3BWGA

The crystal structure of possible transcriptional regulator yydk from bacillus subtilis subsp. subtilis str. 168
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
229
structure length
223
Chain Sequence
QQIATEIETYIEEHQLQQGDKLPVLETLMAQFEVSKSTITKSLELLEQKGAIFQVRGSGIFVRKHKRKGYISLLSNQGDFNVTSKVIELDVRKPTPEAAENLNIGMDEDIYYVKRVRYINGQTLCYEESYYTKSIVTYLNNEIVSHSIFHYIREGLGLKIGFSDLFLHVGQLNEEEAEYLGLEAGLPKLYIESIFHLTNGQPFDYSKISYNYEQSQFVVQANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized HTH-type transcriptional regulator yydK
publication title The crystal structure of possible transcriptional regulator YydK from Bacillus subtilis subsp. subtilis str. 168.
rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transcription regulator
total genus 58
structure length 223
sequence length 229
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
A PF07702 UTRA UTRA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bwgA01
3.40.1410.10 Alpha Beta 3-Layer(aba) Sandwich Chorismate lyase Chorismate lyase-like 3bwgA02
3ABUA 2VOOA 3F22A 2CSOA 3BJ6A 4BHCA 2UWMA 4ZZDA 2XAHA 1KYZA 3R60A 3ECHA 2ZMEA 2Y75A 4ZYDA 4IJAA 1J5YA 1IF1A 4N9HA 3CUQB 1R5GA 2L4AA 3I53A 2DT5A 2Q0OA 2YSRA 3HUGA 4A0XA 1FNNA 1J0RA 3MEXA 1FT9A 1SFUA 5ED4A 3FMSA 4HAMA 1ZARA 3J81K 5CVJA 5H6QA 5ICEA 2PMUA 1BN5A 1QBJA 1YG2A 2YX4A 3QU6A 4F7ZA 4KIGA 1LDJA 2FQ3A 1IXRC 1K6OA 3HFIA 3P7NA 3LQQA 4BHPA 2IVMA 4WCGA 4EM1A 3PQJA 4KYWA 4ASNA 5EEGA 4FX0A 5LLQA 3I58A 5FD6A 1O3SA 2CQKA 3FMRA 5CVRA 3U2RA 1ZRCA 3E3VA 2XUBA 5LHIA 1YW9A 3LAJA 2OZUA 1S7OA 3O6BB 1K79A 1SMYF 3BJAA 3F8NA 2WTEA 1U78A 3G3ZA 2V1DA 3CUOA 4P5OA 3F23A 3TOAA 1STZA 2PG4A 4XRFA 5DDGA 4KN4X 2Z99A 2VBWA 1W5TA 1XGOA 2M45A 2PN6A 4TV7A 2DQRA 3ULQB 2JTVA 1Z1DA 4L5JA 2F5FA 3IRQA 2IW5A 5ICCA 4I01A 1TQIA 1XGNA 3K1MA 4MTEA 2NNNA 4G6QA 1LEBA 2OZ6A 2ELHA 1XLRA 2ZMEB 1W4MA 1FYMA 2P8TA 2R7DA 5JHUA 3HRTA 1USTA 4Q5SF 5ILUA 1IXCA 3K9TA 4MHGA 1ZHFA 5F6FA 3EQLF 3MZYA 1I27A 4GCVA 4M9ZA 4OIRF 1YLFA 5CVIA 4LK1F 3L5ZA 3F8FA 3OV8A 2QVOA 1KYWA 4ENNA 1JXSA 1ODDA 2KJCA 2OBPA 4KFCA 3MWMA 5L3CA 1J7KA 4EJTA 2XASA 4S04A 3E5QA 2ISYA 2IT0A 2ADUA 3QAHA 1QZYA 5ILVA 2HOEA 2W25A 1P2FA 3I0TA 1YFHA 3GF2A 2DPDA 2VXZA 2QQ9A 2CO5A 1YYVA 3WTSC 3Q9SA 4RB2C 2NWIA 1S29A 3Q9VA 1R00A 2QZ8A 2GAUA 3E6MA 2NNYA 2Q8KA 3F21A 4L0ZB 4B8XA 4I0AA 1D8KA 3BY6A 2A6HF 1LNWA 1ZAOA 3P9CA 2BYVE 1W5SA 4LLNA 3J80K 5D5UB 3WTTC 2XKPA 3V8LA 3CJNA 3DEUA 3RJPA 1BI1A 1U5TC 2FXAA 5D6FA 2NYXA 2OD5A 4EGZA 4G9YA 2KJBA 2D1HA 1B9MA 3AAFA 5HDKA 3LA3A 1WQ2A 1IZ1A 2F5DA 3V7CA 5JFRA 1RI7A 3M8FA 2IA0A 4ESJA 1YS6A 1V3FA 3ZN1A 3R6SA 3I59B 4UV9A 5LHHA 2STWA 2M87A 1B59A 3L09A 4ZSIA 2QENA 1P4XA 3V7RA 1HW5A 1DPRA 5JVTA 2QBYA 3ECOA 3SFZA 2QLZA 4U0WA 3GUDA 4KN7X 1I5ZA 2B0LA 4U88A 2EV5A 3RPUA 3QPHA 3ZMUA 3D0SA 3S2WA 4P9FA 4A6DA 4OMYA 5FGMA 1LVAA 5FD5A 3KZZA 1WKMA 1S7AA 1WRJA 3HOSA 1EV7A 3L7WA 2ZJ2A 2PMHA 4YG2F 4DNCA 1Y0UA 2HDCA 1BIAA 4A0ZA 4HF1A 2W85A 1Z6RA 4OOIA 3R0JA 2GZWA 4GYGA 2YX7A 4ESBA 4ZYGA 1HSTA 1FP1D 4LB6B 1KU3A 2ACJA 2VBYA 3L00A 3HRMA 2LKPA 4P55A 2A3SA 2CW0F 1Z7UA 4OIQF 4HZFA 2M30A 5BS6A 3E6DA 1OYWA 5D8LB 1JGSA 5AONA 2DQLA 3CO6C 4WK8F 3WG9A 2FOKA 4LLGF 4KT5C 3TO9A 1R7JA 4IRGA 4EJWA 3LSTA 4U0VA 4Z2YA 4QWQA 2D45A 4WX9A 2GQQA 3I64A 4RB1A 4MGRA 2XHKA 2E1CA 4CGZA 4UNOA 1BI2A 4CO8A 3C3WA 4KMFA 4E70A 3LA7A 5DEQA 2VOPA 1MDMB 4AWXB 3KEOA 3VOEA 4LGWA 2VODA 2PI0A 5DD8A 2O8XA 4NQWA 3TO7A 1JHFA 4L9VA 4RGRA 2H6BA 3C1DA 1MZBA 2KIFA 2HTSA 2QBYB 2PBIA 2V1UA 4L5IA 3T0YA 1DUXC 2VE8A 4A5MA 3FM5A 4OINF 5E18F 1T0FA 1XN7A 3IL2A 3DKWA 1IAWA 3E6CC 3GYHX 2OQRA 3KE2A 1QNTA 4MNUA 2O0YA 2F5EA 1IW7F 2FE3A 2QM3A 3BZ6A 3COAC 1XMKA 4GO1A 4XSXF 5K5RA 2UXNA 2P6TA 5LHGA 1YIOA 4HX7A 1BC8C 1O7FA 3KP5A 1MJAA 1AWCA 2FF4A 3P9KA 1YW8A 2XAQA 4HOBA 2DI3A 2P5LC 1FY7A 1S6LA 3O2PE 5H20A 1P4WA 1TW3A 3FXUA 1HKTA 1L0OC 5DUKA 4MEYF 3H92A 5F1RA 3SZTA 1DDNA 2VE9A 1QO0D 3HYIA 4JBAA 1O3QA 3J80Z 3QP6A 4PCQA 1SD5A 4HYEA 1KU2A 3CLOA 4G6DA 1W7PB 3RYRA 3WE2A 1F5TA 3GO5A 5JI6A 4M73A 5AIPA 2IJLA 2Y48A 2DO7A 4L9NA 2XGXA 3QU3A 1FOKA 4KNYA 1XMAA 3WTYC 5TJJA 2A69F 4MEXF 1B9NA 2PQ8A 5L3DA 1G3TA 1OKRA 3HTUA 4IPAA 4BXUA 1U5TA 1FBUA 1IN6A 4HDUA 4I09A 3W6JB 3CTAA 3F8MA 5DV5A 1GXQA 2XRNA 4BAYA 1XSXA 2HQNA 4L9JA 2FEZA 1WI9A 4HLXA 2KIMA 4UVAA 3WTXC 1UB9A 3E6BA 2E7XA 3LQRA 2M8EA 2ZBKA 2DW4A 5LRRA 1R58A 3TO6A 1MGTA 1BM9A 4LD5A 2PKHA 3F72A 5A2QK 4OIOF 1O3TA 2K02A 1TLHB 2FMYA 3LA2A 3DF8A 2D2WA 1REPC 1CF7B 1ZG1A 3IKVA 4OMZA 1FP2A 3V7SA 2O03A 4A5NA 1R23A 3JSPA 4MQ9F 3ZMVA 4MTDA 3ZMDA 3GZ5A 1P6RA 1MJ9A 4A12A 2Z9OA 2ZO4A 2JPCA 3R61A 1E17A 2F5CA 2K4JA 1LJ9A 2G7HA 1YO5C 5K1YA 1I6XA 2OAZA 5DCMA 4LB5A 3EETA 3C18A 1B4AA 2HWVA 2ZFWA 3MQ0A 2BGCA 3ABTA 3WE3A 1K7AA 1K78B 3WU0A 3HIFA 5BPDA 1RNLA 4HW0A 3DXJF 2YR2A 1SFEA 1UCRA 3CUQC 3I71A 2PFBA 2PLYA 4IXAA 1T2KA 3FF5A 1QQIA 1Z05A 3GEZA 2RN7A 3WTZA 3EYIA 2FMLA 1RIOH 2JZYA 1G6NA 3BDDA 3Q5FA 1FX7A 5IT9K 5DUIA 4QLCU 5D6EA 2E7WA 5FLXK 4UVBA 2YU3A 3WU1B 4Q4ZF 4EJUA 2ZCWA 3DPTA 3GXOA 5BMZA 3HSEA 1J59A 2HR3A 3BOQA 1G3WA 4KMUX 1ZH5A 3NRVA 2UZKA 2LF8A 2XIGA 1G3SA 3P9IA 3GZ6A 1I1SA 4KDPA 2DTRA 3LHEA 2XAJA 2XAFA 3GW2A 3HSFA 4NB5A 4MQVA 1FZPB 2CGPA 2MD5A 1IN8A 3WTUC 5LBQA 3DPLC 4BH9A 4HQMA 4IRIA 2HKXA 3LFKA 3KP3A 3BWGA 3CO7C 3F6OA 1HKSA 3OOPA 4HQEA 3KZYA 2P19A 4AIJA 2L3DA 2M5WA 2EV0A 4K2EA 2AHCA 4LLLA 4M9SA 3TOBA 3NEUA 5E1ZB 1FC3A 4G94A 1EH8A 1ZGJA 2VT3A 3KEQA 5BQTA 1JE8A 3FXRA 2Y0MA 4LMYA 3EUHA 2VC0A 5DCMB 4KIFA 4AIHA 3QRFF 3C7JA 3ERED 2DLLA 3KP7A 3BPVA 4ON0A 1O3RA 3GLXA 3PQKA 1R1TA 4UVCA 4WXDA 4AIKA 1BOAA 4RB3C 1FBSA 3K69A 1Z6TA 4HV5A 1HQCA 1X3UA 3PFIA 2ISZA 1U6GA 2EFPA 1JD3A 1W7PD 3JW4A 5CJ9A 4FX4A 2BBYA 3JAMK 1MD0A 3T8TA 1FYKA 2LDUA 4IVNA 3JTGA 3HOTA 2K7LA 1ON1A 4ZZLA 4RGUA 2W84A 4EJOA 2MLKA 2DPUA 5IT3A 2MBFA 2DU9A 2VONA 3J81Z 4HF2A 5CYVA 1BI3A 4M9XA 3ZMSA 3CDHA 1OR7A 4ZYHA 1JHHA 1MJBA 1OPCA 2FBHA 5TRDA 3TQNA 3QPTA 2IRFG 2DFIA 5A2QZ 2XAGA 4I98B 4L9TA 2L54A 3N4MA 5E17F 2HQRA 3KP4A 1TBXA 1R36A 1TW2A 2EFWA 4S05A 1T38A 2IP2A 1FWZA 5JR3A 3ISPA 2P7CB 1FPQA 3RKXA 3F8BA 5J8CA 4A6EA 4I02A 2RKHA 4KICA 4Y13A 2AS5F 5FFZA 1RUNA 1O7LA 4CYDA 4G8XA 3K1PA 2V9VA 3EDPA 1AOYA 1TNTA 2P7VB 1IUYA 5HS8A 5DYMA 3V4GA 1LDKB 3O3KA 5E1WA 3TGNA 5LRSA 4JQFA 3GX4X 1YTYA 4D0PA 3WODF 4L0YB 3KP6A 4FT8A 1DPUA 5D4RA 3L9FA 4GYIA 1TQPA 4R1HA 1ZYRF 2HYGD 4H0EA 2JSCA 3DV8A 1LEAA 4CXFA 3ZMZA 4ZYEA 4UV8A 5D4SA 3N97A 2RA5A 3IRRA 4XLPF 4PGHA 1SFXA 5HS7A 1KU7A 1BIBA 3TDUC 3DFGA 4YFXF 1FSHA 2QYOA 2X4HA 5L3BA 4CDGA 5IT9Z 6PAXA 1E2XA 5DD4A 2CFXA 1XSDA 3M9AA 2NAZA 5FLXZ 1CGPA 1ZG5A 2H94A 5HLGA 4RS8A 3F8LA 3WTWC 4GXOA 3MCZA 4OU0A 1R1UA 1HKQA 2GA1A 5HDGA 2EWNA 2V79A 1XCVA 5FB2A 1ZLJA 5L3FA 2BE5F 1PP8F 3RTRA 4U0YA 4BNCA 1A04A 4P96A 3DQVC 2VBXA 3GWZA 3DDVA 3M1EA 3RPQA 2VC1A 2P4WA 4M74A 3IKTA 4N9IA 4LFUA 2STTA 3VB2A 2OGGA 4WXCA 4IHSA 1V4RA 3BP8A 5D5VB 3F3XA 1J9IA 2FA1A 3BPXA 3KETA 4YIIA 1FYLA 5LEJA 3IWFA 3E97A 5D5XB 4G7OF 1KQ9A 1YS7A 4M6XA 4DQ2A 3H3UA 3I4PA 2X0LA 4PZJA 4RAZA 2FBIA 2ESHA 3REOA 3ML6A 2IA2A 2ZNZA 2GA2A 1IN5A 3K0LA 2HYFA 4CICA 1ZN2A 4WWCA 5E8GA 4YFKF 4LJZF 3NQOA 2VT2A 1XD7A 2GIVA 2XV4S 5HLHA 4I0BA 2H09A 2AXLA 1UHWA 3W6KB 1SD4A 3VFZA 1T6SA 2EA4A 4R8HA 4A2UA 1IRGA 1UHMA 2DK5A 1EH6A 2TDXA 4EV0A 3JAMZ 2EB7A 1YW7A 1XGSA 2NS0A 1FBQA 3K1NA 4G7HF 5HVQC 2GXBA 1LB2A 4HDVA 1SD6A 1OYIA 2PJPA 1IN4A 4YFNF 4ZSKA 2ZKZA 1ON2A 3L2CA 4R79A 3QP5A 3RIRA 3KP2A 1TTYA 1S8NA 1FLIA 4ENKA 4P9UA 2DAOA 1Z91A 1HW2A 2A07F 5FO5A 1G1BA 4M6YA 5LGTA 1BBYA 2P5VA 3ZPLA 2Z3YA 1KU9A 4Y17A 1IXSB 2J5OA 1MKMA 4EM2A 3F8CA 1P4AA 4UHTA 2HEOA 5HLIA 2LNBA 3E5UA 1Z9CA 3ROUA 2XVCA 2O61A 5CVVA 3RKYA 2M1BA 3EYYA 4KUMA 5LEKA 2ETHA 5FFXA 5ILSA 1U8RA 5L3EA 2HFHA 2HZTA 3RKWA 4IF4A 2EFNA 3KFWX 1OYYA 3WGHA 5K5OA 3IC7A 1B1BA 3QOPA 3ZMTA 3FZVA 1D8JA 4FHTA 2IKKA 3I5UA 3ZP5A 4AD9A 4G7ZF 4O6JA 4XBFA 3FXQA 3FMQA 3T8RA 1XDUA 1TT8A 3HSRA 2MH9A 2J5PA 3GFLA 2RC4A 3R0AA 1ULYA 2VN2A 1SAXA 2CG4A 5DCFA 3MFKA 3WGGA 5J8FA 3V8JA 1XCBA 3T1BA 2WC2A 2K4BA 1U5TB 3I59A 1KGSA 2EFOA 3F6VA 2EJRA 4YIFA 5KK1A 1ONVA 2Z33A 4ZH4F 1ZGAA 2F2EA 3FX3A 2MC3A 3B02A 2RDPA 1F9NA 1G4DA 4RGXA 2QQAA 1R1VA 3HRSA 2OQGA 1KQ0A 5J6XA 3SZPA 1SMTA 4WF2A 4EQQA 2FSWA 1VTNC 4HV6A 2HTJA 2JT1A 1GVJA 2RGVA 1ZRFA 3SXYA 1H0MA 1G3YA 2PEXA 4UXNA 1YQAA 2L4MA 3JTHA 2RVCA 4ESFA 5K5QA 5D5WB 1IN7A 4L18B 3IWZA 1O57A 4HX4A 1H9GA 4ETSA 1GHCA 1S3JA 4I7HA 1XSVA 1LQ1A 1F1ZA 2CYYA 3RDIA 2W57A 4RB0A 3GFIA 3KLNA 4LK0F 1G81A 2R3SA 2OOIA 1DP7P 3VODA 1C0WA 1WSUA 2NRAC 4HX8A 2L01A 2QWWA 2A5YB 3DP7A 1IRFA 1RZ4A 2KIUA 4Q48A 1ZG3A 4NHJA 1BJAA 3FM3A 1U3EM 1B6AA 2Z5UA 3RI4A 1HW1A 3B73A 2ESNA 2P5KA 4EJVA 2CWEA 5BOXA 4BQAA 1HSJA 4BHBA 4IHTA 4EMSA 1BI0A 2A61A 2V1XA 3GFMA 5EEHA 2WV0A 5H6RA 4KIBA 1MDMA 5HDNA 1D3YA 1I1GA 1QZZA 2EA2A 2FNAA 2XROA 2KRFA 1R22A 1LDDA 2FBKA 2UXXA 4Y15A 5BPIA 3FHZA 4ZSBA 2QQBA 2QUFA 2DBBA 2D1VA 2RNJA 1D5VA 2OU2A 4HBLA 2VBZA 5ICGA 3U1DA 2XKOA 4WXHA 2GWRA 1H9TA 1PDNC 1USSA 1FW9A 5D8KB 1KA8A 4EM0B 4IRHA 3M8EA 3U9GA 1F4KA 2FRHA 1KQ8A 2FNPA 1T39A 2COMA 1XB4A 4KA4A 1OMIA 1FSEA 2BV6A 5E20A 3I54A 5CVUA 1GXPA 2O3FA 3LAPA 1J75A 4PDKA 4XSZF 2EK5A 1R5HA 3HHGA 2ZNYA 4HA8A 1NHAA 5ICFA 2DK8A 5E8IA 4LG0A 4UUVA 4JK1X 4ENMA 4B09A 2R7FA 2GXGA 2H27A 2HGCA 3RYPA 5CLSA 2HKOA 2YPRA 3VEPA 2FA5A 2MA3A 3G73A 4U7DA 4GGGA 1Q1HA 3M7GA 5KVRA 3KLOA 5L3GA 4EGYA 4PGGA 4Q47A 1W7PA 4RGSA 3GFJA 2MLGA 2WWYA 4HLYA 1WWXA 4U7BA 2P6SA 3LWFA 2BEOA 3HHHA 1ZLKA 3BROA 4M71A 4O5VA 5LGNA 3ZQ7A 1UFMA 2OA4A 3MAJA 3CUQA 2IA1A 4EVIA 4A0YA 4XLNF 3T5XA 1PP7U 3V8KA 1BC7C 4OIPF 4RAYA 1ZRDA 3E5XA 1XGMA 2FU4A 2Q2EA 5ERIA 2G9WA 2O6GE 3J7AO 2A68F 3WGIA 3BJOA 1T98A 1U2WA 3GVAA 2C6YA 4N0BA 1L3LA 2W24A 3D5LA 2K27A 2L02A 2H6CA 2RQPA 1RUOA 1XDSA 3WTVC 1P92A 2EFQA 2G7UA 3SQNA 3ELKA 5F64A 1HXDA 2K86A 1QGPA 3JSOA 1CF7A 4O3MA 2MH2A 1ZREA 3HRUA 1PUEE 2A6EF 3SHFA 1TNSA 4BYYA 5HS9A 5E1XA 1HBXG 2JPBA 4AVPA 2JRTA 2KKOA 4M72A 2HS5A 2IPQX 2EV6A 3FWEA 2ZXJA 2E1NA 3TDZC 4I2OA 3IHUA 5HOOA 3TKYA 1EH7A 4LG0B 5AIQA 3HTSB 1QPMA 1J2XA 3KCCA 3K2ZA 4CZZA 1K78A 3MZHA 2LSOA 2V6CA 4ENJA 4CHUA 1TQMA 3H3ZA 3ZN0A 2RV8A 5LGUA 4HF0A 2LF7A 3CNVA 3R4KA 1SD7A
chains in the Genus database with same CATH superfamily
