5AIQ A;  3DEU A;  1T98 A;  5LRS A;  3IL2 A;  3I5U A;  3F8C A;  3E5Q A;  3V8K A;  1G3W A;  5HOO A;  1LQ1 A;  4G8X A;  3H3U A;  3DDV A;  3NRV A;  5H6Q A;  3QPH A;  2HKO A;  4L5I A;  3VOE A;  5D8K B;  1J9I A;  3BY6 A;  2RQP A;  2X4H A;  4HLX A;  2PJP A;  4N9H A;  4ZYH A;  5D5W B;  4PDK A;  4HV6 A;  2QQ9 A;  3R6S A;  2Y75 A;  1KU2 A;  1WKM A;  2FEZ A;  5HDN A;  1O3S A;  4NQW A;  3QRF F;  2VBW A;  3EET A;  2L54 A;  2GQQ A;  1O3R A;  1FP2 A;  4U7B A;  3FMR A;  4BAY A;  5LRR A;  2BGC A;  3I59 A;  4P55 A;  4BHP A;  2L01 A;  4GCV A;  2O8X A;  2VBZ A;  1JE8 A;  3ABT A;  4YFK F;  3RTR A;  1O7F A;  3WGI A;  2OGG A;  2QYO A;  2E1C A;  3GFI A;  3B73 A;  3D0S A;  3QPT A;  1U2W A;  3KEO A;  1SD4 A;  1Z6T A;  3T1B A;  2EB7 A;  1OYI A;  1MJB A;  2QM3 A;  4ZYD A;  3GZ6 A;  1ON2 A;  3T8T A;  2HYG D;  1S29 A;  2OQG A;  4JQF A;  1DDN A;  3BJ6 A;  3R0A A;  4G7H F;  1R7J A;  3E5X A;  2Z99 A;  4B8X A;  1YS6 A;  3ZMS A;  4XSZ F;  1XGN A;  2K27 A;  3U1D A;  4U7D A;  3BPX A;  1G4D A;  3GLX A;  4ZYG A;  4EM2 A;  3KP6 A;  3HHH A;  1TQM A;  3BP8 A;  2V79 A;  4MGR A;  2EWN A;  1MJA A;  4WCG A;  3KLN A;  4I2O A;  4YFX F;  3EUH A;  1IRF A;  4KIC A;  1MKM A;  2IRF G;  3OOP A;  1CGP A;  4OIQ F;  4MEX F;  2KJB A;  1D8J A;  3F8M A;  3IWZ A;  2PQ8 A;  1TLH B;  3N4M A;  4KIB A;  5K5R A;  2NNY A;  1Z9C A;  4AIK A;  1LJ9 A;  3KP3 A;  1FLI A;  4L0Z B;  4MTE A;  4UVC A;  5DD8 A;  2QQB A;  5K5Q A;  2K4J A;  2MH2 A;  1FY7 A;  3HYI A;  2XKO A;  2XV4 S;  2DI3 A;  1I1G A;  4O5V A;  4F7Z A;  1DP7 P;  4HX4 A;  4I02 A;  3TOB A;  2VXZ A;  4HX7 A;  5D6E A;  1FNN A;  3V8L A;  2O6G E;  4PGH A;  3LWF A;  1WI9 A;  2OZU A;  3GFL A;  2BV6 A;  2FML A;  2VC0 A;  3F8N A;  2JPC A;  1KGS A;  2V9V A;  2H6B A;  4ENN A;  2HOE A;  4IRG A;  4L0Y B;  1R58 A;  2CO5 A;  1QNT A;  2CSO A;  3JSO A;  1ZLK A;  2ISY A;  3TOA A;  1HW1 A;  3WTS C;  4JK1 X;  3KZZ A;  2DQL A;  3ECH A;  2MLG A;  1XSV A;  2A3S A;  3RYP A;  3WU1 B;  3F22 A;  3S2W A;  2NAZ A;  5BQT A;  2QWW A;  2HR3 A;  3HOT A;  2PLY A;  1XCB A;  2M5W A;  1F9N A;  2L02 A;  3C18 A;  2ZJ2 A;  5DV5 A;  1EV7 A;  2P6T A;  1LDD A;  5CLS A;  1YW7 A;  5FFX A;  1ODD A;  2W24 A;  2CYY A;  4RS8 A;  2FA5 A;  3ZMD A;  4KA4 A;  4Q48 A;  4RGR A;  3BZ6 A;  1SFU A;  4XSX