5M5XJ 3ABUA 5LFAA 3BG5A 5FLMJ 2WB1N 2VOOA 3F22A 2CSOA 2ZSHB 3BJ6A 3CJTB 4BHCA 2UWMA 1APLC 4ZZDA 2Q1ZB 3E7LA 2ELKA 1ETWA 2XAHA 5F0CA 3FXKA 1X1AA 2LVSA 1KYZA 3R60A 3A01B 5J3LA 5GAEJ 4GFBA 1M1EB 2E71A 3ECHA 2F4OB 4IZZA 2ZMEA 4DBQA 2Y75A 4ZYDA 3CC2I 1MBFA 4IJAA 2JQ7A 1N77A 2XPVA 1J5YA 2K9NA 4PFOA 1IF1A 2LY1A 4N9HA 2RAEA 3CUQB 4BS9A 2CU7A 2WAQA 3IH4A 1R5GA 2L4AA 3I53A 2DA5A 1SAUA 4A3MJ 2DT5A 2Q0OA 3CD6I 3HJEA 2YSRA 3P5JA 2Q2EB 3HUGA 2VL8A 4A0XA 1FNNA 3K10A 1J0RA 3ABKH 3MEXA 1FT9A 1SFUA 5ED4A 4F55A 1BR4A 3FMSA 4HAMA 1U8BA 1ZARA 2DCEA 4CUGA 3ZGKA 1FMWA 5EG0B 1A31A 3J81K 4NC6A 5CVJA 4FETA 1A6IA 1FEXA 5H6QA 5ICEA 2PMUA 3BZKA 1BN5A 3MKWB 2UUZA 2E1MB 4JX6A 1QBJA 4IOCF 1YG2A 2YX4A 4F3QA 2R7ZJ 3QU6A 2JUCA 4F7ZA 2L9VA 4KIGA 4UUSA 1LDJA 2FQ3A 2QCOA 1IXRC 3D1NI 1K6OA 1HCRA 2X48A 3HFIA 3P7NA 3LQQA 4BHPA 2IVMA 1LFPA 4OAZA 2BW3B 1VQLI 4WCGA 4QPOA 1OCOH 2KZGA 4EM1A 1D1AA 3PQJA 5GPCA 2R7TA 4KYWA 4ASNA 2BHYA 5EEGA 4FX0A 3G6EI 5LLQA 3I58A 1R49A 5FD6A 2KHMA 2NOGA 1O3SA 2CQKA 2V1NA 3FMRA 3OYMA 5CVRA 4BKXA 3U2RA 2XDVA 4C2UA 1LVKA 1ZRCA 3E3VA 2XUBA 5GADJ 5LHIA 1YW9A 3LAJA 2OZUA 1S7OA 2RQQA 1ETQA 2R7WA 2H1LA 3O6BB 1K79A 1SMYF 3L2UA 3CQZJ 3BJAA 3F8NA 2MABA 4W1UA 2WTEA 4ZTFA 4PUSA 3S15J 1FOWA 4RMNA 2CMPA 2Z2SB 5F27A 1NH3A 3SDGA 3OSGA 1U78A 3G3ZA 2V1DA 3CUOA 4P5OA 2AO9A 3A2KA 2LD5A 3F23A 5DM6F 4U87A 3TOAA 1STZA 4IOAF 2CQNA 2PG4A 3QPLA 4XRFA 5DDGA 2CJJA 4KN4X 2EIKH 4NBQA 4M3GA 2Z99A 2Y2ZA 2VBWA 3MKYB 1W5TA 1XGOA 3M1CA 1WFXA 3D5SC 2M45A 2PN6A 3HDDA 4TV7A 2DQRA 3BCBA 2RREA 2OCEA 2Y0SN 3ULQB 3F0CA 2JTVA 1Z1DA 4L5JA 2F5FA 1MBKA 1VF9A 4KISA 2YU9J 3OIPA 2LKSA 5C4XJ 1NG7A 3IRQA 2IW5A 1VZ0A 3VPRA 5ICCA 5HNFA 4B48A 1R4MB 4I01A 1TQIA 3GTPJ 1XGNA 3K4NA 3K1MA 4CCLA 3IH3A 1VQ4I 4MTEA 1RETA 4B4CA 2NNNA 4S0HB 4G6QA 1LEBA 2DA1A 2OZ6A 3FXJA 4BEHA 1IO2A 2ELHA 1XLRA 2XGCA 2KMUA 4D5FA 2ZMEB 2ME0A 2E60A 1W4MA 1FYMA 2P8TA 1YX5A 2R7DA 5JHUA 4D7MA 2MSYA 3ASNH 3HRTA 1T0FC 1USTA 4Q5SF 5ILUA 1IXCA 3K9TA 4MHGA 1ZHFA 4IX7A 2M4GA 2ZJPF 5F6FA 5F0HA 3EQLF 3PO3J 3MZYA 1I27A 1LFBA 1UG2A 4GCVA 4BJ5C 2M0CA 3HOUJ 4M9ZA 1LPQA 2EZHA 4OIRF 2OCCH 1YLFA 5CVIA 3LSPA 5KAIC 4LK1F 4HNUA 4XLEA 3L5ZA 1SANA 2L9NA 2F6CA 4MO7A 3ZXSA 3DEEA 5GPAA 1N25A 4XRMA 3F8FA 3OV8A 4YRVA 2QVOA 3HPHA 2DFHA 3CCMI 1KYWA 4ENNA 4I76A 1JXSA 1Y8RB 1ODDA 2KJCA 3DBLB 2OBPA 2L9RA 2DT6A 4KFCA 2R7OA 3MWMA 5L3CA 1J7KA 4EJTA 2XASA 1EA3A 1X1CA 3OYLA 2HNHA 1D0ZA 4S04A 3E5QA 1TWAJ 2ISYA 2IT0A 3FDYA 2ADUA 3QAHA 5CQEA 1QZYA 4B47A 5ILVA 4UUSB 3HL2A 4C2MJ 2HOEA 2W25A 1T8IA 1P2FA 3I0TA 1YFHA 3GF2A 2DPDA 1T08B 2VXZA 2QQ9A 1W5CC 2CO5A 1YYVA 1E0EA 3WTSC 2XPUA 3Q9SA 4RB2C 4BE2A 2NWIA 2L7ZA 2EBIA 1S29A 5CQGA 3LFUA 3Q9VA 3FXMA 3OIOA 1R00A 2I8DA 2QZ8A 2GAUA 3E6MA 2NNYA 1QRYA 1U0JA 2Q8KA 3F21A 2NVTJ 5EZGA 2P81A 3QOEA 4BQNA 4L0ZB 4B8XA 2BY2A 3QWLA 3A02A 4I0AA 1D8KA 2IXSA 3BY6A 1LKXA 2CQXA 5F04A 3GTQJ 2A6HF 1JI8A 1LNWA 5E3LA 1ZAOA 1ZKGA 3P9CA 2BYVE 2FX0A 1Z3XA 2JA2A 4BXXJ 2XC7A 1W5SA 4MFDA 2DMNA 4LLNA 3J80K 5D5UB 3WTTC 1YI2I 2XKPA 3PUFA 2LBFA 1TWCJ 3V8LA 2WAFA 3CJNA 3OS1A 3DEUA 1WI3A 3RJPA 2R93J 1BI1A 1U5TC 2FUG2 2FXAA 3DKYA 2JWTA 5D6FA 2XF7A 1MSEC 3K70D 3HGYA 4KITB 2NYXA 3BG7A 5FKKA 2OD5A 1DU0A 1QPIA 4XMYA 3SJMA 2ECBA 4A3LJ 4G9YA 4EGZA 2KJBA 2D1HA 4E7KA 1B9MA 3AAFA 3B6CA 3CESA 3CZ6A 3L2VA 2LOOA 5HDKA 3LA3A 4PJMA 2G0EA 2B63J 5JVGF 1WQ2A 1IZ1A 2JJ7A 2F5DA 2ZXWH 3KIOA 3V7CA 5JFRA 3W2VA 3W3CA 1RI7A 3M8FA 2IA0A 2OF7A 4ESJA 1YS6A 3QPSA 1R71A 1V3FA 1HC8A 3ZN1A 2ZXHA 3R6SA 3I59B 3FXLA 4UV9A 5LHHA 2STWA 2M87A 4IHXA 1B59A 3L09A 4BEHB 2QENA 1P4XA 3V7RA 4ZSIA 1HW5A 3M8JA 1K61A 1DPRA 1RR7A 2K5CA 5JVTA 2QBYA 3ECOA 4C3JJ 1X1PA 1X4OA 3SFZA 2QLZA 4RBOA 4U0WA 3GUDA 4KN7X 1I5ZA 2BOLA 2B0LA 1XX5A 4U88A 2EV5A 3H5RA 3RPUA 3QPHA 1GDTA 1X2MA 3ZMUA 3D0SA 3S2WA 1MSFC 4CZCA 4P9FA 5M5WJ 3IAM2 4A6DA 4OMYA 5FGMA 1LVAA 4OAYA 4FISA 1OCZH 2XGDA 5FD5A 1IDZA 3KZZA 1WKMA 1S7AA 1WRJA 3FK6A 1U9NA 3HOSA 1EV7A 2M2EA 4XK4A 5KNLA 4IKFA 3L7WA 2ZJ2A 2PMHA 3TBIA 2LTPA 4II3A 4C2TA 4YG2F 2Y9YA 4DNCA 1WVRA 1Y0UA 2ME6A 2HDCA 2QSFX 1FJLA 1BIAA 1H88C 2Y30A 4A0ZA 4HF1A 2ZFUA 4ZDPA 4ABZA 1Y8QB 2W85A 2K3FA 1AKHB 1Z6RA 4OOIA 3GLLA 2LK2A 3R0JA 2R92J 2GZWA 4GYGA 2YX7A 2X51A 4ESBA 4ZYGA 3K4CA 1HSTA 1FP1D 4LB6B 1JT0A 1KU3A 2ACJA 2VBYA 3L00A 4RDUA 3HRMA 2LKPA 2V7FA 2EQRA 3JRDA 4P55A 2KPMA 2A3SA 2CW0F 1Z7UA 4HRIA 2JVHA 4OIQF 3JRFA 4HZFA 2M30A 1DU6A 5BS6A 3E6DA 2E2HJ 2V4JC 2K9LA 3S16J 3I56I 1OYWA 2H8WA 4XM3A 5D8LB 1JGSA 4DYQA 5AONA 2K9SA 2DQLA 3CO6C 4WK8F 5J40A 3VYUB 3WG9A 1I3QJ 5E3NA 2V6EA 2M7AA 3F9KA 2FOKA 5K7ZA 2KLOA 3EUKL 4LLGF 3ZQFA 4KT5C 4F52A 3TO9A 1R7JA 2OTLI 4IRGA 4EJWA 2WA0A 3FK7A 3LSTA 4FTHA 4U0VA 4Z2YA 1XC5A 2W7NA 2GIZA 3CC4I 2LBFB 4QWQA 3TW7A 2D45A 4WX9A 2GQQA 3I64A 4RB1A 2QSHX 2JA6J 4ZDLA 2NVYJ 2W1OA 4MGRA 2W82A 2XHKA 2E1CA 4CGZA 4UNOA 1BI2A 2CUEA 4CO8A 5M3MJ 3C3WA 1V55H 3BZCA 4D1QA 4KMFA 3HOYJ 2BVMA 4E70A 4KJZA 2M8GX 3LA7A 5DEQA 2VOPA 2K9QA 4XORA 1MDMB 1AA7A 1BJZA 4AWXB 1JT6A 1Y1VJ 3KEOA 3VOEA 2CW8A 4LGWA 1O4XA 2VODA 2CFOA 2PI0A 5DD8A 4CCNA 2O8XA 4ANJA 2R7UA 2XF6A 3CCYA 3FXOA 3A4CA 4NQWA 2NOJB 3TO7A 1A35A 4AYBA 1JHFA 1FOXA 4L9VA 4G12A 2QKMB 2K3PA 1I39A 2CUJA 4IHVA 1FOYA 4RGRA 3ZQGA 3H0DA 5FKMA 2H6BA 3C1DA 1MZBA 2CQQA 2KIFA 3JRAA 2NVUB 2HTSA 5B1BH 4HSTA 5KAFC 5C3EJ 2QBYB 2PBIA 2R7VA 2V1UA 4L5IA 3T0YA 2BY1A 1DUXC 2VE8A 1BL0A 3FIWA 4A5MA 4OWRB 5C44J 4X6AJ 1JKPC 2TRTA 2WADA 3FM5A 4EEFG 4E7SA 4F91B 3OMYA 4OINF 5E18F 1T0FA 1IDYA 1XN7A 4BY7J 3IL2A 2L7FP 4LITA 4A3KJ 2XPWA 2F48A 3DKWA 5B66C 1IAWA 3E6CC 1ZGWA 4LG3A 3GYHX 2OQRA 3KE2A 3H36A 1QNTA 5DM7F 1VQ8I 4MNUA 2O0YA 5FKLA 2F5EA 1IW7F 2FE3A 2QM3A 3BZ6A 3COAC 1XMKA 5IOZA 3CDIA 4GDFA 3EUHC 4GO1A 2E2JJ 4XSXF 5K5RA 2UXNA 2P6TA 1RC9A 2HQAA 5IYCJ 5LHGA 1SEUA 5IYDJ 1YIOA 4HX7A 3JRCA 1BC8C 1TZLA 2Z16A 5C4JJ 1O7FA 2BY3A 3KP5A 1MJAA 3K4MA 1TL8A 1AWCA 3HM5A 2FF4A 3ZQQA 3P9KA 1YW8A 2XAQA 1WJFA 4HOBA 2GM4A 2AHQA 2DI3A 3HGGA 2P5LC 1FY7A 5E3OA 1S6LA 3VYSB 3O2PE 5H20A 1P4WA 2DA6A 3A1YA 1WJCA 4JOMA 1TW3A 3HZJA 2JN6A 3FXUA 1HKTA 2LKXA 1L0OC 2E1OA 2LREA 4E4HA 5DUKA 4MEYF 1T33A 3H92A 2Y69H 3LSGA 5F1RA 1ITYA 3SZTA 1DDNA 2VB6A 2PMZA 2VE9A 1QO0D 3HYIA 1S9HA 4JBAA 1O3QA 4Z6YA 4XN0A 1YITI 2EZLA 4AVZA 3J80Z 3QP6A 1BR1A 4PCQA 3LL7A 2DJIA 3H9QA 1SD5A 1SC7A 2N8GA 3MD2A 4V2GA 5IOYA 4HYEA 3CLOA 1KU2A 3PNYA 4G6DA 1RR8C 1YJWI 1JUPA 3G1LA 1W7PB 3RYRA 4N4NB 3WE2A 4DYRA 2HPMA 3ZCOA 3GO5A 1F5TA 2W48A 3PSFA 2X85A 3GTJJ 5JI6A 5HNHA 4M73A 1BW6A 3LMMA 5AIPA 2IJLA 4E7ZA 1HA8A 2Y48A 3CCJI 1ZELA 2DO7A 4L9NA 2XGXA 3QU3A 2LC2A 1RKTA 2ZSIB 1JTYA 1XMAA 1JKRC 1FOKA 2HOTA 3WTYC 5TJJA 2A69F 3UR3C 3MZ8A 4MEXF 1B9NA 2PQ8A 2VIXA 1A6QA 5KHDA 1VNDA 1XG1A 4CH7A 4CCMA 1OR7C 5L3DA 4BJ6C 3UNGC 1G3TA 1OKRA 2L2OA 3HTUA 4IPAA 4BXUA 1U5TA 3K4LA 4H4KC 5J1YA 3S14J 3BT9A 1P9QC 3HC7A 1FBUA 2DA3A 1IN6A 4HDUA 4I09A 3W6JB 3S3MA 1I6HJ 1MW7A 3CTAA 3F8MA 5DV5A 5K7HA 1GXQA 3OYAA 1MMDA 2XRNA 2ELJA 4F92B 3I55I 4BAYA 2ID6A 1XSXA 2HQNA 9ANTA 4L9JA 2FEZA 1WI9A 4HLXA 2KIMA 4UVAA 3WTXC 1UB9A 3E6BA 2E7XA 1SVOA 3LQRA 2PX9A 4B3AA 3K7AJ 4A3FJ 3CJQB 2M8EA 1RESA 2XB5A 2ZBKA 3H0GJ 2DW4A 1X58A 5LRRA 1R58A 3TO6A 1MGTA 1BM9A 5K7FA 4LD5A 2PKHA 3BR3A 3F72A 5A2QK 2XSJC 4OIOF 1O3TA 4PFPA 2K02A 3JRGA 1TLHB 3CCSI 2FMYA 4FQGA 5EF6A 3LA2A 4UY8I 3DF8A 2D2WA 3SYTA 1JUMA 1REPC 4RM3A 1CF7B 2A6TA 4BBSJ 1ZG1A 1IG7A 2HXIA 3IKVA 1IGNA 3DTEA 4OMZA 2AQFA 4ZDOA 1FP2A 3PL8A 4AU7A 3V7SA 3AKZA 1JJ6C 2O03A 4A5NA 3CCUI 3I4NJ 3AG4H 4Y4RA 1R23A 3JSPA 3QODA 1JKQC 4MQ9F 1X19A 3ZMVA 4MTDA 5EGOB 3J7AY 3ZMDA 1MMAA 3HPGA 1GT0C 3GZ5A 3K70C 1D0YA 1P6RA 5DS9A 1MJ9A 2IGNA 2JSPA 4A12A 2X6YA 2Z9OA 2ZO4A 3HG9A 2WY8Q 2JPCA 5JLWA 3R61A 1E17A 2F5CA 2K4JA 2DDBA 1K4SA 1LJ9A 1T95A 2G7HA 3H5AA 4XKCA 4DJAA 3C2GA 5K1YA 1YO5C 3JCUC 1I6XA 2OAZA 5DCMA 4LB5A 3TW6A 1R6RA 3EETA 1FTTA 3OS0A 3AG3H 4JX4A 3X2QH 1VQ6I 3C18A 3FBIB 1B4AA 2HWVA 2V9PA 2ZFWA 4NUBA 3MQ0A 3FKJA 4Y3OA 2BGCA 1B8IA 1FIPA 3ABTA 4A3GJ 1G59A 2I10A 3WE3A 1K7AA 4ITVA 3BTLA 1K78B 3KEYA 3WU0A 3HIFA 5BPDA 1RNLA 2UV1A 4HW0A 2E5ZA 3SZGA 5DTDA 3DXJF 2YR2A 1SFEA 1UCRA 2KDZA 1NG6A 2R5ZA 1N78A 4XLFA 5IPAA 2VKHA 3CUQC 2PFBA 3I71A 5GP9A 1B72A 2PLYA 4IXAA 2HVSA 3CF5F 3FF5A 1QQIA 1Z05A 3GEZA 1T2KA 2RN7A 3WTZA 4DW6A 3EYIA 2FMLA 4XRSG 1RIOH 3DU6A 2PJRA 2ID3A 2JZYA 4XLCA 5FLVA 2XAUA 1G6NA 2HU9A 3BDDA 3ZR8X 5GAHJ 3Q5FA 2O7OA 1ZTRA 1FX7A 5IT9K 1Z67A 5DUIA 4QLCU 3RZOJ 3OIQA 5D6EA 2E7WA 1OCRH 4XQFA 4M3DA 4XOPA 3H5NA 5FLXK 4UVBA 1SVMA 3PFYA 2YU3A 3WU1B 2BHZA 2F4MB 4Q4ZF 4EJUA 2E36A 4IO9F 2ZCWA 3DPTA 2KQRA 3GXOA 5BMZA 3AL0C 3HSEA 1J59A 2WB1A 3GTGJ 2HR3A 2VJ4A 3BOQA 2E1MC 1G3WA 4KMUX 1ETKA 3VYTB 1ZH5A 3CJRB 3NRVA 2BXYA 2UZKA 1WH5A 5J1RA 3V42A 2EZKA 2E5NA 2LF8A 1YJ9I 2EINH 2XIGA 1G3SA 2QKLB 3HUGB 3P9IA 1UELB 3GZ6A 2R7XA 1I1SA 3Q0WA 4KDPA 2DTRA 2DA4A 3OR2C 1XPXA 3LHEA 2XAJA 1QZEA 2XAFA 5FJ8J 5FRMA 3BQZA 3GW2A 3HSFA 4NB5A 2MFZA 4RM2A 4MQVA 1FZPB 2XSDC 4BE0A 3HXLA 5H2FC 2CGPA 2MD5A 1WJDA 1IN8A 5FKNA 2K40A 3WTUC 5LBQA 1PVEA 2BVLA 3DPLC 4BH9A 4HQMA 1ENHA 1MH3A 4IRIA 3AFHA 2HKXA 3LFKA 3KP3A 1ETXA 3BWGA 3CO7C 3F6OA 4LIVA 1Y39A 3HEFA 2WV1A 1HKSA 3OOPA 2R7QA 1JJ8C 2JRMA 4HQEA 1QHHD 3KZYA 2P19A 4AIJA 2L3DA 1IUFA 1MMSA 2M5WA 2EV0A 4K2EA 4NDLA 4HPQA 2AHCA 3DCFA 4LLLA 4NNJA 3BTIA 2VPRA 3LSHA 2ZJQF 4XOTA 5CKTA 3QYFA 4M9SA 3TOBA 3NEUA 2X1DA 4G94A 1FC3A 5E1ZB 4X0GA 1RRJA 1EH8A 1ZGJA 2VT3A 3KEQA 1VQMI 5BQTA 3DBHB 4Y52J 2DJNA 1V5EA 2KIQA 1JE8A 3FXRA 3QYEA 2Y0MA 4LMYA 3EUHA 2IS4A 3CDLA 1MBJA 2VC0A 3JRHA 2HVRA 3DPUA 5GAGJ 4XN3A 1BA5A 4B43A 5DCMB 4KIFA 3OWTA 2JA8J 2VJJA 4AIHA 2A5WA 3QRFF 3C7JA 3ERED 2DLLA 3KP7A 3NARA 2DMQA 2QGUA 3BPVA 2R4GA 1G2HA 4ON0A 1ZR2A 1PJRA 1O3RA 2X6OA 4KNYA 3GLXA 2EIMH 2VLAA 3PQKA 1YE9A 4A3BJ 1R1TA 2E19A 4UVCA 2VKDA 4WXDA 4AIKA 1BOAA 4RB3C 2AXTC 2X1CA 1ZK8A 1FBSA 2L7MP 2R5ZB 3K69A 1Z6TA 2VI6A 4HV5A 1HQCA 1X3UA 3PFIA 4J19A 4DIQA 2ISZA 1U6GA 2EFPA 5EYRA 1JD3A 1W7PD 1S72I 4JX5A 3BG6A 3JW4A 5CJ9A 2BBYA 4FX4A 3JAMK 1MD0A 2PJRB 4IHWA 3S8PA 3JRIA 3T8TA 1ORKA 1FYKA 1YRNA 4XKVA 2GBYA 2LDUA 4IVNA 3JTGA 3HOTA 2K7LA 1ON1A 1QHGA 3VSKA 3NAUA 4ZZLA 4G6TB 4RGUA 1D0XA 4ZJZA 3PIOF 1ERDA 2Y0SA 2W84A 4J01A 1TC3C 3L1PA 1OQYA 2DODA 3S2DJ 3ERMA 3L2QA 4EJOA 2MLKA 3H35A 3DTIA 2DPUA 5IT3A 2VJIA 3DTKA 3O8HA 1Y0NA 2DU9A 2MBFA 2VONA 4A69C 3J81Z 2QSGX 4HF2A 2X6WA 5CYVA 1BI3A 4M3EA 2DFEA 4M9XA 3CDHA 1OR7A 3ZMSA 4ZYHA 1JHHA 1MJBA 1OPCA 1RPWA 2FBHA 5TRDA 3TQNA 3TL4X 3QPTA 2IRFG 2DFIA 3HOXJ 1F43A 3H9GA 3O8GA 5A2QZ 2XAGA 2KZVA 3A0HC 3TEDA 1MIJA 4I98B 2HPIA 4L9TA 2L54A 3N4MA 5E17F 2X1EA 2HQRA 3KP4A 1TBXA 2DMUA 2KP6A 3HBLA 1R36A 1TW2A 2FQ4A 2VQLA 3LOCA 2Y31A 2EFWA 4S05A 1T38A 2LG4A 3S1QJ 2IP2A 1FWZA 5JR3A 3ISPA 2XB0X 1YX3A 4J00A 2P7CB 1FPQA 3RKXA 3H3VK 3F8BA 5GTIC 4MFEA 5J8CA 4A6EA 4I02A 3VWBA 3PSIA 2RKHA 1OCPA 4KICA 2IS2A 4Y13A 1EKEA 2B9SA 2AS5F 5FFZA 2DA7A 3PIPF 1RUNA 1O7LA 4CYDA 4G8XA 4PSXA 3MKLA 2LRDA 3K1PA 2V9VA 3EDPA 5FRNA 1PUFA 1AOYA 1TNTA 3U1KA 2HYJA 2P7VB 1IUYA 5HS8A 2KISA 5DYMA 3V4GA 1LDKB 3O3KA 5E1WA 3TGNA 5LRSA 4NC7A 4YEJA 4JQFA 3GX4X 2HZDA 1X1DA 1YTYA 3FISA 2W4SA 3WODF 4D0PA 3KP6A 4FT8A 4L0YB 2BZTA 5D4RA 1DPUA 1WJBA 3L9FA 4GYIA 4LIUA 1TQPA 3VYRB 1KZHA 1QU3A 5FROA 4R1HA 1ZYRF 5EJCA 4BJTA 2HYGD 3LSRA 4H0EA 2JSCA 3DV8A 2DOAA 4QPQA 4JYKA 1LEAA 3FKIJ 4QSHA 3CMEI 4C30A 1PYVA 4CXFA 2CW7A 3ZMZA 3GBGA 4ZYEA 4UV8A 5D4SA 3N97A 2RA5A 3IRRA 4XLPF 3D5RC 4HEA2 4PGHA 1SFXA 5HS7A 2JA7J 1KU7A 1BIBA 3QYBA 4B1RA 1K83J 3KYDB 3TDUC 4BXFA 3DFGA 4YFXF 4E7LA 1FSHA 2QYOA 2X4HA 4A3JJ 5L3BA 1X1BA 3QQAA 4CDGA 3NWTA 3S93A 1U9OA 5IT9Z 6PAXA 1E2XA 1AU7A 4HG2A 4IHYA 5DD4A 2CFXA 4ZC3A 4A3IJ 1XSDA 3M9AA 4I99C 2NAZA 5FLXZ 1CGPA 1ZG5A 2H94A 5HLGA 3DWLE 4RS8A 2DXIA 3F8LA 5F08A 2ZC2A 3WTWC 1ETVA 3A03A 3KZIC 4GXOA 3MCZA 2DT7B 2E35A 1WJAA 3BLYA 3OR1C 4OU0A 2LH9A 5HODA 2H1KA 1V5FA 2W00A 3SFIA 1R1UA 1HKQA 4QTRA 2GA1A 2M9HA 5HDGA 3Q0VA 5EG0A 2EWNA 4XKWA 2DFFA 1EF4A 2V79A 3DBRB 1XCVA 1SFKA 5FB2A 1UJ8A 3J7YJ 1S7EA 1ZLJA 4Y7NJ 2H8RA 5L3FA 2BE5F 1PP8F 1K4TA 2IS1A 3BR2A 1VQ9I 1WCMJ 2E34A 3RTRA 4U0YA 4BNCA 3I4MJ 1A04A 5IP9J 4P96A 2MD0A 3DQVC 1W36D 2VBXA 3GWZA 3DDVA 3M1EA 3RPQA 2VC1A 2VPLA 2P4WA 4M74A 3IKTA 1UHSA 2VQGA 4N9IA 2R5YA 4ZTJA 4LFUA 1I50J 4PSWA 2STTA 3VB2A 3SEQA 2D5VA 3S17J 2OGGA 1WJ5A 4WXCA 4IHSA 4BUPA 3G1OA 4C3HJ 5J47A 1V4RA 3BP8A 5D5VB 3F3XA 1J9IA 2FA1A 3BPXA 3K6GA 3KETA 1BR2A 1S5LC 3CP2A 3HOZJ 2MC4A 2O5RA 3KYCB 5IP7J 4YIIA 2VASA 4W97A 3OYCA 2DYSH 1FYLA 5LEJA 3IWFA 1GVDA 1UMQA 1UG0A 2DDAA 4IQJA 1X4PA 2IGKA 3OYJA 4I6ZA 1DP3A 1HOMA 5F0FA 4BBRJ 2LY9A 1LFUP 3E97A 4DGWB 3CCLI 5D5XB 4G7OF 1KQ9A 1YS7A 2HXOA 4M6XA 4DQ2A 3ABLH 3H3UA 3I4PA 2X0LA 4PZJA 2IBDA 4BQOA 3KX2A 5B3SH 4RAZA 2FBIA 4D9JA 2ESHA 3REOA 3ML6A 1GV2A 2EILH 2GA2A 1IN5A 2IA2A 2HYFA 2ZNZA 3K0LA 2VJ5A 5M3FJ 4CICA 1ZN2A 3I3LA 2XGEA 5E8GA 5KCMA 3WHCA 4WWCA 1TT5B 4YFKF 4LJZF 3NQOA 4MLOA 1Z3YA 2VT2A 1XD7A 3E0JB 2GIVA 2VXDA 3OSFA 2XV4S 4I0BA 5HLHA 2H09A 2AXLA 1UHWA 3DU5A 1N75A 3W6KB 1SD4A 3VFZA 1H8AC 2HDWA 2EZIA 1T6SA 2EA4A 4R8HA 3PNVA 2K85A 4A2UA 3CCEI 3NWSA 1IRGA 1UHMA 2DOFA 2DK5A 1FIAA 2QEXI 1WZ2A 1EH6A 2TDXA 3PO2J 3OL3A 5CPRB 1Y1WJ 3G1MA 4EV0A 2GXAA 1JTXA 3JAMZ 2EB7A 4X1EA 4M3FA 1YW7A 1XGSA 1YJNI 2NS0A 1A5JA 1FBQA 2FOWA 2M4KA 3GCMA 4FASD 5LD2C 3K1NA 4G7HF 3EUAA 2OV7A 5HVQC 1FMVA 2ZJRF 2GXBA 4CCKA 2M0MA 1LB2A 4HDVA 3HOVJ 1SD6A 1OYIA 2DTZA 1IN4A 2L5QA 4YFNF 2PJPA 4ZSKA 2OPTA 2ZKZA 3GMEA 1ON2A 4BGDA 4NQWB 3OL4A 1MNEA 3L2CA 3LSMA 1X3ZB 3VDXA 4R79A 3QP5A 3RIRA 2E2IJ 2HOAA 3KP2A 4E7HA 1TTYA 1XTAA 2L9SA 3I9V2 4XICA 1S8NA 1FLIA 4ENKA 2WBMA 4QIWN 3K4JA 3CMMA 4RLFA 3FBNB 4XL9A 4P9UA 3RKQA 2DAOA 1Z91A 1HW2A 2A07F 2DOEA 2OJED 4BL0B 5FO5A 1G1BA 2CS3A 1Z0XA 4M6YA 2LLKA 5LGTA 1BBYA 1F36A 2P5VA 2Z3YA 3ZPLA 1KU9A 4PJLA 4Y17A 1IXSB 1D1BA 2J5OA 1MKMA 1MMNA 5FKOA 3F8CA 4EM2A 4BU2A 3AL0B 1ZR4A 1P4AA 4UHTA 2HEOA 5HLIA 2LNBA 2KT0A 3M07A 4UB6C 3E5UA 1Z9CA 3ROUA 2XVCA 2O61A 1V5GA 5CVVA 2CV1A 1TWGJ 4RAGA 3RKYA 2R5YB 2M1BA 2QA4I 1X2NA 3EYYA 2KRCA 2NS8A 4BACA 3W2AA 1JKOC 4KUMA 5LEKA 2ETHA 5FFXA 2CH0A 4HNTA 1A36A 5ILSA 3K2AA 3CCRI 1U8RA 1VQNI 2V26A 5L3EA 2HFHA 2HZTA 3RKWA 4IF4A 2EFNA 4XIDA 4C3IJ 1DGWY 3KFWX 1OYYA 4CCJA 5JHFA 2VKEA 3M4OJ 4KT6A 3WGHA 3BTCA 5K5OA 3IC7A 1B1BA 3QOPA 4M3BA 2EH3A 5TISC 4CA0A 3S2HJ 3ZMTA 3ABMH 3IP4B 3FZVA 2BXZA 2M3AA 1D8JA 4FHTA 1DQUA 2XF5A 1NK3P 4DOZA 2IKKA 3I5UA 3ZP5A 3Q0UA 3GZNB 4AIDA 1POGA 4A3CJ 4AD9A 4G7ZF 4O6JA 1YHQI 3CC7I 4XBFA 3FXQA 1OISA 3FMQA 3T8RA 1XDUA 1TT8A 1TWHJ 3HSRA 2MH9A 3TMOA 5EDNA 5J1UA 2HDDA 2J5PA 1FTZA 3PNTA 2QQ8A 1GLNA 2DMTA 4RA2A 3GFLA 2RC4A 3R0AA 4AM3A 1ULYA 2VN2A 3BC8A 2CG4A 1SAXA 3W6VA 5DCFA 4E6KG 3MFKA 4IL6C 3WGGA 5J8FA 2X6XA 2CQ7A 3V8JA 4MIMA 1XCBA 3ESWB 4NC8A 1HDPA 1WHUA 3T1BA 2LP0A 5B1AH 3SDBA 3AG1H 2OUMA 1WJEA 2K4BA 2WC2A 1U5TB 3I59A 2VQCA 1KGSA 2EFOA 3F6VA 3TP3A 2Y9ZA 4BDZA 2LFBA 1JUSA 4DYCA 2IS6A 1R5ID 2EJRA 4YIFA 5KK1A 3CMYA 4M6VA 1ETYA 1ONVA 2Z33A 4ZH4F 1ZGAA 3DEWA 2F2EA 3FX3A 3OYNA 2MC3A 2KFDA 1H89C 3S1NJ 3B02A 2RDPA 1F9NA 1AHDP 1G4DA 4RGXA 2HOSA 4HSRA 1GUUA 2L0KA 1HDDC 2QQAA 1R1VA 3HRSA 2OQGA 1KQ0A 5J4YA 5J6XA 3SZPA 1SMTA 3WHBA 2ZXIA 4WF2A 2KL4A 4XLAA 1VQ7I 4EQQA 2QF7A 2FSWA 3JR9A 1VTNC 4P1WA 4HV6A 2TCTA 2HTJA 2JT1A 1GVJA 2RGVA 1ZRFA 4XRSA 1W0TA 2IGMA 4A93J 4PJNA 1OJLA 2JUGA 3SXYA 3A0BC 1H0MA 1G3YA 1Q1VA 2PEXA 1YQAA 4UXNA 3RPUD 5J4VA 2JK3A 2L4MA 3JTHA 2EPFA 2WAEA 4IEJA 1RKWA 4ZYAA 2RVCA 1YOVB 4ESFA 5K5QA 5D5WB 1AKHA 1IN7A 3ZQIA 1TWFJ 4PJJA 2GLOA 3IWZA 4L18B 1O57A 1QVUA 2FD5A 4HX4A 2NVXJ 2CUFA 2NVQJ 1H9GA 4XR6A 4ETSA 4V19K 1EJ9A 1GHCA 1S3JA 4I7HA 1XSVA 3RQ4A 1LQ1A 4E7JA 1F1ZA 2WY7Q 2CYYA 1D1CA 3RDIA 2W57A 4DBRA 4RB0A 4AC0A 3GFIA 4CCOA 2B7EA 3KLNA 1ACIA 4LK0F 2VKVA 1VQOI 3TP0A 2JA5J 1G81A 2R3SA 5JLXA 3MVPA 1P7IA 2IEKA 4DZJA 2OOIA 3JREA 1DP7P 3VODA 1C0WA 1Z77A 1WSUA 2XRLA 2YUSA 2NRAC 4HX8A 1B8IB 4IQ4A 2L01A 2MGQA 4UB8C 2QWWA 2A5YB 3OYEA 3DP7A 1IRFA 1XS9A 1RZ4A 2MYSA 2KIUA 4XONA 4Q48A 1ZG3A 4NHJA 3FHNA 4HNVA 1BJAA 3ONQA 3FM3A 1U3EM 3LSJA 1B6AA 2CRGA 2ZMEC 2Z5UA 4CSWA 1Y6IA 3CF2A 3RI4A 1HW1A 1WPKA 3LNQA 3B73A 3MN2A 2DA2A 3S3OA 4L5EA 2ESNA 1B72B 2P5KA 4EJVA 2CWEA 3IUOA 3OYHA 5BOXA 2HI3A 4BQAA 1HSJA 4BHBA 3HKZN 3RSNA 4IHTA 2RNGA 4EMSA 3B6AA 1BI0A 1MBHA 2A61A 2V1XA 4AYBN 5F1JA 1VFCA 3S32A 3GFMA 5EEHA 2WV0A 3EPZA 5H6RA 2R7RA 3ASOH 4C9YA 2ICWG 3BTJA 4KIBA 1MDMA 4YELA 5EEAA 4YIRX 1IV8A 1OLTA 3IAS2 1CQTA 2ECCA 5HDNA 1D3YA 1I1GA 1QZZA 4A3EJ 4CYCA 3C2BA 3N05A 1W36C 2EA2A 2FNAA 1QA6A 3G2BA 2XROA 1VQ5I 1OCTC 2KRFA 5E3MA 1R22A 1LDDA 2FBKA 2UXXA 4Y15A 5BPIA 3FHZA 4ZSBA 2QQBA 2QUFA 2DBBA 2D1VA 4PJ0C 1J09A 2RNJA 1D5VA 4XLHA 1YIJI 3CCQI 2OU2A 4HBLA 5IY5H 2VBZA 5ICGA 3U1DA 3CLQA 2I5UA 3AG2H 3C2HA 2XKOA 1IC8A 1WGXA 2GWRA 4WXHA 1H9TA 1PDNC 3BCAA 3RCOA 1USSA 3GTKJ 1FW9A 5D8KB 4FE4A 4B3XA 4RLQA 4XKBA 1KA8A 4EM0B 1LE8A 3SEZA 3M3YJ 4IRHA 5IP6A 3M8EA 3U9GA 1F4KA 5HLTA 2FRHA 2LR8A 1KQ8A 2FNPA 1T39A 2COMA 1XB4A 4F93B 1BW5A 4KA4A 1MH4A 1OMIA 2L7KA 3IH2A 2K9MA 3IV5A 1FSEA 2M7BA 2BV6A 3KPHA 5E20A 3S1MJ 4PK4A 3I54A 4XNFA 4DZPA 1HF0A 2AQEA 5CVUA 2O8KA 1OCCH 4V2FA 1GXPA 2CV0A 2O3FA 4UUTA 2EIJH 4II2A 3LAPA 1TT0A 2PMZN 1J75A 4PDKA 4XSZF 2EK5A 3BQYA 2M34A 1GV5A 2MG4A 1R5HA 3VSLA 3HHGA 2ZNYA 3Q3SA 4HA8A 1R9TJ 1NHAA 1XMXA 5ICFA 2DK8A 5E8IA 4LG0A 2R0QC 4UUVA 1IRXA 1KONA 4JK1X 4ENMA 1SVLA 3ZRGA 4B09A 5B5EC 2NXNB 2R7FA 3BR1A 3OYGA 2GXGA 2H27A 1E3PA 2HGCA 2COBA 3RYPA 1W1WE 5CLSA 3DKXA 2HKOA 3J7ZI 2YPRA 3VEPA 2V9KA 2FA5A 2BY0A 2MA3A 3RQIA 3S3NA 2OTJI 1LUJB 3ZQHA 2HQ5A 4Y33A 2JMWA 3MMYB 2IGOA 3G73A 4U7DA 1MBGA 1MBEA 1Q1HA 4GGGA 1IRZA 3M7GA 3OOUA 5KVRA 3WU2C 1WH7A 2WAQN 3KLOA 5L3GA 4EGYA 1Z21A 4PGGA 4Q47A 1W7PA 2GOMA 1OFCX 4RGSA 3GFJA 2DYRH 2MLGA 2WWYA 1IJWC 5GTHC 4HLYA 3A01A 1WWXA 2R7SA 3H1CA 4U7BA 4BDYA 2P6SA 3LWFA 2BEOA 1E3OC 2VUMJ 1ZQ3P 3HHHA 2O9LA 1ZLKA 3KYLA 3OY9A 4BE1A 3BROA 4M71A 4O5VA 1DGRM 5LGNA 1VQKI 3ZQ7A 1UFMA 2YS9A 2OA4A 3MAJA 1MNMC 3CUQA 2IA1A 4EVIA 4A0YA 3GTMJ 4XLNF 3T5XA 1PP7U 3BG3A 5M5YJ 3V8KA 1BC7C 4FE7A 4OIPF 1TP4A 4RAYA 1YRNB 1ZRDA 3E5XA 1XGMA 2LMDA 3L2WA 2FU4A 3G71I 2Q2EA 3OYBA 1QVTA 1SD7A 3LSKA 5ERIA 2G9WA 4CYCB 2O6GE 4BY1J 3J7AO 2A68F 5E79C 1W0UA 3WGIA 3RZDJ 3BJOA 1T98A 3ZQLA 3E1SA 1U2WA 3GVAA 2C6YA 2LYCA 4N0BA 5BNGA 1SFOJ 3HKZA 2MW8A 1L3LA 2DN0A 2W24A 3D5LA 3PUBA 3BR5A 3CMAI 2K27A 3DLLF 2X9DA 2L02A 3ZOBA 1ETOA 3BR0A 2H6CA 2RQPA 1R4NB 1I3AA 1V54H 1RUOA 1XDSA 3H9JA 1NTCA 3WTVC 5EZHA 1P92A 2JVGA 2EFQA 2G7UA 3SQNA 3ELKA 1MMGA 1VI0A 5F64A 2DMPA 1HXDA 2F4IA 2K86A 1QGPA 3DLAA 3JSOA 1CF7A 2KDOA 4O3MA 2MH2A 1JGGA 1ZREA 4B44A 3HRUA 1E3HA 2A05A 1LE8B 3S1RJ 1PUEE 3WG7H 2ZB9A 2A6EF 3SHFA 1TNSA 2HVQA 1D5YA 1G8XA 2KRHA 2BW3A 4BYYA 2Z1DA 1HLVA 5HS9A 3K4KA 4EATA 3GTOJ 2VQHA 5EGOA 5E1XA 3BR6A 1VQPI 1HBXG 3BG9A 3OYKA 2JPBA 1X3WB 4AVPA 4N4OB 2CV2A 2JRTA 4BQQA 1Y56A 1K6YA 3OS2A 2KKOA 4M72A 4GRIA 4LOCA 3HOWJ 1BOBA 2HS5A 2LY2A 4FCYA 3GTLJ 3W2WA 2GOXB 3L2RA 2IPQX 3HB9A 5TGTA 3G4SI 3LSIA 2EV6A 4AUXA 2FJ1A 3JRBA 4D7NA 2F5VA 3CP8A 2ZXJA 2E1NA 3FWEA 4JP0A 3TDZC 1NK2P 4I2OA 1IV6A 1PUFB 3IHUA 1UAAA 3MKZA 5HOOA 3TKYA 1EH7A 3K4BA 4LG0B 1MNDA 1UZCA 5AIQA 4RAFA 3HTSB 1QPMA 3PM1A 4E7IA 1J2XA 3KCCA 3UKGA 3K2ZA 4CZZA 3OYDA 1K78A 4A3DJ 3MZHA 2LSOA 2V6CA 1T56A 3PJRA 2IAIA 4ENJA 5IYBJ 4CHUA 1TQMA 1Z7LA 3CCVI 3OYIA 3H3ZA 3U21A 3ZN0A 2RV8A 1P7JA 5LGUA 2OC6A 2NS7A 3OYFA 3ZQCA 4D5CA 4HF0A 2LF7A 3CNVA 3R4KA 2P0WA 2CUZA
chains in the Genus database with same CATH topology
3ABUA 2VOOA 3F22A 2CSOA 3BJ6A 4BHCA 2UWMA 4ZZDA 2XAHA 1KYZA 3R60A 3ECHA 2ZMEA 2Y75A 4ZYDA 4IJAA 1J5YA 1IF1A 4N9HA 3CUQB 1R5GA 2L4AA 3I53A 2DT5A 2Q0OA 2YSRA 3HUGA 4A0XA 1FNNA 1J0RA 3MEXA 1FT9A 1SFUA 5ED4A 3FMSA 4HAMA 1ZARA 3J81K 5CVJA 5H6QA 5ICEA 2PMUA 1BN5A 1QBJA 1YG2A 2YX4A 3QU6A 4F7ZA 4KIGA 1LDJA 2FQ3A 1IXRC 1K6OA 3HFIA 3P7NA 3LQQA 4BHPA 2IVMA 4WCGA 4EM1A 3PQJA 4KYWA 4ASNA 5EEGA 4FX0A 5LLQA 3I58A 5FD6A 1O3SA 2CQKA 3FMRA 5CVRA 3U2RA 1ZRCA 3E3VA 2XUBA 5LHIA 1YW9A 3LAJA 2OZUA 1S7OA 3O6BB 1K79A 1SMYF 3BJAA 3F8NA 2WTEA 1U78A 3G3ZA 2V1DA 3CUOA 4P5OA 3F23A 3TOAA 1STZA 2PG4A 4XRFA 5DDGA 4KN4X 2Z99A 2VBWA 1W5TA 1XGOA 2M45A 2PN6A 4TV7A 2DQRA 3ULQB 2JTVA 1Z1DA 4L5JA 2F5FA 3IRQA 2IW5A 5ICCA 4I01A 1TQIA 1XGNA 3K1MA 4MTEA 2NNNA 4G6QA 1LEBA 2OZ6A 2ELHA 1XLRA 2ZMEB 1W4MA 1FYMA 2P8TA 2R7DA 5JHUA 3HRTA 1USTA 4Q5SF 5ILUA 1IXCA 3K9TA 4MHGA 1ZHFA 5F6FA 3EQLF 3MZYA 1I27A 4GCVA 4M9ZA 4OIRF 1YLFA 5CVIA 4LK1F 3L5ZA 3F8FA 3OV8A 2QVOA 1KYWA 4ENNA 1JXSA 1ODDA 2KJCA 2OBPA 4KFCA 3MWMA 5L3CA 1J7KA 4EJTA 2XASA 4S04A 3E5QA 2ISYA 2IT0A 2ADUA 3QAHA 1QZYA 5ILVA 2HOEA 2W25A 1P2FA 3I0TA 1YFHA 3GF2A 2DPDA 2VXZA 2QQ9A 2CO5A 1YYVA 3WTSC 3Q9SA 4RB2C 2NWIA 1S29A 3Q9VA 1R00A 2QZ8A 2GAUA 3E6MA 2NNYA 2Q8KA 3F21A 4L0ZB 4B8XA 4I0AA 1D8KA 3BY6A 2A6HF 1LNWA 1ZAOA 3P9CA 2BYVE 1W5SA 4LLNA 3J80K 5D5UB 3WTTC 2XKPA 3V8LA 3CJNA 3DEUA 3RJPA 1BI1A 1U5TC 2FXAA 5D6FA 2NYXA 2OD5A 4EGZA 4G9YA 2KJBA 2D1HA 1B9MA 3AAFA 5HDKA 3LA3A 1WQ2A 1IZ1A 2F5DA 3V7CA 5JFRA 1RI7A 3M8FA 2IA0A 4ESJA 1YS6A 1V3FA 3ZN1A 3R6SA 3I59B 4UV9A 5LHHA 2STWA 2M87A 1B59A 3L09A 4ZSIA 2QENA 1P4XA 3V7RA 1HW5A 1DPRA 5JVTA 2QBYA 3ECOA 3SFZA 2QLZA 4U0WA 3GUDA 4KN7X 1I5ZA 2B0LA 4U88A 2EV5A 3RPUA 3QPHA 3ZMUA 3D0SA 3S2WA 4P9FA 4A6DA 4OMYA 5FGMA 1LVAA 5FD5A 3KZZA 1WKMA 1S7AA 1WRJA 3HOSA 1EV7A 3L7WA 2ZJ2A 2PMHA 4YG2F 4DNCA 1Y0UA 2HDCA 1BIAA 4A0ZA 4HF1A 2W85A 1Z6RA 4OOIA 3R0JA 2GZWA 4GYGA 2YX7A 4ESBA 4ZYGA 1HSTA 1FP1D 4LB6B 1KU3A 2ACJA 2VBYA 3L00A 3HRMA 2LKPA 4P55A 2A3SA 2CW0F 1Z7UA 4OIQF 4HZFA 2M30A 5BS6A 3E6DA 1OYWA 5D8LB 1JGSA 5AONA 2DQLA 3CO6C 4WK8F 3WG9A 2FOKA 4LLGF 4KT5C 3TO9A 1R7JA 4IRGA 4EJWA 3LSTA 4U0VA 4Z2YA 4QWQA 2D45A 4WX9A 2GQQA 3I64A 4RB1A 4MGRA 2XHKA 2E1CA 4CGZA 4UNOA 1BI2A 4CO8A 3C3WA 4KMFA 4E70A 3LA7A 5DEQA 2VOPA 1MDMB 4AWXB 3KEOA 3VOEA 4LGWA 2VODA 2PI0A 5DD8A 2O8XA 4NQWA 3TO7A 1JHFA 4L9VA 4RGRA 2H6BA 3C1DA 1MZBA 2KIFA 2HTSA 2QBYB 2PBIA 2V1UA 4L5IA 3T0YA 1DUXC 2VE8A 4A5MA 3FM5A 4OINF 5E18F 1T0FA 1XN7A 3IL2A 3DKWA 1IAWA 3E6CC 3GYHX 2OQRA 3KE2A 1QNTA 4MNUA 2O0YA 2F5EA 1IW7F 2FE3A 2QM3A 3BZ6A 3COAC 1XMKA 4GO1A 4XSXF 5K5RA 2UXNA 2P6TA 5LHGA 1YIOA 4HX7A 1BC8C 1O7FA 3KP5A 1MJAA 1AWCA 2FF4A 3P9KA 1YW8A 2XAQA 4HOBA 2DI3A 2P5LC 1FY7A 1S6LA 3O2PE 5H20A 1P4WA 1TW3A 3FXUA 1HKTA 1L0OC 5DUKA 4MEYF 3H92A 5F1RA 3SZTA 1DDNA 2VE9A 1QO0D 3HYIA 4JBAA 1O3QA 3J80Z 3QP6A 4PCQA 1SD5A 4HYEA 1KU2A 3CLOA 4G6DA 1W7PB 3RYRA 3WE2A 1F5TA 3GO5A 5JI6A 4M73A 5AIPA 2IJLA 2Y48A 2DO7A 4L9NA 2XGXA 3QU3A 1FOKA 4KNYA 1XMAA 3WTYC 5TJJA 2A69F 4MEXF 1B9NA 2PQ8A 5L3DA 1G3TA 1OKRA 3HTUA 4IPAA 4BXUA 1U5TA 1FBUA 1IN6A 4HDUA 4I09A 3W6JB 3CTAA 3F8MA 5DV5A 1GXQA 2XRNA 4BAYA 1XSXA 2HQNA 4L9JA 2FEZA 1WI9A 4HLXA 2KIMA 4UVAA 3WTXC 1UB9A 3E6BA 2E7XA 3LQRA 2M8EA 2ZBKA 2DW4A 5LRRA 1R58A 3TO6A 1MGTA 1BM9A 4LD5A 2PKHA 3F72A 5A2QK 4OIOF 1O3TA 2K02A 1TLHB 2FMYA 3LA2A 3DF8A 2D2WA 1REPC 1CF7B 1ZG1A 3IKVA 4OMZA 1FP2A 3V7SA 2O03A 4A5NA 1R23A 3JSPA 4MQ9F 3ZMVA 4MTDA 3ZMDA 3GZ5A 1P6RA 1MJ9A 4A12A 2Z9OA 2ZO4A 2JPCA 3R61A 1E17A 2F5CA 2K4JA 1LJ9A 2G7HA 1YO5C 5K1YA 1I6XA 2OAZA 5DCMA 4LB5A 3EETA 3C18A 1B4AA 2HWVA 2ZFWA 3MQ0A 2BGCA 3ABTA 3WE3A 1K7AA 1K78B 3WU0A 3HIFA 5BPDA 1RNLA 4HW0A 3DXJF 2YR2A 1SFEA 1UCRA 3CUQC 3I71A 2PFBA 2PLYA 4IXAA 1T2KA 3FF5A 1QQIA 1Z05A 3GEZA 2RN7A 3WTZA 3EYIA 2FMLA 1RIOH 2JZYA 1G6NA 3BDDA 3Q5FA 1FX7A 5IT9K 5DUIA 4QLCU 5D6EA 2E7WA 5FLXK 4UVBA 2YU3A 3WU1B 4Q4ZF 4EJUA 2ZCWA 3DPTA 3GXOA 5BMZA 3HSEA 1J59A 2HR3A 3BOQA 1G3WA 4KMUX 1ZH5A 3NRVA 2UZKA 2LF8A 2XIGA 1G3SA 3P9IA 3GZ6A 1I1SA 4KDPA 2DTRA 3LHEA 2XAJA 2XAFA 3GW2A 3HSFA 4NB5A 4MQVA 1FZPB 2CGPA 2MD5A 1IN8A 3WTUC 5LBQA 3DPLC 4BH9A 4HQMA 4IRIA 2HKXA 3LFKA 3KP3A 3BWGA 3CO7C 3F6OA 1HKSA 3OOPA 4HQEA 3KZYA 2P19A 4AIJA 2L3DA 2M5WA 2EV0A 4K2EA 2AHCA 4LLLA 4M9SA 3TOBA 3NEUA 5E1ZB 1FC3A 4G94A 1EH8A 1ZGJA 2VT3A 3KEQA 5BQTA 1JE8A 3FXRA 2Y0MA 