F;  2MC3 A;  1AWC A;  2QEN A;  1VTN C;  2BE5 F;  1FW9 A;  2DT5 A;  2EA4 A;  1W4M A;  1XCV A;  5HS8 A;  3KZY A;  5L3G A;  3IC7 A;  1G3Y A;  3K9T A;  2P8T A;  2IA0 A;  1CF7 B;  2PFB A;  1ONV A;  2A6H F;  5TRD A;  2V6C A;  1FC3 A;  3ZN1 A;  3Q9V A;  4UVB A;  2E1N A;  3WTX C;  4BHB A;  2ISZ A;  1KQ9 A;  5ICG A;  4L9N A;  2A5Y B;  2FE3 A;  4KNY A;  1SFX A;  1XSX A;  3KET A;  1WQ2 A;  2Z9O A;  1BM9 A;  1FBS A;  2AHC A;  3CO6 C;  2KIF A;  5HLI A;  4CHU A;  3SHF A;  3GFM A;  3GO5 A;  4HZF A;  5L3F A;  1BI3 A;  5ED4 A;  4G6Q A;  5A2Q Z;  5D5X B;  1Z7U A;  4HYE A;  3BOQ A;  4CIC A;  5LEJ A;  2ACJ A;  3QU3 A;  4ENM A;  4GGG A;  3F8F A;  4LB6 B;  3HSE A;  2EA2 A;  2HYF A;  1XGM A;  3T5X A;  3ZMZ A;  3E3V A;  4MQV A;  3M1E A;  4UNO A;  2W85 A;  1SFE A;  3O6B B;  2UZK A;  1YO5 C;  1E2X A;  5E1X A;  2GWR A;  4ZZL A;  2DBB A;  5LEK A;  2H09 A;  3CO7 C;  5LHI A;  2HGC A;  1L0O C;  3R60 A;  2XVC A;  3IKV A;  2RA5 A;  1HKT A;  1FYL A;  4LLN A;  1A04 A;  3FZV A;  1TQI A;  2CFX A;  3CUQ C;  4EJV A;  3SZP A;  4FHT A;  4P9U A;  1SAX A;  3HOS A;  3JSP A;  1D8K A;  4O3M A;  3E5U A;  1U6G A;  2DAO A;  2EJR A;  4A0Z A;  1S6L A;  2XAG A;  2HKX A;  3RKX A;  3WOD F;  1XGS A;  1S7A A;  3MWM A;  1R1V A;  2MBF A;  2ZFW A;  4IHT A;  1FPQ A;  1RUN A;  3J80 K;  2EFQ A;  1YW9 A;  1ULY A;  4ENK A;  3KEQ A;  1OKR A;  3PQK A;  1P4A A;  4CO8 A;  4N0B A;  1R36 A;  1J7K A;  5BPD A;  3LAP A;  5H20 A;  2CQK A;  4QWQ A;  3HTS B;  4ZSB A;  4HDV A;  2VOD A;  4UV8 A;  2OBP A;  2HWV A;  2VT3 A;  1LB2 A;  2XAQ A;  1FSH A;  2VON A;  1J5Y A;  1LEB A;  2WC2 A;  1NHA A;  4HQM A;  2EV0 A;  2XRN A;  3MZY A;  4KIG A;  3MFK A;  3C3W A;  1R5G A;  3K2Z A;  3M9A A;  3V7S A;  2EK5 A;  1G81 A;  2EFP A;  3FMS A;  1FZP B;  1YLF A;  4BH9 A;  1TNT A;  2RNJ A;  2Y0M A;  4XBF A;  3GVA A;  3F6O A;  3BPV A;  2JRT A;  4D0P A;  5HVQ C;  3T8R A;  1RZ4 A;  1YFH A;  1ZN2 A;  4A0Y A;  2J5O A;  3LAJ A;  3PQJ A;  3WE3 A;  2FU4 A;  1HSJ A;  4CYD A;  2H94 A;  1D5V A;  4MQ9 F;  1R1T A;  3HSF A;  2O61 A;  5ILU A;  4L9J A;  5CVJ A;  5IT3 A;  4M9S A;  4UHT A;  1IN4 A;  3HTU A;  2FXA A;  3P9K A;  2QZ8 A;  1ZRE A;  4AIJ A;  2W84 A;  3CJN A;  4XLP F;  2Z5U A;  4CZZ A;  3DFG A;  3DPL C;  3F3X A;  3KP5 A;  4MEY F;  5FB2 A;  