4LMYA 3EUHA 2VC0A 5DCMB 4KIFA 4AIHA 3QRFF 3C7JA 3ERED 2DLLA 3KP7A 3BPVA 4ON0A 1O3RA 3GLXA 3PQKA 1R1TA 4UVCA 4WXDA 4AIKA 1BOAA 4RB3C 1FBSA 3K69A 1Z6TA 4HV5A 1HQCA 1X3UA 3PFIA 2ISZA 1U6GA 2EFPA 1JD3A 1W7PD 3JW4A 5CJ9A 4FX4A 2BBYA 3JAMK 1MD0A 3T8TA 1FYKA 2LDUA 4IVNA 3JTGA 3HOTA 2K7LA 1ON1A 4ZZLA 4RGUA 2W84A 4EJOA 2MLKA 2DPUA 5IT3A 2MBFA 2DU9A 2VONA 3J81Z 4HF2A 5CYVA 1BI3A 4M9XA 3ZMSA 3CDHA 1OR7A 4ZYHA 1JHHA 1MJBA 1OPCA 2FBHA 5TRDA 3TQNA 3QPTA 2IRFG 2DFIA 5A2QZ 2XAGA 4I98B 4L9TA 2L54A 3N4MA 5E17F 2HQRA 3KP4A 1TBXA 1R36A 1TW2A 2EFWA 4S05A 1T38A 2IP2A 1FWZA 5JR3A 3ISPA 2P7CB 1FPQA 3RKXA 3F8BA 5J8CA 4A6EA 4I02A 2RKHA 4KICA 4Y13A 2AS5F 5FFZA 1RUNA 1O7LA 4CYDA 4G8XA 3K1PA 2V9VA 3EDPA 1AOYA 1TNTA 2P7VB 1IUYA 5HS8A 5DYMA 3V4GA 1LDKB 3O3KA 5E1WA 3TGNA 5LRSA 4JQFA 3GX4X 1YTYA 4D0PA 3WODF 4L0YB 3KP6A 4FT8A 1DPUA 5D4RA 3L9FA 4GYIA 1TQPA 4R1HA 1ZYRF 2HYGD 4H0EA 2JSCA 3DV8A 1LEAA 4CXFA 3ZMZA 4ZYEA 4UV8A 5D4SA 3N97A 2RA5A 3IRRA 4XLPF 4PGHA 1SFXA 5HS7A 1KU7A 1BIBA 3TDUC 3DFGA 4YFXF 1FSHA 2QYOA 2X4HA 5L3BA 4CDGA 5IT9Z 6PAXA 1E2XA 5DD4A 2CFXA 1XSDA 3M9AA 2NAZA 5FLXZ 1CGPA 1ZG5A 2H94A 5HLGA 4RS8A 3F8LA 3WTWC 4GXOA 3MCZA 4OU0A 1R1UA 1HKQA 2GA1A 5HDGA 2EWNA 2V79A 1XCVA 5FB2A 1ZLJA 5L3FA 2BE5F 1PP8F 3RTRA 4U0YA 4BNCA 1A04A 4P96A 3DQVC 2VBXA 3GWZA 3DDVA 3M1EA 3RPQA 2VC1A 2P4WA 4M74A 3IKTA 4N9IA 4LFUA 2STTA 3VB2A 2OGGA 4WXCA 4IHSA 1V4RA 3BP8A 5D5VB 3F3XA 1J9IA 2FA1A 3BPXA 3KETA 4YIIA 1FYLA 5LEJA 3IWFA 3E97A 5D5XB 4G7OF 1KQ9A 1YS7A 4M6XA 4DQ2A 3H3UA 3I4PA 2X0LA 4PZJA 4RAZA 2FBIA 2ESHA 3REOA 3ML6A 2IA2A 2ZNZA 2GA2A 1IN5A 3K0LA 2HYFA 4CICA 1ZN2A 4WWCA 5E8GA 4YFKF 4LJZF 3NQOA 2VT2A 1XD7A 2GIVA 2XV4S 5HLHA 4I0BA 2H09A 2AXLA 1UHWA 3W6KB 1SD4A 3VFZA 1T6SA 2EA4A 4R8HA 4A2UA 1IRGA 1UHMA 2DK5A 1EH6A 2TDXA 4EV0A 3JAMZ 2EB7A 1YW7A 1XGSA 2NS0A 1FBQA 3K1NA 4G7HF 5HVQC 2GXBA 1LB2A 4HDVA 1SD6A 1OYIA 2PJPA 1IN4A 4YFNF 4ZSKA 2ZKZA 1ON2A 3L2CA 4R79A 3QP5A 3RIRA 3KP2A 1TTYA 1S8NA 1FLIA 4ENKA 4P9UA 2DAOA 1Z91A 1HW2A 2A07F 5FO5A 1G1BA 4M6YA 5LGTA 1BBYA 2P5VA 3ZPLA 2Z3YA 1KU9A 4Y17A 1IXSB 2J5OA 1MKMA 4EM2A 3F8CA 1P4AA 4UHTA 2HEOA 5HLIA 2LNBA 3E5UA 1Z9CA 3ROUA 2XVCA 2O61A 5CVVA 3RKYA 2M1BA 3EYYA 4KUMA 5LEKA 2ETHA 5FFXA 5ILSA 1U8RA 5L3EA 2HFHA 2HZTA 3RKWA 4IF4A 2EFNA 3KFWX 1OYYA 3WGHA 5K5OA 3IC7A 1B1BA 3QOPA 3ZMTA 3FZVA 1D8JA 4FHTA 2IKKA 3I5UA 3ZP5A 4AD9A 4G7ZF 4O6JA 4XBFA 3FXQA 3FMQA 3T8RA 1XDUA 1TT8A 3HSRA 2MH9A 2J5PA 3GFLA 2RC4A 3R0AA 1ULYA 2VN2A 1SAXA 2CG4A 5DCFA 3MFKA 3WGGA 5J8FA 3V8JA 1XCBA 3T1BA 2WC2A 2K4BA 1U5TB 3I59A 1KGSA 2EFOA 3F6VA 2EJRA 4YIFA 5KK1A 1ONVA 2Z33A 4ZH4F 1ZGAA 2F2EA 3FX3A 2MC3A 3B02A 2RDPA 1F9NA 1G4DA 4RGXA 2QQAA 1R1VA 3HRSA 2OQGA 1KQ0A 5J6XA 3SZPA 1SMTA 4WF2A 4EQQA 2FSWA 1VTNC 4HV6A 2HTJA 2JT1A 1GVJA 2RGVA 1ZRFA 3SXYA 1H0MA 1G3YA 2PEXA 4UXNA 1YQAA 2L4MA 3JTHA 2RVCA 4ESFA 5K5QA 5D5WB 1IN7A 4L18B 3IWZA 1O57A 4HX4A 1H9GA 4ETSA 1GHCA 1S3JA 4I7HA 1XSVA 1LQ1A 1F1ZA 2CYYA 3RDIA 2W57A 4RB0A 3GFIA 3KLNA 4LK0F 1G81A 2R3SA 2OOIA 1DP7P 3VODA 1C0WA 1WSUA 2NRAC 4HX8A 2L01A 2QWWA 2A5YB 3DP7A 1IRFA 1RZ4A 2KIUA 4Q48A 1ZG3A 4NHJA 1BJAA 3FM3A 1U3EM 1B6AA 2Z5UA 3RI4A 1HW1A 3B73A 2ESNA 2P5KA 4EJVA 2CWEA 5BOXA 4BQAA 1HSJA 4BHBA 4IHTA 4EMSA 1BI0A 2A61A 2V1XA 3GFMA 5EEHA 2WV0A 5H6RA 4KIBA 1MDMA 5HDNA 1D3YA 1I1GA 1QZZA 2EA2A 2FNAA 2XROA 2KRFA 1R22A 1LDDA 2FBKA 2UXXA 4Y15A 5BPIA 3FHZA 4ZSBA 2QQBA 2QUFA 2DBBA 2D1VA 2RNJA 1D5VA 2OU2A 4HBLA 2VBZA 5ICGA 3U1DA 2XKOA 4WXHA 2GWRA 1H9TA 1PDNC 1USSA 1FW9A 5D8KB 1KA8A 4EM0B 4IRHA 3M8EA 3U9GA 1F4KA 2FRHA 1KQ8A 2FNPA 1T39A 2COMA 1XB4A 4KA4A 1OMIA 1FSEA 2BV6A 5E20A 3I54A 5CVUA 1GXPA 2O3FA 3LAPA 1J75A 4PDKA 4XSZF 2EK5A 1R5HA 3HHGA 2ZNYA 4HA8A 1NHAA 5ICFA 2DK8A 5E8IA 4LG0A 4UUVA 4JK1X 4ENMA 4B09A 2R7FA 2GXGA 2H27A 2HGCA 3RYPA 5CLSA 2HKOA 2YPRA 3VEPA 2FA5A 2MA3A 3G73A 4U7DA 4GGGA 1Q1HA 3M7GA 5KVRA 3KLOA 5L3GA 4EGYA 4PGGA 4Q47A 1W7PA 4RGSA 3GFJA 2MLGA 2WWYA 4HLYA 1WWXA 4U7BA 2P6SA 3LWFA 2BEOA 3HHHA 1ZLKA 3BROA 4M71A 4O5VA 5LGNA 3ZQ7A 1UFMA 2OA4A 3MAJA 3CUQA 2IA1A 4EVIA 4A0YA 4XLNF 3T5XA 1PP7U 3V8KA 1BC7C 4OIPF 4RAYA 1ZRDA 3E5XA 1XGMA 2FU4A 2Q2EA 5ERIA 2G9WA 2O6GE 3J7AO 2A68F 3WGIA 3BJOA 1T98A 1U2WA 3GVAA 2C6YA 4N0BA 1L3LA 2W24A 3D5LA 2K27A 2L02A 2H6CA 2RQPA 1RUOA 1XDSA 3WTVC 1P92A 2EFQA 2G7UA 3SQNA 3ELKA 5F64A 1HXDA 2K86A 1QGPA 3JSOA 1CF7A 4O3MA 2MH2A 1ZREA 3HRUA 1PUEE 2A6EF 3SHFA 1TNSA 4BYYA 5HS9A 5E1XA 1HBXG 2JPBA 4AVPA 2JRTA 2KKOA 4M72A 2HS5A 2IPQX 2EV6A 3FWEA 2ZXJA 2E1NA 3TDZC 4I2OA 3IHUA 5HOOA 3TKYA 1EH7A 4LG0B 5AIQA 3HTSB 1QPMA 1J2XA 3KCCA 3K2ZA 4CZZA 1K78A 3MZHA 2LSOA 2V6CA 4ENJA 4CHUA 1TQMA 3H3ZA 3ZN0A 2RV8A 5LGUA 4HF0A 2LF7A 3CNVA 3R4KA 1SD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABU A;  2VOO A;  3F22 A;  2CSO A;  3BJ6 A;  4BHC A;  2UWM A;  4ZZD A;  2XAH A;  1KYZ A;  3R60 A;  3ECH A;  2ZME A;  2Y75 A;  4ZYD A;  4IJA A;  1J5Y A;  1IF1 A;  4N9H A;  3CUQ B;  1R5G A;  2L4A A;  3I53 A;  2DT5 A;  2Q0O A;  2YSR A;  3HUG A;  4A0X A;  1FNN A;  1J0R A;  3MEX A;  1FT9 A;  1SFU A;  5ED4 A;  3FMS A;  4HAM A;  1ZAR A;  3J81 K;  5CVJ A;  5H6Q A;  5ICE A;  2PMU A;  1BN5 A;  1QBJ A;  1YG2 A;  2YX4 A;  3QU6 A;  4F7Z A;  4KIG A;  1LDJ A;  2FQ3 A;  1IXR C;  1K6O A;  3HFI A;  3P7N A;  3LQQ A;  4BHP A;  2IVM A;  4WCG A;  4EM1 A;  3PQJ A;  4KYW A;  4ASN A;  5EEG A;  4FX0 A;  5LLQ A;  3I58 A;  5FD6 A;  1O3S A;  2CQK A;  3FMR A;  5CVR A;  3U2R A;  1ZRC A;  3E3V A;  2XUB A;  5LHI A;  1YW9 A;  3LAJ A;  2OZU A;  1S7O A;  3O6B B;  1K79 A;  1SMY F;  3BJA A;  3F8N A;  2WTE A;  1U78 A;  3G3Z A;  2V1D A;  3CUO A;  4P5O A;  3F23 A;  3TOA A;  1STZ A;  2PG4 A;  4XRF A;  5DDG A;  4KN4 X;  2Z99 A;  2VBW A;  1W5T A;  1XGO A;  2M45 A;  2PN6 A;  4TV7 A;  2DQR A;  3ULQ B;  2JTV A;  1Z1D A;  4L5J A;  2F5F A;  3IRQ A;  2IW5 A;  5ICC A;  4I01 A;  1TQI A;  1XGN A;  3K1M A;  4MTE A;  2NNN A;  4G6Q A;  1LEB A;  2OZ6 A;  2ELH A;  1XLR A;  2ZME B;  1W4M A;  1FYM A;  2P8T A;  2R7D A;  5JHU A;  3HRT A;  1UST A;  4Q5S F;  5ILU A;  1IXC A;  3K9T A;  4MHG A;  1ZHF A;  5F6F A;  3EQL F;  3MZY A;  1I27 A;  4GCV A;  4M9Z A;  4OIR F;  1YLF A;  5CVI A;  4LK1 F;  3L5Z A;  3F8F A;  3OV8 A;  2QVO A;  1KYW A;  4ENN A;  1JXS A;  1ODD A;  2KJC A;  2OBP A;  4KFC A;  3MWM A;  5L3C A;  1J7K A;  4EJT A;  2XAS A;  4S04 A;  3E5Q A;  2ISY A;  2IT0 A;  2ADU A;  3QAH A;  1QZY A;  5ILV A;  2HOE A;  2W25 A;  1P2F A;  3I0T A;  1YFH A;  3GF2 A;  2DPD A;  2VXZ A;  2QQ9 A;  2CO5 A;  1YYV A;  3WTS C;  3Q9S A;  4RB2 C;  2NWI A;  1S29 A;  3Q9V A;  1R00 A;  2QZ8 A;  2GAU A;  3E6M A;  2NNY A;  2Q8K A;  3F21 A;  4L0Z B;  4B8X A;  4I0A A;  1D8K A;  3BY6 A;  2A6H F;  1LNW A;  1ZAO A;  3P9C A;  2BYV E;  1W5S A;  4LLN A;  3J80 K;  5D5U B;  3WTT C;  2XKP A;  3V8L A;  3CJN A;  3DEU A;  3RJP A;  1BI1 A;  1U5T C;  2FXA A;  5D6F A;  2NYX A;  2OD5 A;  4EGZ A;  4G9Y A;  2KJB A;  2D1H A;  1B9M A;  3AAF A;  5HDK A;  3LA3 A;  1WQ2 A;  1IZ1 A;  2F5D A;  3V7C A;  5JFR A;  1RI7 A;  3M8F A;  2IA0 A;  4ESJ A;  1YS6 A;  1V3F A;  3ZN1 A;  3R6S A;  3I59 B;  4UV9 A;  5LHH A;  2STW A;  2M87 A;  1B59 A;  3L09 A;  4ZSI A;  2QEN A;  1P4X A;  3V7R A;  1HW5 A;  1DPR A;  5JVT A;  2QBY A;  3ECO A;  3SFZ A;  2QLZ A;  4U0W A;  3GUD A;  4KN7 X;  1I5Z A;  2B0L A;  4U88 A;  2EV5 A;  3RPU A;  3QPH A;  3ZMU A;  3D0S A;  3S2W A;  4P9F A;  4A6D A;  4OMY A;  5FGM A;  1LVA A;  5FD5 A;  3KZZ A;  1WKM A;  1S7A A;  1WRJ A;  3HOS A;  1EV7 A;  3L7W A;  2ZJ2 A;  2PMH A;  4YG2 F;  4DNC A;  1Y0U A;  2HDC A;  1BIA A;  4A0Z A;  4HF1 A;  2W85 A;  1Z6R A;  4OOI A;  3R0J A;  2GZW A;  4GYG A;  2YX7 A;  4ESB A;  4ZYG A;  1HST A;  1FP1 D;  4LB6 B;  1KU3 A;  2ACJ A;  2VBY A;  3L00 A;  3HRM A;  2LKP A;  4P55 A;  2A3S A;  2CW0 F;  1Z7U A;  4OIQ F;  4HZF A;  2M30 A;  5BS6 A;  3E6D A;  1OYW A;  5D8L B;  1JGS A;  5AON A;  2DQL A;  3CO6 C;  4WK8 F;  3WG9 A;  2FOK A;  4LLG F;  4KT5 C;  3TO9 A;  1R7J A;  4IRG A;  4EJW A;  3LST A;  4U0V A;  4Z2Y A;  4QWQ A;  2D45 A;  4WX9 A;  2GQQ A;  3I64 A;  4RB1 A;  4MGR A;  2XHK A;  2E1C A;  4CGZ A;  4UNO A;  1BI2 A;  4CO8 A;  3C3W A;  4KMF A;  4E70 A;  3LA7 A;  5DEQ A;  2VOP A;  1MDM B;  4AWX B;  3KEO A;  3VOE A;  4LGW A;  2VOD A;  2PI0 A;  5DD8 A;  2O8X A;  4NQW A;  3TO7 A;  1JHF A;  4L9V A;  4RGR A;  2H6B A;  3C1D A;  1MZB A;  2KIF A;  2HTS A;  2QBY B;  2PBI A;  2V1U A;  4L5I A;  3T0Y A;  1DUX C;  2VE8 A;  4A5M A;  3FM5 A;  4OIN F;  5E18 F;  1T0F A;  1XN7 A;  3IL2 A;  3DKW A;  1IAW A;  3E6C C;  3GYH X;  2OQR A;  3KE2 A;  1QNT A;  4MNU A;  2O0Y A;  2F5E A;  1IW7 F;  2FE3 A;  2QM3 A;  3BZ6 A;  3COA C;  1XMK A;  4GO1 A;  4XSX F;  5K5R A;  2UXN A;  2P6T A;  5LHG A;  1YIO A;  4HX7 A;  1BC8 C;  1O7F A;  3KP5 A;  1MJA A;  1AWC A;  2FF4 A;  3P9K A;  1YW8 A;  2XAQ A;  4HOB A;  2DI3 A;  2P5L C;  1FY7 A;  1S6L A;  3O2P E;  5H20 A;  1P4W A;  1TW3 A;  3FXU A;  1HKT A;  1L0O C;  5DUK A;  4MEY F;  3H92 A;  5F1R A;  3SZT A;  1DDN A;  2VE9 A;  1QO0 D;  3HYI A;  4JBA A;  1O3Q A;  3J80 Z;  3QP6 A;  4PCQ A;  1SD5 A;  4HYE A;  1KU2 A;  3CLO A;  4G6D A;  1W7P B;  3RYR A;  3WE2 A;  1F5T A;  3GO5 A;  5JI6 A;  4M73 A;  5AIP A;  2IJL A;  2Y48 A;  2DO7 A;  4L9N A;  2XGX A;  3QU3 A;  1FOK A;  4KNY A;  1XMA A;  3WTY C;  5TJJ A;  2A69 F;  4MEX F;  1B9N A;  2PQ8 A;  5L3D A;  1G3T A;  1OKR A;  3HTU A;  4IPA A;  4BXU A;  1U5T A;  1FBU A;  1IN6 A;  4HDU A;  4I09 A;  3W6J B;  3CTA A;  3F8M A;  5DV5 A;  1GXQ A;  2XRN A;  4BAY A;  1XSX A;  2HQN A;  4L9J A;  2FEZ A;  1WI9 A;  4HLX A;  2KIM A;  4UVA A;  3WTX C;  1UB9 A;  3E6B A;  2E7X A;  3LQR A;  2M8E A;  2ZBK A;  2DW4 A;  5LRR A;  1R58 A;  3TO6 A;  1MGT A;  1BM9 A;  4LD5 A;  2PKH A;  3F72 A;  5A2Q K;  4OIO F;  1O3T A;  2K02 A;  1TLH B;  2FMY A;  3LA2 A;  3DF8 A;  2D2W A;  1REP C;  1CF7 B;  1ZG1 A;  3IKV A;  4OMZ A;  1FP2 A;  3V7S A;  2O03 A;  4A5N A;  1R23 A;  3JSP A;  4MQ9 F;  3ZMV A;  4MTD A;  3ZMD A;  3GZ5 A;  1P6R A;  1MJ9 A;  4A12 A;  2Z9O A;  2ZO4 A;  2JPC A;  3R61 A;  1E17 A;  2F5C A;  2K4J A;  1LJ9 A;  2G7H A;  1YO5 C;  5K1Y A;  1I6X A;  2OAZ A;  5DCM A;  4LB5 A;  3EET A;  3C18 A;  1B4A A;  2HWV A;  2ZFW A;  3MQ0 A;  2BGC A;  3ABT A;  3WE3 A;  1K7A A;  1K78 B;  3WU0 A;  3HIF A;  5BPD A;  1RNL A;  4HW0 A;  3DXJ F;  2YR2 A;  1SFE A;  1UCR A;  3CUQ C;  3I71 A;  2PFB A;  2PLY A;  4IXA A;  1T2K A;  3FF5 A;  1QQI A;  1Z05 A;  3GEZ A;  2RN7 A;  3WTZ A;  3EYI A;  2FML A;  1RIO H;  2JZY A;  1G6N A;  3BDD A;  3Q5F A;  1FX7 A;  5IT9 K;  5DUI A;  4QLC U;  5D6E A;  2E7W A;  5FLX K;  4UVB A;  2YU3 A;  3WU1 B;  4Q4Z F;  4EJU A;  2ZCW A;  3DPT A;  3GXO A;  5BMZ A;  3HSE A;  1J59 A;  2HR3 A;  3BOQ A;  1G3W A;  4KMU X;  1ZH5 A;  3NRV A;  2UZK A;  2LF8 A;  2XIG A;  1G3S A;  3P9I A;  3GZ6 A;  1I1S A;  4KDP A;  2DTR A;  3LHE A;  2XAJ A;  2XAF A;  3GW2 A;  3HSF A;  4NB5 A;  4MQV A;  1FZP B;  2CGP A;  2MD5 A;  1IN8 A;  3WTU C;  5LBQ A;  3DPL C;  4BH9 A;  4HQM A;  4IRI A;  2HKX A;  3LFK A;  3KP3 A;  3BWG A;  3CO7 C;  3F6O A;  1HKS A;  3OOP A;  4HQE A;  3KZY A;  2P19 A;  4AIJ A;  2L3D A;  2M5W A;  2EV0 A;  4K2E A;  2AHC A;  4LLL A;  4M9S A;  3TOB A;  3NEU A;  5E1Z B;  1FC3 A;  4G94 A;  1EH8 A;  1ZGJ A;  2VT3 A;  3KEQ A;  5BQT A;  1JE8 A;  3FXR A;  2Y0M A;  4LMY A;  3EUH A;  2VC0 A;  5DCM B;  4KIF A;  4AIH A;  3QRF F;  3C7J A;  3ERE D;  2DLL A;  3KP7 A;  3BPV A;  4ON0 A;  1O3R A;  3GLX A;  3PQK A;  1R1T A;  4UVC A;  4WXD A;  4AIK A;  1BOA A;  4RB3 C;  1FBS A;  3K69 A;  1Z6T A;  4HV5 A;  1HQC A;  1X3U A;  3PFI A;  2ISZ A;  1U6G A;  2EFP A;  1JD3 A;  1W7P D;  3JW4 A;  5CJ9 A;  4FX4 A;  2BBY A;  3JAM K;  1MD0 A;  3T8T A;  1FYK A;  2LDU A;  4IVN A;  3JTG A;  3HOT A;  2K7L A;  1ON1 A;  4ZZL A;  4RGU A;  2W84 A;  4EJO A;  2MLK A;  2DPU A;  5IT3 A;  2MBF A;  2DU9 A;  2VON A;  3J81 Z;  4HF2 A;  5CYV A;  1BI3 A;  4M9X A;  3ZMS A;  3CDH A;  1OR7 A;  4ZYH A;  1JHH A;  1MJB A;  1OPC A;  2FBH A;  5TRD A;  3TQN A;  3QPT A;  2IRF G;  2DFI A;  5A2Q Z;  2XAG A;  4I98 B;  4L9T A;  2L54 A;  3N4M A;  5E17 F;  2HQR A;  3KP4 A;  1TBX A;  1R36 A;  1TW2 A;  2EFW A;  4S05 A;  1T38 A;  2IP2 A;  1FWZ A;  5JR3 A;  3ISP A;  2P7C B;  1FPQ A;  3RKX A;  3F8B A;  5J8C A;  4A6E A;  4I02 A;  2RKH A;  4KIC A;  4Y13 A;  2AS5 F;  5FFZ A;  1RUN A;  1O7L A;  4CYD A;  4G8X A;  3K1P A;  2V9V A;  3EDP A;  1AOY A;  1TNT A;  2P7V B;  1IUY A;  5HS8 A;  5DYM A;  3V4G A;  1LDK B;  3O3K A;  5E1W A;  3TGN A;  5LRS A;  4JQF A;  3GX4 X;  1YTY A;  4D0P A;  3WOD F;  4L0Y B;  3KP6 A;  4FT8 A;  1DPU A;  5D4R A;  3L9F A;  4GYI A;  1TQP A;  4R1H A;  1ZYR F;  2HYG D;  4H0E A;  2JSC A;  3DV8 A;  1LEA A;  4CXF A;  3ZMZ A;  4ZYE A;  4UV8 A;  5D4S A;  3N97 A;  2RA5 A;  3IRR A;  4XLP F;  4PGH A;  1SFX A;  5HS7 A;  1KU7 A;  1BIB A;  3TDU C;  3DFG A;  4YFX F;  1FSH A;  2QYO A;  2X4H A;  5L3B A;  4CDG A;  5IT9 Z;  6PAX A;  1E2X A;  5DD4 A;  2CFX A;  1XSD A;  3M9A A;  2NAZ A;  5FLX Z;  1CGP A;  1ZG5 A;  2H94 A;  5HLG A;  4RS8 A;  3F8L A;  3WTW C;  4GXO A;  3MCZ A;  4OU0 A;  1R1U A;  1HKQ A;  2GA1 A;  5HDG A;  2EWN A;  2V79 A;  1XCV A;  5FB2 A;  1ZLJ A;  5L3F A;  2BE5 F;  1PP8 F;  3RTR A;  4U0Y A;  4BNC A;  1A04 A;  4P96 A;  3DQV C;  2VBX A;  3GWZ A;  3DDV A;  3M1E A;  3RPQ A;  2VC1 A;  2P4W A;  4M74 A;  3IKT A;  4N9I A;  4LFU A;  2STT A;  3VB2 A;  2OGG A;  4WXC A;  4IHS A;  1V4R A;  3BP8 A;  5D5V B;  3F3X A;  1J9I A;  2FA1 A;  3BPX A;  3KET A;  4YII A;  1FYL A;  5LEJ A;  3IWF A;  3E97 A;  5D5X B;  4G7O F;  1KQ9 A;  1YS7 A;  4M6X A;  4DQ2 A;  3H3U A;  3I4P A;  2X0L A;  4PZJ A;  4RAZ A;  2FBI A;  2ESH A;  3REO A;  3ML6 A;  2IA2 A;  2ZNZ A;  2GA2 A;  1IN5 A;  3K0L A;  2HYF A;  4CIC A;  1ZN2 A;  4WWC A;  5E8G A;  4YFK F;  4LJZ F;  3NQO A;  2VT2 A;  1XD7 A;  2GIV A;  2XV4 S;  5HLH A;  4I0B A;  2H09 A;  2AXL A;  1UHW A;  3W6K B;  1SD4 A;  3VFZ A;  1T6S A;  2EA4 A;  4R8H A;  4A2U A;  1IRG A;  1UHM A;  2DK5 A;  1EH6 A;  2TDX A;  4EV0 A;  3JAM Z;  2EB7 A;  1YW7 A;  1XGS A;  2NS0 A;  1FBQ A;  3K1N A;  4G7H F;  5HVQ C;  2GXB A;  1LB2 A;  4HDV A;  1SD6 A;  1OYI A;  2PJP A;  1IN4 A;  4YFN F;  4ZSK A;  2ZKZ A;  1ON2 A;  3L2C A;  4R79 A;  3QP5 A;  3RIR A;  3KP2 A;  1TTY A;  1S8N A;  1FLI A;  4ENK A;  4P9U A;  2DAO A;  1Z91 A;  1HW2 A;  2A07 F;  5FO5 A;  1G1B A;  4M6Y A;  5LGT A;  1BBY A;  2P5V A;  3ZPL A;  2Z3Y A;  1KU9 A;  4Y17 A;  1IXS B;  2J5O A;  1MKM A;  4EM2 A;  3F8C A;  1P4A A;  4UHT A;  2HEO A;  5HLI A;  2LNB A;  3E5U A;  1Z9C A;  3ROU A;  2XVC A;  2O61 A;  5CVV A;  3RKY A;  2M1B A;  3EYY A;  4KUM A;  5LEK A;  2ETH A;  5FFX A;  5ILS A;  1U8R A;  5L3E A;  2HFH A;  2HZT A;  3RKW A;  4IF4 A;  2EFN A;  3KFW X;  1OYY A;  3WGH A;  5K5O A;  3IC7 A;  1B1B A;  3QOP A;  3ZMT A;  3FZV A;  1D8J A;  4FHT A;  2IKK A;  3I5U A;  3ZP5 A;  4AD9 A;  4G7Z F;  4O6J A;  4XBF A;  3FXQ A;  3FMQ A;  3T8R A;  1XDU A;  1TT8 A;  3HSR A;  2MH9 A;  2J5P A;  3GFL A;  2RC4 A;  3R0A A;  1ULY A;  2VN2 A;  1SAX A;  2CG4 A;  5DCF A;  3MFK A;  3WGG A;  5J8F A;  3V8J A;  1XCB A;  3T1B A;  2WC2 A;  2K4B A;  1U5T B;  3I59 A;  1KGS A;  2EFO A;  3F6V A;  2EJR A;  4YIF A;  5KK1 A;  1ONV A;  2Z33 A;  4ZH4 F;  1ZGA A;  2F2E A;  3FX3 A;  2MC3 A;  3B02 A;  2RDP A;  1F9N A;  1G4D A;  4RGX A;  2QQA A;  1R1V A;  3HRS A;  2OQG A;  1KQ0 A;  5J6X A;  3SZP A;  1SMT A;  4WF2 A;  4EQQ A;  2FSW A;  1VTN C;  4HV6 A;  2HTJ A;  2JT1 A;  1GVJ A;  2RGV A;  1ZRF A;  3SXY A;  1H0M A;  1G3Y A;  2PEX A;  4UXN A;  1YQA A;  2L4M A;  3JTH A;  2RVC A;  4ESF A;  5K5Q A;  5D5W B;  1IN7 A;  4L18 B;  3IWZ A;  1O57 A;  4HX4 A;  1H9G A;  4ETS A;  1GHC A;  1S3J A;  4I7H A;  1XSV A;  1LQ1 A;  1F1Z A;  2CYY A;  3RDI A;  2W57 A;  4RB0 A;  3GFI A;  3KLN A;  4LK0 F;  1G81 A;  2R3S A;  2OOI A;  1DP7 P;  3VOD A;  1C0W A;  1WSU A;  2NRA C;  4HX8 A;  2L01 A;  2QWW A;  2A5Y B;  3DP7 A;  1IRF A;  1RZ4 A;  2KIU A;  4Q48 A;  1ZG3 A;  4NHJ A;  1BJA A;  3FM3 A;  1U3E M;  1B6A A;  2Z5U A;  3RI4 A;  1HW1 A;  3B73 A;  2ESN A;  2P5K A;  4EJV A;  2CWE A;  5BOX A;  4BQA A;  1HSJ A;  4BHB A;  4IHT A;  4EMS A;  1BI0 A;  2A61 A;  2V1X A;  3GFM A;  5EEH A;  2WV0 A;  5H6R A;  4KIB A;  1MDM A;  5HDN A;  1D3Y A;  1I1G A;  1QZZ A;  2EA2 A;  2FNA A;  2XRO A;  2KRF A;  1R22 A;  1LDD A;  2FBK A;  2UXX A;  4Y15 A;  5BPI A;  3FHZ A;  4ZSB A;  2QQB A;  2QUF A;  2DBB A;  2D1V A;  2RNJ A;  1D5V A;  2OU2 A;  4HBL A;  2VBZ A;  5ICG A;  3U1D A;  2XKO A;  4WXH A;  2GWR A;  1H9T A;  1PDN C;  1USS A;  1FW9 A;  5D8K B;  1KA8 A;  4EM0 B;  4IRH A;  3M8E A;  3U9G A;  1F4K A;  2FRH A;  1KQ8 A;  2FNP A;  1T39 A;  2COM A;  1XB4 A;  4KA4 A;  1OMI A;  1FSE A;  2BV6 A;  5E20 A;  3I54 A;  5CVU A;  1GXP A;  2O3F A;  3LAP A;  1J75 A;  4PDK A;  4XSZ F;  2EK5 A;  1R5H A;  3HHG A;  2ZNY A;  4HA8 A;  1NHA A;  5ICF A;  2DK8 A;  5E8I A;  4LG0 A;  4UUV A;  4JK1 X;  4ENM A;  4B09 A;  2R7F A;  2GXG A;  2H27 A;  2HGC A;  3RYP A;  5CLS A;  2HKO A;  2YPR A;  3VEP A;  2FA5 A;  2MA3 A;  3G73 A;  4U7D A;  4GGG A;  1Q1H A;  3M7G A;  5KVR A;  3KLO A;  5L3G A;  4EGY A;  4PGG A;  4Q47 A;  1W7P A;  4RGS A;  3GFJ A;  2MLG A;  2WWY A;  4HLY A;  1WWX A;  4U7B A;  2P6S A;  3LWF A;  2BEO A;  3HHH A;  1ZLK A;  3BRO A;  4M71 A;  4O5V A;  5LGN A;  3ZQ7 A;  1UFM A;  2OA4 A;  3MAJ A;  3CUQ A;  2IA1 A;  4EVI A;  4A0Y A;  4XLN F;  3T5X A;  1PP7 U;  3V8K A;  1BC7 C;  4OIP F;  4RAY A;  1ZRD A;  3E5X A;  1XGM A;  2FU4 A;  2Q2E A;  5ERI A;  2G9W A;  2O6G E;  3J7A O;  2A68 F;  3WGI A;  3BJO A;  1T98 A;  1U2W A;  3GVA A;  2C6Y A;  4N0B A;  1L3L A;  2W24 A;  3D5L A;  2K27 A;  2L02 A;  2H6C A;  2RQP A;  1RUO A;  1XDS A;  3WTV C;  1P92 A;  2EFQ A;  2G7U A;  3SQN A;  3ELK A;  5F64 A;  1HXD A;  2K86 A;  1QGP A;  3JSO A;  1CF7 A;  4O3M A;  2MH2 A;  1ZRE A;  3HRU A;  1PUE E;  2A6E F;  3SHF A;  1TNS A;  4BYY A;  5HS9 A;  5E1X A;  1HBX G;  2JPB A;  4AVP A;  2JRT A;  2KKO A;  4M72 A;  2HS5 A;  2IPQ X;  2EV6 A;  3FWE A;  2ZXJ A;  2E1N A;  3TDZ C;  4I2O A;  3IHU A;  5HOO A;  3TKY A;  1EH7 A;  4LG0 B;  5AIQ A;  3HTS B;  1QPM A;  1J2X A;  3KCC A;  3K2Z A;  4CZZ A;  1K78 A;  3MZH A;  2LSO A;  2V6C A;  4ENJ A;  4CHU A;  1TQM A;  3H3Z A;  3ZN0 A;  2RV8 A;  5LGU A;  4HF0 A;  2LF7 A;  3CNV A;  3R4K A;  1SD7 A; 
#chains in the Genus database with same CATH topology
 5M5X J;  3ABU A;  5LFA A;  3BG5 A;  5FLM J;  2WB1 N;  2VOO A;  3F22 A;  2CSO A;  2ZSH B;  3BJ6 A;  3CJT B;  4BHC A;  2UWM A;  1APL C;  4ZZD A;  2Q1Z B;  3E7L A;  2ELK A;  1ETW A;  2XAH A;  5F0C A;  3FXK A;  1X1A A;  2LVS A;  1KYZ A;  3R60 A;  3A01 B;  5J3L A;  5GAE J;  4GFB A;  1M1E B;  2E71 A;  3ECH A;  2F4O B;  4IZZ A;  2ZME A;  4DBQ A;  2Y75 A;  4ZYD A;  3CC2 I;  1MBF A;  4IJA A;  2JQ7 A;  1N77 A;  2XPV A;  1J5Y A;  2K9N A;  4PFO A;  1IF1 A;  2LY1 A;  4N9H A;  2RAE A;  3CUQ B;  4BS9 A;  2CU7 A;  2WAQ A;  3IH4 A;  1R5G A;  2L4A A;  3I53 A;  2DA5 A;  1SAU A;  4A3M J;  2DT5 A;  2Q0O A;  3CD6 I;  3HJE A;  2YSR A;  3P5J A;  2Q2E B;  3HUG A;  2VL8 A;  4A0X A;  1FNN A;  3K10 A;  1J0R A;  3ABK H;  3MEX A;  1FT9 A;  1SFU A;  5ED4 A;  4F55 A;  1BR4 A;  3FMS A;  4HAM A;  1U8B A;  1ZAR A;  2DCE A;  4CUG A;  3ZGK A;  1FMW A;  5EG0 B;  1A31 A;  3J81 K;  4NC6 A;  5CVJ A;  4FET A;  1A6I A;  1FEX A;  5H6Q A;  5ICE A;  2PMU A;  3BZK A;  1BN5 A;  3MKW B;  2UUZ A;  2E1M B;  4JX6 A;  1QBJ A;  4IOC F;  1YG2 A;  2YX4 A;  4F3Q A;  2R7Z J;  3QU6 A;  2JUC A;  4F7Z A;  2L9V A;  4KIG A;  4UUS A;  1LDJ A;  2FQ3 A;  2QCO A;  1IXR C;  3D1N I;  1K6O A;  1HCR A;  2X48 A;  3HFI A;  3P7N A;  3LQQ A;  4BHP A;  2IVM A;  1LFP A;  4OAZ A;  2BW3 B;  1VQL I;  4WCG A;  4QPO A;  1OCO H;  2KZG A;  4EM1 A;  1D1A A;  3PQJ A;  5GPC A;  2R7T A;  4KYW A;  4ASN A;  2BHY A;  5EEG A;  4FX0 A;  3G6E I;  5LLQ A;  3I58 A;  1R49 A;  5FD6 A;  2KHM A;  2NOG A;  1O3S A;  2CQK A;  2V1N A;  3FMR A;  3OYM A;  5CVR A;  4BKX A;  3U2R A;  2XDV A;  4C2U A;  1LVK A;  1ZRC A;  3E3V A;  2XUB A;  5GAD J;  5LHI A;  1YW9 A;  3LAJ A;  2OZU A;  1S7O A;  2RQQ A;  1ETQ A;  2R7W A;  2H1L A;  3O6B B;  1K79 A;  1SMY F;  3L2U A;  3CQZ J;  3BJA A;  3F8N A;  2MAB A;  4W1U A;  2WTE A;  4ZTF A;  4PUS A;  3S15 J;  1FOW A;  4RMN A;  2CMP A;  2Z2S B;  5F27 A;  1NH3 A;  3SDG A;  3OSG A;  1U78 A;  3G3Z A;  2V1D A;  3CUO A;  4P5O A;  2AO9 A;  3A2K A;  2LD5 A;  3F23 A;  5DM6 F;  4U87 A;  3TOA A;  1STZ A;  4IOA F;  2CQN A;  2PG4 A;  3QPL A;  4XRF A;  5DDG A;  2CJJ A;  4KN4 X;  2EIK H;  4NBQ A;  4M3G A;  2Z99 A;  2Y2Z A;  2VBW A;  3MKY B;  1W5T A;  1XGO A;  3M1C A;  1WFX A;  3D5S C;  2M45 A;  2PN6 A;  3HDD A;  4TV7 A;  2DQR A;  3BCB A;  2RRE A;  2OCE A;  2Y0S N;  3ULQ B;  3F0C A;  2JTV A;  1Z1D A;  4L5J A;  2F5F A;  1MBK A;  1VF9 A;  4KIS A;  2YU9 J;  3OIP A;  2LKS A;  5C4X J;  1NG7 A;  3IRQ A;  2IW5 A;  1VZ0 A;  3VPR A;  5ICC A;  5HNF A;  4B48 A;  1R4M B;  4I01 A;  1TQI A;  3GTP J;  1XGN A;  3K4N A;  3K1M A;  4CCL A;  3IH3 A;  1VQ4 I;  4MTE A;  1RET A;  4B4C A;  2NNN A;  4S0H B;  4G6Q A;  1LEB A;  2DA1 A;  2OZ6 A;  3FXJ A;  4BEH A;  1IO2 A;  2ELH A;  1XLR A;  2XGC A;  2KMU A;  4D5F A;  2ZME B;  2ME0 A;  2E60 A;  1W4M A;  1FYM A;  2P8T A;  1YX5 A;  2R7D A;  5JHU A;  4D7M A;  2MSY A;  3ASN H;  3HRT A;  1T0F C;  1UST A;  4Q5S F;  5ILU A;  1IXC A;  3K9T A;  4MHG A;  1ZHF A;  4IX7 A;  2M4G A;  2ZJP F;  5F6F A;  5F0H A;  3EQL F;  3PO3 J;  3MZY A;  1I27 A;  1LFB A;  1UG2 A;  4GCV A;  4BJ5 C;  2M0C A;  3HOU J;  4M9Z A;  1LPQ A;  2EZH A;  4OIR F;  2OCC H;  1YLF A;  5CVI A;  3LSP A;  5KAI C;  4LK1 F;  4HNU A;  4XLE A;  3L5Z A;  1SAN A;  2L9N A;  2F6C A;  4MO7 A;  3ZXS A;  3DEE A;  5GPA A;  1N25 A;  4XRM A;  3F8F A;  3OV8 A;  4YRV A;  2QVO A;  3HPH A;  2DFH A;  3CCM I;  1KYW A;  4ENN A;  4I76 A;  1JXS A;  1Y8R B;  1ODD A;  2KJC A;  3DBL B;  2OBP A;  2L9R A;  2DT6 A;  4KFC A;  2R7O A;  3MWM A;  5L3C A;  1J7K A;  4EJT A;  2XAS A;  1EA3 A;  1X1C A;  3OYL A;  2HNH A;  1D0Z A;  4S04 A;  3E5Q A;  1TWA J;  2ISY A;  2IT0 A;  3FDY A;  2ADU A;  3QAH A;  5CQE A;  1QZY A;  4B47 A;  5ILV A;  4UUS B;  3HL2 A;  4C2M J;  2HOE A;  2W25 A;  1T8I A;  1P2F A;  3I0T A;  1YFH A;  3GF2 A;  2DPD A;  1T08 B;  2VXZ A;  2QQ9 A;  1W5C C;  2CO5 A;  1YYV A;  1E0E A;  3WTS C;  2XPU A;  3Q9S A;  4RB2 C;  4BE2 A;  2NWI A;  2L7Z A;  2EBI A;  1S29 A;  5CQG A;  3LFU A;  3Q9V A;  3FXM A;  3OIO A;  1R00 A;  2I8D A;  2QZ8 A;  2GAU A;  3E6M A;  2NNY A;  1QRY A;  1U0J A;  2Q8K A;  3F21 A;  2NVT J;  5EZG A;  2P81 A;  3QOE A;  4BQN A;  4L0Z B;  4B8X A;  2BY2 A;  