1T39 A;  4IHS A;  4IXA A;  4O6J A;  4BNC A;  1IRG A;  5DCF A;  1T0F A;  4HV5 A;  4R79 A;  1MZB A;  2FSW A;  3IWF A;  1HKQ A;  4OIO F;  2IT0 A;  3HRT A;  4L9V A;  2FMY A;  3TQN A;  2YR2 A;  1ON1 A;  3V4G A;  3SZT A;  3MCZ A;  5K5O A;  1KYW A;  4K2E A;  2W25 A;  2KIU A;  1YS7 A;  4P96 A;  2E7W A;  3MAJ A;  5AON A;  3ZN0 A;  4LLG F;  4ETS A;  2GZW A;  3D5L A;  2Z33 A;  1KYZ A;  4U0Y A;  4B09 A;  4BHC A;  4RB1 A;  3TDU C;  4A12 A;  1SD5 A;  4UXN A;  3FXR A;  2GA1 A;  4JBA A;  2DPU A;  2BEO A;  3V7C A;  3TO7 A;  1F5T A;  5BS6 A;  4WF2 A;  3ZQ7 A;  3F23 A;  5IT9 K;  4HAM A;  2YX4 A;  1HQC A;  1CF7 A;  2KIM A;  2P5K A;  2IA1 A;  3HIF A;  4GO1 A;  4ON0 A;  1ZYR F;  4KT5 C;  1BOA A;  3FX3 A;  1MGT A;  5D4S A;  3EYI A;  3QOP A;  2QVO A;  1J59 A;  3LA2 A;  2XHK A;  4A0X A;  5JHU A;  2YU3 A;  4BXU A;  4H0E A;  3G73 A;  4BQA A;  3ZMU A;  2NNN A;  2PN6 A;  3LFK A;  4ESB A;  1K78 B;  2P4W A;  2IP2 A;  4M9X A;  1ZGA A;  1W5S A;  3EQL F;  1EH7 A;  4TV7 A;  5E20 A;  4HF1 A;  3LQR A;  4WXD A;  4KMU X;  3CLO A;  5ILS A;  4HF2 A;  5L3E A;  3TO9 A;  4WK8 F;  2JSC A;  1QPM A;  4N9I A;  3K1N A;  2RC4 A;  3WTZ A;  4A6E A;  3Q5F A;  2FNA A;  2RGV A;  3E6D A;  1QBJ A;  4HOB A;  3WTT C;  1KA8 A;  2QLZ A;  2CGP A;  4QLC U;  4EM0 B;  1LDK B;  4I0B A;  2ELH A;  1OMI A;  2IKK A;  4LLL A;  2H27 A;  5LBQ A;  2NS0 A;  3GWZ A;  2WV0 A;  4WXC A;  3E6C C;  2O03 A;  1FYK A;  1Z91 A;  1K79 A;  1B6A A;  3L00 A;  2GXB A;  3ROU A;  3RI4 A;  5HLH A;  2OA4 A;  3M8F A;  2V1U A;  1HST A;  2R7D A;  1JHH A;  4XRF A;  5BOX A;  1UFM A;  4UVA A;  2FBH A;  2PEX A;  2QQA A;  3REO A;  1E17 A;  1BJA A;  1YW8 A;  4AD9 A;  3VEP A;  4OMY A;  2ZME B;  3ULQ B;  5JVT A;  2BBY A;  2XAS A;  3H3Z A;  3DXJ F;  2XAJ A;  4HQE A;  1TQP A;  1JXS A;  1XSD A;  1T2K A;  2J5P A;  1Z6R A;  4RAY A;  3JW4 A;  3NEU A;  5ICE A;  2DK5 A;  4ZSK A;  3QAH A;  3VOD A;  1ZGJ A;  1LEA A;  5TJJ A;  3IKT A;  5FFZ A;  1HKS A;  4YII A;  1ZG1 A;  2XIG A;  3RJP A;  1HBX G;  3DKW A;  3CUQ B;  1T38 A;  4BYY A;  2R3S A;  3KE2 A;  3KCC A;  1P92 A;  1S8N A;  2HEO A;  5CJ9 A;  3KP7 A;  4ZH4 F;  4EJT A;  1ZAO A;  2GXG A;  1UST A;  1G6N A;  4A6D A;  3L7W A;  4HLY A;  3SXY A;  1G3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...