3QWL A;  3A02 A;  4I0A A;  1D8K A;  2IXS A;  3BY6 A;  1LKX A;  2CQX A;  5F04 A;  3GTQ J;  2A6H F;  1JI8 A;  1LNW A;  5E3L A;  1ZAO A;  1ZKG A;  3P9C A;  2BYV E;  2FX0 A;  1Z3X A;  2JA2 A;  4BXX J;  2XC7 A;  1W5S A;  4MFD A;  2DMN A;  4LLN A;  3J80 K;  5D5U B;  3WTT C;  1YI2 I;  2XKP A;  3PUF A;  2LBF A;  1TWC J;  3V8L A;  2WAF A;  3CJN A;  3OS1 A;  3DEU A;  1WI3 A;  3RJP A;  2R93 J;  1BI1 A;  1U5T C;  2FUG 2;  2FXA A;  3DKY A;  2JWT A;  5D6F A;  2XF7 A;  1MSE C;  3K70 D;  3HGY A;  4KIT B;  2NYX A;  3BG7 A;  5FKK A;  2OD5 A;  1DU0 A;  1QPI A;  4XMY A;  3SJM A;  2ECB A;  4A3L J;  4G9Y A;  4EGZ A;  2KJB A;  2D1H A;  4E7K A;  1B9M A;  3AAF A;  3B6C A;  3CES A;  3CZ6 A;  3L2V A;  2LOO A;  5HDK A;  3LA3 A;  4PJM A;  2G0E A;  2B63 J;  5JVG F;  1WQ2 A;  1IZ1 A;  2JJ7 A;  2F5D A;  2ZXW H;  3KIO A;  3V7C A;  5JFR A;  3W2V A;  3W3C A;  1RI7 A;  3M8F A;  2IA0 A;  2OF7 A;  4ESJ A;  1YS6 A;  3QPS A;  1R71 A;  1V3F A;  1HC8 A;  3ZN1 A;  2ZXH A;  3R6S A;  3I59 B;  3FXL A;  4UV9 A;  5LHH A;  2STW A;  2M87 A;  4IHX A;  1B59 A;  3L09 A;  4BEH B;  2QEN A;  1P4X A;  3V7R A;  4ZSI A;  1HW5 A;  3M8J A;  1K61 A;  1DPR A;  1RR7 A;  2K5C A;  5JVT A;  2QBY A;  3ECO A;  4C3J J;  1X1P A;  1X4O A;  3SFZ A;  2QLZ A;  4RBO A;  4U0W A;  3GUD A;  4KN7 X;  1I5Z A;  2BOL A;  2B0L A;  1XX5 A;  4U88 A;  2EV5 A;  3H5R A;  3RPU A;  3QPH A;  1GDT A;  1X2M A;  3ZMU A;  3D0S A;  3S2W A;  1MSF C;  4CZC A;  4P9F A;  5M5W J;  3IAM 2;  4A6D A;  4OMY A;  5FGM A;  1LVA A;  4OAY A;  4FIS A;  1OCZ H;  2XGD A;  5FD5 A;  1IDZ A;  3KZZ A;  1WKM A;  1S7A A;  1WRJ A;  3FK6 A;  1U9N A;  3HOS A;  1EV7 A;  2M2E A;  4XK4 A;  5KNL A;  4IKF A;  3L7W A;  2ZJ2 A;  2PMH A;  3TBI A;  2LTP A;  4II3 A;  4C2T A;  4YG2 F;  2Y9Y A;  4DNC A;  1WVR A;  1Y0U A;  2ME6 A;  2HDC A;  2QSF X;  1FJL A;  1BIA A;  1H88 C;  2Y30 A;  4A0Z A;  4HF1 A;  2ZFU A;  4ZDP A;  4ABZ A;  1Y8Q B;  2W85 A;  2K3F A;  1AKH B;  1Z6R A;  4OOI A;  3GLL A;  2LK2 A;  3R0J A;  2R92 J;  2GZW A;  4GYG A;  2YX7 A;  2X51 A;  4ESB A;  4ZYG A;  3K4C A;  1HST A;  1FP1 D;  4LB6 B;  1JT0 A;  1KU3 A;  2ACJ A;  2VBY A;  3L00 A;  4RDU A;  3HRM A;  2LKP A;  2V7F A;  2EQR A;  3JRD A;  4P55 A;  2KPM A;  2A3S A;  2CW0 F;  1Z7U A;  4HRI A;  2JVH A;  4OIQ F;  3JRF A;  4HZF A;  2M30 A;  1DU6 A;  5BS6 A;  3E6D A;  2E2H J;  2V4J C;  2K9L A;  3S16 J;  3I56 I;  1OYW A;  2H8W A;  4XM3 A;  5D8L B;  1JGS A;  4DYQ A;  5AON A;  2K9S A;  2DQL A;  3CO6 C;  4WK8 F;  5J40 A;  3VYU B;  3WG9 A;  1I3Q J;  5E3N A;  2V6E A;  2M7A A;  3F9K A;  2FOK A;  5K7Z A;  2KLO A;  3EUK L;  4LLG F;  3ZQF A;  4KT5 C;  4F52 A;  3TO9 A;  1R7J A;  2OTL I;  4IRG A;  4EJW A;  2WA0 A;  3FK7 A;  3LST A;  4FTH A;  4U0V A;  4Z2Y A;  1XC5 A;  2W7N A;  2GIZ A;  3CC4 I;  2LBF B;  4QWQ A;  3TW7 A;  2D45 A;  4WX9 A;  2GQQ A;  3I64 A;  4RB1 A;  2QSH X;  2JA6 J;  4ZDL A;  2NVY J;  2W1O A;  4MGR A;  2W82 A;  2XHK A;  2E1C A;  4CGZ A;  4UNO A;  1BI2 A;  2CUE A;  4CO8 A;  5M3M J;  3C3W A;  1V55 H;  3BZC A;  4D1Q A;  4KMF A;  3HOY J;  2BVM A;  4E70 A;  4KJZ A;  2M8G X;  3LA7 A;  5DEQ A;  2VOP A;  2K9Q A;  4XOR A;  1MDM B;  1AA7 A;  1BJZ A;  4AWX B;  1JT6 A;  1Y1V J;  3KEO A;  3VOE A;  2CW8 A;  4LGW A;  1O4X A;  2VOD A;  2CFO A;  2PI0 A;  5DD8 A;  4CCN A;  2O8X A;  4ANJ A;  2R7U A;  2XF6 A;  3CCY A;  3FXO A;  3A4C A;  4NQW A;  2NOJ B;  3TO7 A;  1A35 A;  4AYB A;  1JHF A;  1FOX A;  4L9V A;  4G12 A;  2QKM B;  2K3P A;  1I39 A;  2CUJ A;  4IHV A;  1FOY A;  4RGR A;  3ZQG A;  3H0D A;  5FKM A;  2H6B A;  3C1D A;  1MZB A;  2CQQ A;  2KIF A;  3JRA A;  2NVU B;  2HTS A;  5B1B H;  4HST A;  5KAF C;  5C3E J;  2QBY B;  2PBI A;  2R7V A;  2V1U A;  4L5I A;  3T0Y A;  2BY1 A;  1DUX C;  2VE8 A;  1BL0 A;  3FIW A;  4A5M A;  4OWR B;  5C44 J;  4X6A J;  1JKP C;  2TRT A;  2WAD A;  3FM5 A;  4EEF G;  4E7S A;  4F91 B;  3OMY A;  4OIN F;  5E18 F;  1T0F A;  1IDY A;  1XN7 A;  4BY7 J;  3IL2 A;  2L7F P;  4LIT A;  4A3K J;  2XPW A;  2F48 A;  3DKW A;  5B66 C;  1IAW A;  3E6C C;  1ZGW A;  4LG3 A;  3GYH X;  2OQR A;  3KE2 A;  3H36 A;  1QNT A;  5DM7 F;  1VQ8 I;  4MNU A;  2O0Y A;  5FKL A;  2F5E A;  1IW7 F;  2FE3 A;  2QM3 A;  3BZ6 A;  3COA C;  1XMK A;  5IOZ A;  3CDI A;  4GDF A;  3EUH C;  4GO1 A;  2E2J J;  4XSX F;  5K5R A;  2UXN A;  2P6T A;  1RC9 A;  2HQA A;  5IYC J;  5LHG A;  1SEU A;  5IYD J;  1YIO A;  4HX7 A;  3JRC A;  1BC8 C;  1TZL A;  2Z16 A;  5C4J J;  1O7F A;  2BY3 A;  3KP5 A;  1MJA A;  3K4M A;  1TL8 A;  1AWC A;  3HM5 A;  2FF4 A;  3ZQQ A;  3P9K A;  1YW8 A;  2XAQ A;  1WJF A;  4HOB A;  2GM4 A;  2AHQ A;  2DI3 A;  3HGG A;  2P5L C;  1FY7 A;  5E3O A;  1S6L A;  3VYS B;  3O2P E;  5H20 A;  1P4W A;  2DA6 A;  3A1Y A;  1WJC A;  4JOM A;  1TW3 A;  3HZJ A;  2JN6 A;  3FXU A;  1HKT A;  2LKX A;  1L0O C;  2E1O A;  2LRE A;  4E4H A;  5DUK A;  4MEY F;  1T33 A;  3H92 A;  2Y69 H;  3LSG A;  5F1R A;  1ITY A;  3SZT A;  1DDN A;  2VB6 A;  2PMZ A;  2VE9 A;  1QO0 D;  3HYI A;  1S9H A;  4JBA A;  1O3Q A;  4Z6Y A;  4XN0 A;  1YIT I;  2EZL A;  4AVZ A;  3J80 Z;  3QP6 A;  1BR1 A;  4PCQ A;  3LL7 A;  2DJI A;  3H9Q A;  1SD5 A;  1SC7 A;  2N8G A;  3MD2 A;  4V2G A;  5IOY A;  4HYE A;  3CLO A;  1KU2 A;  3PNY A;  4G6D A;  1RR8 C;  1YJW I;  1JUP A;  3G1L A;  1W7P B;  3RYR A;  4N4N B;  3WE2 A;  4DYR A;  2HPM A;  3ZCO A;  3GO5 A;  1F5T A;  2W48 A;  3PSF A;  2X85 A;  3GTJ J;  5JI6 A;  5HNH A;  4M73 A;  1BW6 A;  3LMM A;  5AIP A;  2IJL A;  4E7Z A;  1HA8 A;  2Y48 A;  3CCJ I;  1ZEL A;  2DO7 A;  4L9N A;  2XGX A;  3QU3 A;  2LC2 A;  1RKT A;  2ZSI B;  1JTY A;  1XMA A;  1JKR C;  1FOK A;  2HOT A;  3WTY C;  5TJJ A;  2A69 F;  3UR3 C;  3MZ8 A;  4MEX F;  1B9N A;  2PQ8 A;  2VIX A;  1A6Q A;  5KHD A;  1VND A;  1XG1 A;  4CH7 A;  4CCM A;  1OR7 C;  5L3D A;  4BJ6 C;  3UNG C;  1G3T A;  1OKR A;  2L2O A;  3HTU A;  4IPA A;  4BXU A;  1U5T A;  3K4L A;  4H4K C;  5J1Y A;  3S14 J;  3BT9 A;  1P9Q C;  3HC7 A;  1FBU A;  2DA3 A;  1IN6 A;  4HDU A;  4I09 A;  3W6J B;  3S3M A;  1I6H J;  1MW7 A;  3CTA A;  3F8M A;  5DV5 A;  5K7H A;  1GXQ A;  3OYA A;  1MMD A;  2XRN A;  2ELJ A;  4F92 B;  3I55 I;  4BAY A;  2ID6 A;  1XSX A;  2HQN A;  9ANT A;  4L9J A;  2FEZ A;  1WI9 A;  4HLX A;  2KIM A;  4UVA A;  3WTX C;  1UB9 A;  3E6B A;  2E7X A;  1SVO A;  3LQR A;  2PX9 A;  4B3A A;  3K7A J;  4A3F J;  3CJQ B;  2M8E A;  1RES A;  2XB5 A;  2ZBK A;  3H0G J;  2DW4 A;  1X58 A;  5LRR A;  1R58 A;  3TO6 A;  1MGT A;  1BM9 A;  5K7F A;  4LD5 A;  2PKH A;  3BR3 A;  3F72 A;  5A2Q K;  2XSJ C;  4OIO F;  1O3T A;  4PFP A;  2K02 A;  3JRG A;  1TLH B;  3CCS I;  2FMY A;  4FQG A;  5EF6 A;  3LA2 A;  4UY8 I;  3DF8 A;  2D2W A;  3SYT A;  1JUM A;  1REP C;  4RM3 A;  1CF7 B;  2A6T A;  4BBS J;  1ZG1 A;  1IG7 A;  2HXI A;  3IKV A;  1IGN A;  3DTE A;  4OMZ A;  2AQF A;  4ZDO A;  1FP2 A;  3PL8 A;  4AU7 A;  3V7S A;  3AKZ A;  1JJ6 C;  2O03 A;  4A5N A;  3CCU I;  3I4N J;  3AG4 H;  4Y4R A;  1R23 A;  3JSP A;  3QOD A;  1JKQ C;  4MQ9 F;  1X19 A;  3ZMV A;  4MTD A;  5EGO B;  3J7A Y;  3ZMD A;  1MMA A;  3HPG A;  1GT0 C;  3GZ5 A;  3K70 C;  1D0Y A;  1P6R A;  5DS9 A;  1MJ9 A;  2IGN A;  2JSP A;  4A12 A;  2X6Y A;  2Z9O A;  2ZO4 A;  3HG9 A;  2WY8 Q;  2JPC A;  5JLW A;  3R61 A;  1E17 A;  2F5C A;  2K4J A;  2DDB A;  1K4S A;  1LJ9 A;  1T95 A;  2G7H A;  3H5A A;  4XKC A;  4DJA A;  3C2G A;  5K1Y A;  1YO5 C;  3JCU C;  1I6X A;  2OAZ A;  5DCM A;  4LB5 A;  3TW6 A;  1R6R A;  3EET A;  1FTT A;  3OS0 A;  3AG3 H;  4JX4 A;  3X2Q H;  1VQ6 I;  3C18 A;  3FBI B;  1B4A A;  2HWV A;  2V9P A;  2ZFW A;  4NUB A;  3MQ0 A;  3FKJ A;  4Y3O A;  2BGC A;  1B8I A;  1FIP A;  3ABT A;  4A3G J;  1G59 A;  2I10 A;  3WE3 A;  1K7A A;  4ITV A;  3BTL A;  1K78 B;  3KEY A;  3WU0 A;  3HIF A;  5BPD A;  1RNL A;  2UV1 A;  4HW0 A;  2E5Z A;  3SZG A;  5DTD A;  3DXJ F;  2YR2 A;  1SFE A;  1UCR A;  2KDZ A;  1NG6 A;  2R5Z A;  1N78 A;  4XLF A;  5IPA A;  2VKH A;  3CUQ C;  2PFB A;  3I71 A;  5GP9 A;  1B72 A;  2PLY A;  4IXA A;  2HVS A;  3CF5 F;  3FF5 A;  1QQI A;  1Z05 A;  3GEZ A;  1T2K A;  2RN7 A;  3WTZ A;  4DW6 A;  3EYI A;  2FML A;  4XRS G;  1RIO H;  3DU6 A;  2PJR A;  2ID3 A;  2JZY A;  4XLC A;  5FLV A;  2XAU A;  1G6N A;  2HU9 A;  3BDD A;  3ZR8 X;  5GAH J;  3Q5F A;  2O7O A;  1ZTR A;  1FX7 A;  5IT9 K;  1Z67 A;  5DUI A;  4QLC U;  3RZO J;  3OIQ A;  5D6E A;  2E7W A;  1OCR H;  4XQF A;  4M3D A;  4XOP A;  3H5N A;  5FLX K;  4UVB A;  1SVM A;  3PFY A;  2YU3 A;  3WU1 B;  2BHZ A;  2F4M B;  4Q4Z F;  4EJU A;  2E36 A;  4IO9 F;  2ZCW A;  3DPT A;  2KQR A;  3GXO A;  5BMZ A;  3AL0 C;  3HSE A;  1J59 A;  2WB1 A;  3GTG J;  2HR3 A;  2VJ4 A;  3BOQ A;  2E1M C;  1G3W A;  4KMU X;  1ETK A;  3VYT B;  1ZH5 A;  3CJR B;  3NRV A;  2BXY A;  2UZK A;  1WH5 A;  5J1R A;  3V42 A;  2EZK A;  2E5N A;  2LF8 A;  1YJ9 I;  2EIN H;  2XIG A;  1G3S A;  2QKL B;  3HUG B;  3P9I A;  1UEL B;  3GZ6 A;  2R7X A;  1I1S A;  3Q0W A;  4KDP A;  2DTR A;  2DA4 A;  3OR2 C;  1XPX A;  3LHE A;  2XAJ A;  1QZE A;  2XAF A;  5FJ8 J;  5FRM A;  3BQZ A;  3GW2 A;  3HSF A;  4NB5 A;  2MFZ A;  4RM2 A;  4MQV A;  1FZP B;  2XSD C;  4BE0 A;  3HXL A;  5H2F C;  2CGP A;  2MD5 A;  1WJD A;  1IN8 A;  5FKN A;  2K40 A;  3WTU C;  5LBQ A;  1PVE A;  2BVL A;  3DPL C;  4BH9 A;  4HQM A;  1ENH A;  1MH3 A;  4IRI A;  3AFH A;  2HKX A;  3LFK A;  3KP3 A;  1ETX A;  3BWG A;  3CO7 C;  3F6O A;  4LIV A;  1Y39 A;  3HEF A;  2WV1 A;  1HKS A;  3OOP A;  2R7Q A;  1JJ8 C;  2JRM A;  4HQE A;  1QHH D;  3KZY A;  2P19 A;  4AIJ A;  2L3D A;  1IUF A;  1MMS A;  2M5W A;  2EV0 A;  4K2E A;  4NDL A;  4HPQ A;  2AHC A;  3DCF A;  4LLL A;  4NNJ A;  3BTI A;  2VPR A;  3LSH A;  2ZJQ F;  4XOT A;  5CKT A;  3QYF A;  4M9S A;  3TOB A;  3NEU A;  2X1D A;  4G94 A;  1FC3 A;  5E1Z B;  4X0G A;  1RRJ A;  1EH8 A;  1ZGJ A;  2VT3 A;  3KEQ A;  1VQM I;  5BQT A;  3DBH B;  4Y52 J;  2DJN A;  1V5E A;  2KIQ A;  1JE8 A;  3FXR A;  3QYE A;  2Y0M A;  4LMY A;  3EUH A;  2IS4 A;  3CDL A;  1MBJ A;  2VC0 A;  3JRH A;  2HVR A;  3DPU A;  5GAG J;  4XN3 A;  1BA5 A;  4B43 A;  5DCM B;  4KIF A;  3OWT A;  2JA8 J;  2VJJ A;  4AIH A;  2A5W A;  3QRF F;  3C7J A;  3ERE D;  2DLL A;  3KP7 A;  3NAR A;  2DMQ A;  2QGU A;  3BPV A;  2R4G A;  1G2H A;  4ON0 A;  1ZR2 A;  1PJR A;  1O3R A;  2X6O A;  4KNY A;  3GLX A;  2EIM H;  2VLA A;  3PQK A;  1YE9 A;  4A3B J;  1R1T A;  2E19 A;  4UVC A;  2VKD A;  4WXD A;  4AIK A;  1BOA A;  4RB3 C;  2AXT C;  2X1C A;  1ZK8 A;  1FBS A;  2L7M P;  2R5Z B;  3K69 A;  1Z6T A;  2VI6 A;  4HV5 A;  1HQC A;  1X3U A;  3PFI A;  4J19 A;  4DIQ A;  2ISZ A;  1U6G A;  2EFP A;  5EYR A;  1JD3 A;  1W7P D;  1S72 I;  4JX5 A;  3BG6 A;  3JW4 A;  5CJ9 A;  2BBY A;  4FX4 A;  3JAM K;  1MD0 A;  2PJR B;  4IHW A;  3S8P A;  3JRI A;  3T8T A;  1ORK A;  1FYK A;  1YRN A;  4XKV A;  2GBY A;  2LDU A;  4IVN A;  3JTG A;  3HOT A;  2K7L A;  1ON1 A;  1QHG A;  3VSK A;  3NAU A;  4ZZL A;  4G6T B;  4RGU A;  1D0X A;  4ZJZ A;  3PIO F;  1ERD A;  2Y0S A;  2W84 A;  4J01 A;  1TC3 C;  3L1P A;  1OQY A;  2DOD A;  3S2D J;  3ERM A;  3L2Q A;  4EJO A;  2MLK A;  3H35 A;  3DTI A;  2DPU A;  5IT3 A;  2VJI A;  3DTK A;  3O8H A;  1Y0N A;  2DU9 A;  2MBF A;  2VON A;  4A69 C;  3J81 Z;  2QSG X;  4HF2 A;  2X6W A;  5CYV A;  1BI3 A;  4M3E A;  2DFE A;  4M9X A;  3CDH A;  1OR7 A;  3ZMS A;  4ZYH A;  1JHH A;  1MJB A;  1OPC A;  1RPW A;  2FBH A;  5TRD A;  3TQN A;  3TL4 X;  3QPT A;  2IRF G;  2DFI A;  3HOX J;  1F43 A;  3H9G A;  3O8G A;  5A2Q Z;  2XAG A;  2KZV A;  3A0H C;  3TED A;  1MIJ A;  4I98 B;  2HPI A;  4L9T A;  2L54 A;  3N4M A;  5E17 F;  2X1E A;  2HQR A;  3KP4 A;  1TBX A;  2DMU A;  2KP6 A;  3HBL A;  1R36 A;  1TW2 A;  2FQ4 A;  2VQL A;  3LOC A;  2Y31 A;  2EFW A;  4S05 A;  1T38 A;  2LG4 A;  3S1Q J;  2IP2 A;  1FWZ A;  5JR3 A;  3ISP A;  2XB0 X;  1YX3 A;  4J00 A;  2P7C B;  1FPQ A;  3RKX A;  3H3V K;  3F8B A;  5GTI C;  4MFE A;  5J8C A;  4A6E A;  4I02 A;  3VWB A;  3PSI A;  2RKH A;  1OCP A;  4KIC A;  2IS2 A;  4Y13 A;  1EKE A;  2B9S A;  2AS5 F;  5FFZ A;  2DA7 A;  3PIP F;  1RUN A;  1O7L A;  4CYD A;  4G8X A;  4PSX A;  3MKL A;  2LRD A;  3K1P A;  2V9V A;  3EDP A;  5FRN A;  1PUF A;  1AOY A;  1TNT A;  3U1K A;  2HYJ A;  2P7V B;  1IUY A;  5HS8 A;  2KIS A;  5DYM A;  3V4G A;  1LDK B;  3O3K A;  5E1W A;  3TGN A;  5LRS A;  4NC7 A;  4YEJ A;  4JQF A;  3GX4 X;  2HZD A;  1X1D A;  1YTY A;  3FIS A;  2W4S A;  3WOD F;  4D0P A;  3KP6 A;  4FT8 A;  4L0Y B;  2BZT A;  5D4R A;  1DPU A;  1WJB A;  3L9F A;  4GYI A;  4LIU A;  1TQP A;  3VYR B;  1KZH A;  1QU3 A;  5FRO A;  4R1H A;  1ZYR F;  5EJC A;  4BJT A;  2HYG D;  3LSR A;  4H0E A;  2JSC A;  3DV8 A;  2DOA A;  4QPQ A;  4JYK A;  1LEA A;  3FKI J;  4QSH A;  3CME I;  4C30 A;  1PYV A;  4CXF A;  2CW7 A;  3ZMZ A;  3GBG A;  4ZYE A;  4UV8 A;  5D4S A;  3N97 A;  2RA5 A;  3IRR A;  4XLP F;  3D5R C;  4HEA 2;  4PGH A;  1SFX A;  5HS7 A;  2JA7 J;  1KU7 A;  1BIB A;  3QYB A;  4B1R A;  1K83 J;  3KYD B;  3TDU C;  4BXF A;  3DFG A;  4YFX F;  4E7L A;  1FSH A;  2QYO A;  2X4H A;  4A3J J;  5L3B A;  1X1B A;  3QQA A;  4CDG A;  3NWT A;  3S93 A;  1U9O A;  5IT9 Z;  6PAX A;  1E2X A;  1AU7 A;  4HG2 A;  4IHY A;  5DD4 A;  2CFX A;  4ZC3 A;  4A3I J;  1XSD A;  3M9A A;  4I99 C;  2NAZ A;  5FLX Z;  1CGP A;  1ZG5 A;  2H94 A;  5HLG A;  3DWL E;  4RS8 A;  2DXI A;  3F8L A;  5F08 A;  2ZC2 A;  3WTW C;  1ETV A;  3A03 A;  3KZI C;  4GXO A;  3MCZ A;  2DT7 B;  2E35 A;  1WJA A;  3BLY A;  3OR1 C;  4OU0 A;  2LH9 A;  5HOD A;  2H1K A;  1V5F A;  2W00 A;  3SFI A;  1R1U A;  1HKQ A;  4QTR A;  2GA1 A;  2M9H A;  5HDG A;  3Q0V A;  5EG0 A;  2EWN A;  4XKW A;  2DFF A;  1EF4 A;  2V79 A;  3DBR B;  1XCV A;  1SFK A;  5FB2 A;  1UJ8 A;  3J7Y J;  1S7E A;  1ZLJ A;  4Y7N J;  2H8R A;  5L3F A;  2BE5 F;  1PP8 F;  1K4T A;  2IS1 A;  3BR2 A;  1VQ9 I;  1WCM J;  2E34 A;  3RTR A;  4U0Y A;  4BNC A;  3I4M J;  1A04 A;  5IP9 J;  4P96 A;  2MD0 A;  3DQV C;  1W36 D;  2VBX A;  3GWZ A;  3DDV A;  3M1E A;  3RPQ A;  2VC1 A;  2VPL A;  2P4W A;  4M74 A;  3IKT A;  1UHS A;  2VQG A;  4N9I A;  2R5Y A;  4ZTJ A;  4LFU A;  1I50 J;  4PSW A;  2STT A;  3VB2 A;  3SEQ A;  2D5V A;  3S17 J;  2OGG A;  1WJ5 A;  4WXC A;  4IHS A;  4BUP A;  3G1O A;  4C3H J;  5J47 A;  1V4R A;  3BP8 A;  5D5V B;  3F3X A;  1J9I A;  2FA1 A;  3BPX A;  3K6G A;  3KET A;  1BR2 A;  1S5L C;  3CP2 A;  3HOZ J;  2MC4 A;  2O5R A;  3KYC B;  5IP7 J;  4YII A;  2VAS A;  4W97 A;  3OYC A;  2DYS H;  1FYL A;  5LEJ A;  3IWF A;  1GVD A;  1UMQ A;  1UG0 A;  2DDA A;  4IQJ A;  1X4P A;  2IGK A;  3OYJ A;  4I6Z A;  1DP3 A;  1HOM A;  5F0F A;  4BBR J;  2LY9 A;  1LFU P;  3E97 A;  4DGW B;  3CCL I;  5D5X B;  4G7O F;  1KQ9 A;  1YS7 A;  2HXO A;  4M6X A;  4DQ2 A;  3ABL H;  3H3U A;  3I4P A;  2X0L A;  4PZJ A;  2IBD A;  4BQO A;  3KX2 A;  5B3S H;  4RAZ A;  2FBI A;  4D9J A;  2ESH A;  3REO A;  3ML6 A;  1GV2 A;  2EIL H;  2GA2 A;  1IN5 A;  2IA2 A;  2HYF A;  2ZNZ A;  3K0L A;  2VJ5 A;  5M3F J;  4CIC A;  1ZN2 A;  3I3L A;  2XGE A;  5E8G A;  5KCM A;  3WHC A;  4WWC A;  1TT5 B;  4YFK F;  4LJZ F;  3NQO A;  4MLO A;  1Z3Y A;  2VT2 A;  1XD7 A;  3E0J B;  2GIV A;  2VXD A;  3OSF A;  2XV4 S;  4I0B A;  5HLH A;  2H09 A;  2AXL A;  1UHW A;  3DU5 A;  1N75 A;  3W6K B;  1SD4 A;  3VFZ A;  1H8A C;  2HDW A;  2EZI A;  1T6S A;  2EA4 A;  4R8H A;  3PNV A;  2K85 A;  4A2U A;  3CCE I;  3NWS A;  1IRG A;  1UHM A;  2DOF A;  2DK5 A;  1FIA A;  2QEX I;  1WZ2 A;  1EH6 A;  2TDX A;  3PO2 J;  3OL3 A;  5CPR B;  1Y1W J;  3G1M A;  4EV0 A;  2GXA A;  1JTX A;  3JAM Z;  2EB7 A;  4X1E A;  4M3F A;  1YW7 A;  1XGS A;  1YJN I;  2NS0 A;  1A5J A;  1FBQ A;  2FOW A;  2M4K A;  3GCM A;  4FAS D;  5LD2 C;  3K1N A;  4G7H F;  3EUA A;  2OV7 A;  5HVQ C;  1FMV A;  2ZJR F;  2GXB A;  4CCK A;  2M0M A;  1LB2 A;  4HDV A;  3HOV J;  1SD6 A;  1OYI A;  2DTZ A;  1IN4 A;  2L5Q A;  4YFN F;  2PJP A;  4ZSK A;  2OPT A;  2ZKZ A;  3GME A;  1ON2 A;  4BGD A;  4NQW B;  3OL4 A;  1MNE A;  3L2C A;  3LSM A;  1X3Z B;  3VDX A;  4R79 A;  3QP5 A;  3RIR A;  2E2I J;  2HOA A;  3KP2 A;  4E7H A;  1TTY A;  1XTA A;  2L9S A;  3I9V 2;  4XIC A;  1S8N A;  1FLI A;  4ENK A;  2WBM A;  4QIW N;  3K4J A;  3CMM A;  4RLF A;  3FBN B;  4XL9 A;  4P9U A;  3RKQ A;  2DAO A;  1Z91 A;  1HW2 A;  2A07 F;  2DOE A;  2OJE D;  4BL0 B;  5FO5 A;  1G1B A;  2CS3 A;  1Z0X A;  4M6Y A;  2LLK A;  5LGT A;  1BBY A;  1F36 A;  2P5V A;  2Z3Y A;  3ZPL A;  1KU9 A;  4PJL A;  4Y17 A;  1IXS B;  1D1B A;  2J5O A;  1MKM A;  1MMN A;  5FKO A;  3F8C A;  4EM2 A;  4BU2 A;  3AL0 B;  1ZR4 A;  1P4A A;  4UHT A;  2HEO A;  5HLI A;  2LNB A;  2KT0 A;  3M07 A;  4UB6 C;  3E5U A;  1Z9C A;  3ROU A;  2XVC A;  2O61 A;  1V5G A;  5CVV A;  2CV1 A;  1TWG J;  4RAG A;  3RKY A;  2R5Y B;  2M1B A;  2QA4 I;  1X2N A;  3EYY A;  2KRC A;  2NS8 A;  4BAC A;  3W2A A;  1JKO C;  4KUM A;  5LEK A;  2ETH A;  5FFX A;  2CH0 A;  4HNT A;  1A36 A;  5ILS A;  3K2A A;  3CCR I;  1U8R A;  1VQN I;  2V26 A;  5L3E A;  2HFH A;  2HZT A;  3RKW A;  4IF4 A;  2EFN A;  4XID A;  4C3I J;  1DGW Y;  3KFW X;  1OYY A;  4CCJ A;  5JHF A;  2VKE A;  3M4O J;  4KT6 A;  3WGH A;  3BTC A;  5K5O A;  3IC7 A;  1B1B A;  3QOP A;  4M3B A;  2EH3 A;  5TIS C;  4CA0 A;  3S2H J;  3ZMT A;  3ABM H;  3IP4 B;  3FZV A;  2BXZ A;  2M3A A;  1D8J A;  4FHT A;  1DQU A;  2XF5 A;  1NK3 P;  4DOZ A;  2IKK A;  3I5U A;  3ZP5 A;  3Q0U A;  3GZN B;  4AID A;  1POG A;  4A3C J;  4AD9 A;  4G7Z F;  4O6J A;  1YHQ I;  3CC7 I;  4XBF A;  3FXQ A;  1OIS A;  3FMQ A;  3T8R A;  1XDU A;  1TT8 A;  1TWH J;  3HSR A;  2MH9 A;  3TMO A;  5EDN A;  5J1U A;  2HDD A;  2J5P A;  1FTZ A;  3PNT A;  2QQ8 A;  1GLN A;  2DMT A;  4RA2 A;  3GFL A;  2RC4 A;  3R0A A;  4AM3 A;  1ULY A;  2VN2 A;  3BC8 A;  2CG4 A;  1SAX A;  3W6V A;  5DCF A;  4E6K G;  3MFK A;  4IL6 C;  3WGG A;  5J8F A;  2X6X A;  2CQ7 A;  3V8J A;  4MIM A;  1XCB A;  3ESW B;  4NC8 A;  1HDP A;  1WHU A;  3T1B A;  2LP0 A;  5B1A H;  3SDB A;  3AG1 H;  2OUM A;  1WJE A;  2K4B A;  2WC2 A;  1U5T B;  3I59 A;  2VQC A;  1KGS A;  2EFO A;  3F6V A;  3TP3 A;  2Y9Z A;  4BDZ A;  2LFB A;  1JUS A;  4DYC A;  2IS6 A;  1R5I D;  2EJR A;  4YIF A;  5KK1 A;  3CMY A;  4M6V A;  1ETY A;  1ONV A;  2Z33 A;  4ZH4 F;  1ZGA A;  3DEW A;  2F2E A;  3FX3 A;  3OYN A;  2MC3 A;  2KFD A;  1H89 C;  3S1N J;  3B02 A;  2RDP A;  1F9N A;  1AHD P;  1G4D A;  4RGX A;  2HOS A;  4HSR A;  1GUU A;  2L0K A;  1HDD C;  2QQA A;  1R1V A;  3HRS A;  2OQG A;  1KQ0 A;  5J4Y A;  5J6X A;  3SZP A;  1SMT A;  3WHB A;  2ZXI A;  4WF2 A;  2KL4 A;  4XLA A;  1VQ7 I;  4EQQ A;  2QF7 A;  2FSW A;  3JR9 A;  1VTN C;  4P1W A;  4HV6 A;  2TCT A;  2HTJ A;  2JT1 A;  1GVJ A;  2RGV A;  1ZRF A;  4XRS A;  1W0T A;  2IGM A;  4A93 J;  4PJN A;  1OJL A;  2JUG A;  3SXY A;  3A0B C;  1H0M A;  1G3Y A;  1Q1V A;  2PEX A;  1YQA A;  4UXN A;  3RPU D;  5J4V A;  2JK3 A;  2L4M A;  3JTH A;  2EPF A;  2WAE A;  4IEJ A;  1RKW A;  4ZYA A;  2RVC A;  1YOV B;  4ESF A;  5K5Q A;  5D5W B;  1AKH A;  1IN7 A;  3ZQI A;  1TWF J;  4PJJ A;  2GLO A;  3IWZ A;  4L18 B;  1O57 A;  1QVU A;  2FD5 A;  4HX4 A;  2NVX J;  2CUF A;  2NVQ J;  1H9G A;  4XR6 A;  4ETS A;  4V19 K;  1EJ9 A;  1GHC A;  1S3J A;  4I7H A;  1XSV A;  3RQ4 A;  1LQ1 A;  4E7J A;  1F1Z A;  2WY7 Q;  2CYY A;  1D1C A;  3RDI A;  2W57 A;  4DBR A;  4RB0 A;  4AC0 A;  3GFI A;  4CCO A;  2B7E A;  3KLN A;  1ACI A;  4LK0 F;  2VKV A;  1VQO I;  3TP0 A;  2JA5 J;  1G81 A;  2R3S A;  5JLX A;  3MVP A;  1P7I A;  2IEK A;  4DZJ A;  2OOI A;  3JRE A;  1DP7 P;  3VOD A;  1C0W A;  1Z77 A;  1WSU A;  2XRL A;  2YUS A;  2NRA C;  4HX8 A;  1B8I B;  4IQ4 A;  2L01 A;  2MGQ A;  4UB8 C;  2QWW A;  2A5Y B;  3OYE A;  3DP7 A;  1IRF A;  1XS9 A;  1RZ4 A;  2MYS A;  2KIU A;  4XON A;  4Q48 A;  1ZG3 A;  4NHJ A;  3FHN A;  4HNV A;  1BJA A;  3ONQ A;  3FM3 A;  1U3E M;  3LSJ A;  1B6A A;  2CRG A;  2ZME C;  2Z5U A;  4CSW A;  1Y6I A;  3CF2 A;  3RI4 A;  1HW1 A;  1WPK A;  3LNQ A;  3B73 A;  3MN2 A;  2DA2 A;  3S3O A;  4L5E A;  2ESN A;  1B72 B;  2P5K A;  4EJV A;  2CWE A;  3IUO A;  3OYH A;  5BOX A;  2HI3 A;  4BQA A;  1HSJ A;  4BHB A;  3HKZ N;  3RSN A;  4IHT A;  2RNG A;  4EMS A;  3B6A A;  1BI0 A;  1MBH A;  2A61 A;  2V1X A;  4AYB N;  5F1J A;  1VFC A;  3S32 A;  3GFM A;  5EEH A;  2WV0 A;  3EPZ A;  5H6R A;  2R7R A;  3ASO H;  4C9Y A;  2ICW G;  3BTJ A;  4KIB A;  1MDM A;  4YEL A;  5EEA A;  4YIR X;  1IV8 A;  1OLT A;  3IAS 2;  1CQT A;  2ECC A;  5HDN A;  1D3Y A;  1I1G A;  1QZZ A;  4A3E J;  4CYC A;  3C2B A;  3N05 A;  1W36 C;  2EA2 A;  2FNA A;  1QA6 A;  3G2B A;  2XRO A;  1VQ5 I;  1OCT C;  2KRF A;  5E3M A;  1R22 A;  1LDD A;  2FBK A;  2UXX A;  4Y15 A;  5BPI A;  3FHZ A;  4ZSB A;  2QQB A;  2QUF A;  2DBB A;  2D1V A;  4PJ0 C;  1J09 A;  2RNJ A;  1D5V A;  4XLH A;  1YIJ I;  3CCQ I;  2OU2 A;  4HBL A;  5IY5 H;  2VBZ A;  5ICG A;  3U1D A;  3CLQ A;  2I5U A;  3AG2 H;  3C2H A;  2XKO A;  1IC8 A;  1WGX A;  2GWR A;  4WXH A;  1H9T A;  1PDN C;  3BCA A;  3RCO A;  1USS A;  3GTK J;  1FW9 A;  5D8K B;  4FE4 A;  4B3X A;  4RLQ A;  4XKB A;  1KA8 A;  4EM0 B;  1LE8 A;  3SEZ A;  3M3Y J;  4IRH A;  5IP6 A;  3M8E A;  3U9G A;  1F4K A;  5HLT A;  2FRH A;  2LR8 A;  1KQ8 A;  2FNP A;  1T39 A;  2COM A;  1XB4 A;  4F93 B;  1BW5 A;  4KA4 A;  1MH4 A;  1OMI A;  2L7K A;  3IH2 A;  2K9M A;  3IV5 A;  1FSE A;  2M7B A;  2BV6 A;  3KPH A;  5E20 A;  3S1M J;  4PK4 A;  3I54 A;  4XNF A;  4DZP A;  1HF0 A;  2AQE A;  5CVU A;  2O8K A;  1OCC H;  4V2F A;  1GXP A;  2CV0 A;  2O3F A;  4UUT A;  2EIJ H;  4II2 A;  3LAP A;  1TT0 A;  2PMZ N;  1J75 A;  4PDK A;  4XSZ F;  2EK5 A;  3BQY A;  2M34 A;  1GV5 A;  2MG4 A;  1R5H A;  3VSL A;  3HHG A;  2ZNY A;  3Q3S A;  4HA8 A;  1R9T J;  1NHA A;  1XMX A;  5ICF A;  2DK8 A;  5E8I A;  4LG0 A;  2R0Q C;  4UUV A;  1IRX A;  1KON A;  4JK1 X;  4ENM A;  1SVL A;  3ZRG A;  4B09 A;  5B5E C;  2NXN B;  2R7F A;  3BR1 A;  3OYG A;  2GXG A;  2H27 A;  1E3P A;  2HGC A;  2COB A;  3RYP A;  1W1W E;  5CLS A;  3DKX A;  2HKO A;  3J7Z I;  2YPR A;  3VEP A;  2V9K A;  2FA5 A;  2BY0 A;  2MA3 A;  3RQI A;  3S3N A;  2OTJ I;  1LUJ B;  3ZQH A;  2HQ5 A;  4Y33 A;  2JMW A;  3MMY B;  2IGO A;  3G73 A;  4U7D A;  1MBG A;  1MBE A;  1Q1H A;  4GGG A;  1IRZ A;  3M7G A;  3OOU A;  5KVR A;  3WU2 C;  1WH7 A;  2WAQ N;  3KLO A;  5L3G A;  4EGY A;  1Z21 A;  4PGG A;  4Q47 A;  1W7P A;  2GOM A;  1OFC X;  4RGS A;  3GFJ A;  2DYR H;  2MLG A;  2WWY A;  1IJW C;  5GTH C;  4HLY A;  3A01 A;  1WWX A;  2R7S A;  3H1C A;  4U7B A;  4BDY A;  2P6S A;  3LWF A;  2BEO A;  1E3O C;  2VUM J;  1ZQ3 P;  3HHH A;  2O9L A;  1ZLK A;  3KYL A;  3OY9 A;  4BE1 A;  3BRO A;  4M71 A;  4O5V A;  1DGR M;  5LGN A;  1VQK I;  3ZQ7 A;  1UFM A;  2YS9 A;  2OA4 A;  3MAJ A;  1MNM C;  3CUQ A;  2IA1 A;  4EVI A;  4A0Y A;  3GTM J;  4XLN F;  3T5X A;  1PP7 U;  3BG3 A;  5M5Y J;  3V8K A;  1BC7 C;  4FE7 A;  4OIP F;  1TP4 A;  4RAY A;  1YRN B;  1ZRD A;  3E5X A;  1XGM A;  2LMD A;  3L2W A;  2FU4 A;  3G71 I;  2Q2E A;  3OYB A;  1QVT A;  1SD7 A;  3LSK A;  5ERI A;  2G9W A;  4CYC B;  2O6G E;  4BY1 J;  3J7A O;  2A68 F;  5E79 C;  1W0U A;  3WGI A;  3RZD J;  3BJO A;  1T98 A;  3ZQL A;  3E1S A;  1U2W A;  3GVA A;  2C6Y A;  2LYC A;  4N0B A;  5BNG A;  1SFO J;  3HKZ A;  2MW8 A;  1L3L A;  2DN0 A;  2W24 A;  3D5L A;  3PUB A;  3BR5 A;  3CMA I;  2K27 A;  3DLL F;  2X9D A;  2L02 A;  3ZOB A;  1ETO A;  3BR0 A;  2H6C A;  2RQP A;  1R4N B;  1I3A A;  1V54 H;  1RUO A;  1XDS A;  3H9J A;  1NTC A;  3WTV C;  5EZH A;  1P92 A;  2JVG A;  2EFQ A;  2G7U A;  3SQN A;  3ELK A;  1MMG A;  1VI0 A;  5F64 A;  2DMP A;  1HXD A;  2F4I A;  2K86 A;  1QGP A;  3DLA A;  3JSO A;  1CF7 A;  2KDO A;  4O3M A;  2MH2 A;  1JGG A;  1ZRE A;  4B44 A;  3HRU A;  1E3H A;  2A05 A;  1LE8 B;  3S1R J;  1PUE E;  3WG7 H;  2ZB9 A;  2A6E F;  3SHF A;  1TNS A;  2HVQ A;  1D5Y A;  1G8X A;  2KRH A;  2BW3 A;  4BYY A;  2Z1D A;  1HLV A;  5HS9 A;  3K4K A;  4EAT A;  3GTO J;  2VQH A;  5EGO A;  5E1X A;  3BR6 A;  1VQP I;  1HBX G;  3BG9 A;  3OYK A;  2JPB A;  1X3W B;  4AVP A;  4N4O B;  2CV2 A;  2JRT A;  4BQQ A;  1Y56 A;  1K6Y A;  3OS2 A;  2KKO A;  4M72 A;  4GRI A;  4LOC A;  3HOW J;  1BOB A;  2HS5 A;  2LY2 A;  4FCY A;  3GTL J;  3W2W A;  2GOX B;  3L2R A;  2IPQ X;  3HB9 A;  5TGT A;  3G4S I;  3LSI A;  2EV6 A;  4AUX A;  2FJ1 A;  3JRB A;  4D7N A;  2F5V A;  3CP8 A;  2ZXJ A;  2E1N A;  3FWE A;  4JP0 A;  3TDZ C;  1NK2 P;  4I2O A;  1IV6 A;  1PUF B;  3IHU A;  1UAA A;  3MKZ A;  5HOO A;  3TKY A;  1EH7 A;  3K4B A;  4LG0 B;  1MND A;  1UZC A;  5AIQ A;  4RAF A;  3HTS B;  1QPM A;  3PM1 A;  4E7I A;  1J2X A;  3KCC A;  3UKG A;  3K2Z A;  4CZZ A;  3OYD A;  1K78 A;  4A3D J;  3MZH A;  2LSO A;  2V6C A;  1T56 A;  3PJR A;  2IAI A;  4ENJ A;  5IYB J;  4CHU A;  1TQM A;  1Z7L A;  3CCV I;  3OYI A;  3H3Z A;  3U21 A;  3ZN0 A;  2RV8 A;  1P7J A;  5LGU A;  2OC6 A;  2NS7 A;  3OYF A;  3ZQC A;  4D5C A;  4HF0 A;  2LF7 A;  3CNV A;  3R4K A;  2P0W A;  2CUZ A; 
#chains in the Genus database with same CATH homology
 3ABU A;  2VOO A;  3F22 A;  2CSO A;  3BJ6 A;  4BHC A;  2UWM A;  4ZZD A;  2XAH A;  1KYZ A;  3R60 A;  3ECH A;  2ZME A;  2Y75 A;  4ZYD A;  4IJA A;  1J5Y A;  1IF1 A;  4N9H A;  3CUQ B;  1R5G A;  2L4A A;  3I53 A;  2DT5 A;  2Q0O A;  2YSR A;  3HUG A;  4A0X A;  1FNN A;  1J0R A;  3MEX A;  1FT9 A;  1SFU A;  5ED4 A;  3FMS A;  4HAM A;  1ZAR A;  3J81 K;  5CVJ A;  5H6Q A;  5ICE A;  2PMU A;  1BN5 A;  1QBJ A;  1YG2 A;  2YX4 A;  3QU6 A;  4F7Z A;  4KIG A;  1LDJ A;  2FQ3 A;  1IXR C;  1K6O A;  3HFI A;  3P7N A;  3LQQ A;  4BHP A;  2IVM A;  4WCG A;  4EM1 A;  3PQJ A;  4KYW A;  4ASN A;  5EEG A;  4FX0 A;  5LLQ A;  3I58 A;  5FD6 A;  1O3S A;  2CQK A;  3FMR A;  5CVR A;  3U2R A;  1ZRC A;  3E3V A;  2XUB A;  5LHI A;  1YW9 A;  3LAJ A;  2OZU A;  1S7O A;  3O6B B;  1K79 A;  1SMY F;  3BJA A;  3F8N A;  2WTE A;  1U78 A;  3G3Z A;  2V1D A;  3CUO A;  4P5O A;  3F23 A;  3TOA A;  1STZ A;  2PG4 A;  4XRF A;  5DDG A;  4KN4 X;  2Z99 A;  2VBW A;  1W5T A;  1XGO A;  2M45 A;  2PN6 A;  4TV7 A;  2DQR A;  3ULQ B;  2JTV A;  1Z1D A;  4L5J A;  2F5F A;  3IRQ A;  2IW5 A;  5ICC A;  4I01 A;  1TQI A;  1XGN A;  3K1M A;  4MTE A;  2NNN A;  4G6Q A;  1LEB A;  2OZ6 A;  2ELH A;  1XLR A;  2ZME B;  1W4M A;  1FYM A;  2P8T A;  2R7D A;  5JHU A;  3HRT A;  1UST A;  4Q5S F;  5ILU A;  1IXC A;  3K9T A;  4MHG A;  1ZHF A;  5F6F A;  3EQL F;  3MZY A;  1I27 A;  4GCV A;  4M9Z A;  4OIR F;  1YLF A;  5CVI A;  4LK1 F;  3L5Z A;  3F8F A;  3OV8 A;  2QVO A;  1KYW A;  4ENN A;  1JXS A;  1ODD A;  2KJC A;  2OBP A;  4KFC A;  3MWM A;  5L3C A;  1J7K A;  4EJT A;  2XAS A;  4S04 A;  3E5Q A;  2ISY A;  2IT0 A;  2ADU A;  3QAH A;  1QZY A;  5ILV A;  2HOE A;  2W25 A;  1P2F A;  3I0T A;  1YFH A;  3GF2 A;  2DPD A;  2VXZ A;  2QQ9 A;  2CO5 A;  1YYV A;  3WTS C;  3Q9S A;  4RB2 C;  2NWI A;  1S29 A;  3Q9V A;  1R00 A;  2QZ8 A;  2GAU A;  3E6M A;  2NNY A;  2Q8K A;  3F21 A;  4L0Z B;  4B8X A;  4I0A A;  1D8K A;  3BY6 A;  2A6H F;  1LNW A;  1ZAO A;  3P9C A;  2BYV E;  1W5S A;  4LLN A;  3J80 K;  5D5U B;  3WTT C;  2XKP A;  3V8L A;  3CJN A;  3DEU A;  3RJP A;  1BI1 A;  1U5T C;  2FXA A;  5D6F A;  2NYX A;  2OD5 A;  4EGZ A;  4G9Y A;  2KJB A;  2D1H A;  1B9M A;  3AAF A;  5HDK A;  3LA3 A;  1WQ2 A;  1IZ1 A;  2F5D A;  3V7C A;  5JFR A;  1RI7 A;  3M8F A;  2IA0 A;  4ESJ A;  1YS6 A;  1V3F A;  3ZN1 A;  3R6S A;  3I59 B;  4UV9 A;  5LHH A;  2STW A;  2M87 A;  1B59 A;  3L09 A;  4ZSI A;  2QEN A;  1P4X A;  3V7R A;  1HW5 A;  1DPR A;  5JVT A;  2QBY A;  3ECO A;  3SFZ A;  2QLZ A;  4U0W A;  3GUD A;  4KN7 X;  1I5Z A;  2B0L A;  4U88 A;  2EV5 A;  3RPU A;  3QPH A;  3ZMU A;  3D0S A;  3S2W A;  4P9F A;  4A6D A;  4OMY A;  5FGM A;  1LVA A;  5FD5 A;  3KZZ A;  1WKM A;  1S7A A;  1WRJ A;  3HOS A;  1EV7 A;  3L7W A;  2ZJ2 A;  2PMH A;  4YG2 F;  4DNC A;  1Y0U A;  2HDC A;  1BIA A;  4A0Z A;  4HF1 A;  2W85 A;  1Z6R A;  4OOI A;  3R0J A;  2GZW A;  4GYG A;  2YX7 A;  4ESB A;  4ZYG A;  1HST A;  1FP1 D;  4LB6 B;  1KU3 A;  2ACJ A;  2VBY A;  3L00 A;  3HRM A;  2LKP A;  4P55 A;  2A3S A;  2CW0 F;  1Z7U A;  4OIQ F;  4HZF A;  2M30 A;  5BS6 A;  3E6D A;  1OYW A;  5D8L B;  1JGS A;  5AON A;  2DQL A;  3CO6 C;  4WK8 F;  3WG9 A;  2FOK A;  4LLG F;  4KT5 C;  3TO9 A;  1R7J A;  4IRG A;  4EJW A;  3LST A;  4U0V A;  4Z2Y A;  4QWQ A;  2D45 A;  4WX9 A;  2GQQ A;  3I64 A;  4RB1 A;  4MGR A;  2XHK A;  2E1C A;  4CGZ A;  4UNO A;  1BI2 A;  4CO8 A;  3C3W A;  4KMF A;  4E70 A;  3LA7 A;  5DEQ A;  2VOP A;  1MDM B;  4AWX B;  3KEO A;  3VOE A;  4LGW A;  2VOD A;  2PI0 A;  5DD8 A;  2O8X A;  4NQW A;  3TO7 A;  1JHF A;  4L9V A;  4RGR A;  2H6B A;  3C1D A;  1MZB A;  2KIF A;  2HTS A;  2QBY B;  2PBI A;  2V1U A;  4L5I A;  3T0Y A;  1DUX C;  2VE8 A;  4A5M A;  3FM5 A;  4OIN F;  5E18 F;  1T0F A;  1XN7 A;  3IL2 A;  3DKW A;  1IAW A;  3E6C C;  3GYH X;  2OQR A;  3KE2 A;  1QNT A;  4MNU A;  2O0Y A;  2F5E A;  1IW7 F;  2FE3 A;  2QM3 A;  3BZ6 A;  3COA C;  1XMK A;  4GO1 A;  4XSX F;  5K5R A;  2UXN A;  2P6T A;  5LHG A;  1YIO A;  4HX7 A;  1BC8 C;  1O7F A;  3KP5 A;  1MJA A;  1AWC A;  2FF4 A;  3P9K A;  1YW8 A;  2XAQ A;  4HOB A;  2DI3 A;  2P5L C;  1FY7 A;  1S6L A;  3O2P E;  5H20 A;  1P4W A;  1TW3 A;  3FXU A;  1HKT A;  1L0O C;  5DUK A;  4MEY F;  3H92 A;  5F1R A;  3SZT A;  1DDN A;  2VE9 A;  1QO0 D;  3HYI A;  4JBA A;  1O3Q A;  3J80 Z;  3QP6 A;  4PCQ A;  1SD5 A;  4HYE A;  1KU2 A;  3CLO A;  4G6D A;  1W7P B;  3RYR A;  3WE2 A;  1F5T A;  3GO5 A;  5JI6 A;  4M73 A;  5AIP A;  2IJL A;  2Y48 A;  2DO7 A;  4L9N A;  2XGX A;  3QU3 A;  1FOK A;  4KNY A;  1XMA A;  3WTY C;  5TJJ A;  2A69 F;  4MEX F;  1B9N A;  2PQ8 A;  5L3D A;  1G3T A;  1OKR A;  3HTU A;  4IPA A;  4BXU A;  1U5T A;  1FBU A;  1IN6 A;  4HDU A;  4I09 A;  3W6J B;  3CTA A;  3F8M A;  5DV5 A;  1GXQ A;  2XRN A;  4BAY A;  1XSX A;  2HQN A;  4L9J A;  2FEZ A;  1WI9 A;  4HLX A;  2KIM A;  4UVA A;  3WTX C;  1UB9 A;  3E6B A;  2E7X A;  3LQR A;  2M8E A;  2ZBK A;  2DW4 A;  5LRR A;  1R58 A;  3TO6 A;  1MGT A;  1BM9 A;  4LD5 A;  2PKH A;  3F72 A;  5A2Q K;  4OIO F;  1O3T A;  2K02 A;  1TLH B;  2FMY A;  3LA2 A;  3DF8 A;  2D2W A;  1REP C;  1CF7 B;  1ZG1 A;  3IKV A;  4OMZ A;  1FP2 A;  3V7S A;  2O03 A;  4A5N A;  1R23 A;  3JSP A;  4MQ9 F;  3ZMV A;  4MTD A;  3ZMD A;  3GZ5 A;  1P6R A;  1MJ9 A;  4A12 A;  2Z9O A;  2ZO4 A;  2JPC A;  3R61 A;  1E17 A;  2F5C A;  2K4J A;  1LJ9 A;  2G7H A;  1YO5 C;  5K1Y A;  1I6X A;  2OAZ A;  5DCM A;  4LB5 A;  3EET A;  3C18 A;  1B4A A;  2HWV A;  2ZFW A;  3MQ0 A;  2BGC A;  3ABT A;  3WE3 A;  1K7A A;  1K78 B;  3WU0 A;  3HIF A;  5BPD A;  1RNL A;  4HW0 A;  3DXJ F;  2YR2 A;  1SFE A;  1UCR A;  3CUQ C;  3I71 A;  2PFB A;  2PLY A;  4IXA A;  1T2K A;  3FF5 A;  1QQI A;  1Z05 A;  3GEZ A;  2RN7 A;  3WTZ A;  3EYI A;  2FML A;  1RIO H;  2JZY A;  1G6N A;  3BDD A;  3Q5F A;  1FX7 A;  5IT9 K;  5DUI A;  4QLC U;  5D6E A;  2E7W A;  5FLX K;  4UVB A;  2YU3 A;  3WU1 B;  4Q4Z F;  4EJU A;  2ZCW A;  3DPT A;  3GXO A;  5BMZ A;  3HSE A;  1J59 A;  2HR3 A;  3BOQ A;  1G3W A;  4KMU X;  1ZH5 A;  3NRV A;  2UZK A;  2LF8 A;  2XIG A;  1G3S A;  3P9I A;  3GZ6 A;  1I1S A;  4KDP A;  2DTR A;  3LHE A;  2XAJ A;  2XAF A;  3GW2 A;  3HSF A;  4NB5 A;  4MQV A;  1FZP B;  2CGP A;  2MD5 A;  1IN8 A;  3WTU C;  5LBQ A;  3DPL C;  4BH9 A;  4HQM A;  4IRI A;  2HKX A;  3LFK A;  3KP3 A;  3BWG A;  3CO7 C;  3F6O A;  1HKS A;  3OOP A;  4HQE A;  3KZY A;  2P19 A;  4AIJ A;  2L3D A;  2M5W A;  2EV0 A;  4K2E A;  2AHC A;  4LLL A;  4M9S A;  3TOB A;  3NEU A;  5E1Z B;  1FC3 A;  4G94 A;  1EH8 A;  1ZGJ A;  2VT3 A;  3KEQ A;  5BQT A;  1JE8 A;  3FXR A;  2Y0M A;  4LMY A;  3EUH A;  2VC0 A;  5DCM B;  4KIF A;  4AIH A;  3QRF F;  3C7J A;  3ERE D;  2DLL A;  3KP7 A;  3BPV A;  4ON0 A;  1O3R A;  3GLX A;  3PQK A;  1R1T A;  4UVC A;  4WXD A;  4AIK A;  1BOA A;  4RB3 C;  1FBS A;  3K69 A;  1Z6T A;  4HV5 A;  1HQC A;  1X3U A;  3PFI A;  2ISZ A;  1U6G A;  2EFP A;  1JD3 A;  1W7P D;  3JW4 A;  5CJ9 A;  4FX4 A;  2BBY A;  3JAM K;  1MD0 A;  3T8T A;  1FYK A;  2LDU A;  4IVN A;  3JTG A;  3HOT A;  2K7L A;  1ON1 A;  4ZZL A;  4RGU A;  2W84 A;  4EJO A;  2MLK A;  2DPU A;  5IT3 A;  2MBF A;  2DU9 A;  2VON A;  3J81 Z;  4HF2 A;  5CYV A;  1BI3 A;  4M9X A;  3ZMS A;  3CDH A;  1OR7 A;  4ZYH A;  1JHH A;  1MJB A;  1OPC A;  2FBH A;  5TRD A;  3TQN A;  3QPT A;  2IRF G;  2DFI A;  5A2Q Z;  2XAG A;  4I98 B;  4L9T A;  2L54 A;  3N4M A;  5E17 F;  2HQR A;  3KP4 A;  1TBX A;  1R36 A;  1TW2 A;  2EFW A;  4S05 A;  1T38 A;  2IP2 A;  1FWZ A;  5JR3 A;  3ISP A;  2P7C B;  1FPQ A;  3RKX A;  3F8B A;  5J8C A;  4A6E A;  4I02 A;  2RKH A;  4KIC A;  4Y13 A;  2AS5 F;  5FFZ A;  1RUN A;  1O7L A;  4CYD A;  4G8X A;  3K1P A;  2V9V A;  3EDP A;  1AOY A;  1TNT A;  2P7V B;  1IUY A;  5HS8 A;  5DYM A;  3V4G A;  1LDK B;  3O3K A;  5E1W A;  3TGN A;  5LRS A;  4JQF A;  3GX4 X;  1YTY A;  4D0P A;  3WOD F;  4L0Y B;  3KP6 A;  4FT8 A;  1DPU A;  5D4R A;  3L9F A;  4GYI A;  1TQP A;  4R1H A;  1ZYR F;  2HYG D;  4H0E A;  2JSC A;  3DV8 A;  1LEA A;  4CXF A;  3ZMZ A;  4ZYE A;  4UV8 A;  5D4S A;  3N97 A;  2RA5 A;  3IRR A;  4XLP F;  4PGH A;  1SFX A;  5HS7 A;  1KU7 A;  1BIB A;  3TDU C;  3DFG A;  4YFX F;  1FSH A;  2QYO A;  2X4H A;  5L3B A;  4CDG A;  5IT9 Z;  6PAX A;  1E2X A;  5DD4 A;  2CFX A;  1XSD A;  3M9A A;  2NAZ A;  5FLX Z;  1CGP A;  1ZG5 A;  2H94 A;  5HLG A;  4RS8 A;  3F8L A;  3WTW C;  4GXO A;  3MCZ A;  4OU0 A;  1R1U A;  1HKQ A;  2GA1 A;  5HDG A;  2EWN A;  2V79 A;  1XCV A;  5FB2 A;  1ZLJ A;  5L3F A;  2BE5 F;  1PP8 F;  3RTR A;  4U0Y A;  4BNC A;  1A04 A;  4P96 A;  3DQV C;  2VBX A;  3GWZ A;  3DDV A;  3M1E A;  3RPQ A;  2VC1 A;  2P4W A;  4M74 A;  3IKT A;  4N9I A;  4LFU A;  2STT A;  3VB2 A;  2OGG A;  4WXC A;  4IHS A;  1V4R A;  3BP8 A;  5D5V B;  3F3X A;  1J9I A;  2FA1 A;  3BPX A;  3KET A;  4YII A;  1FYL A;  5LEJ A;  3IWF A;  3E97 A;  5D5X B;  4G7O F;  1KQ9 A;  1YS7 A;  4M6X A;  4DQ2 A;  3H3U A;  3I4P A;  2X0L A;  4PZJ A;  4RAZ A;  2FBI A;  2ESH A;  3REO A;  3ML6 A;  2IA2 A;  2ZNZ A;  2GA2 A;  1IN5 A;  3K0L A;  2HYF A;  4CIC A;  1ZN2 A;  4WWC A;  5E8G A;  4YFK F;  4LJZ F;  3NQO A;  2VT2 A;  1XD7 A;  2GIV A;  2XV4 S;  5HLH A;  4I0B A;  2H09 A;  2AXL A;  1UHW A;  3W6K B;  1SD4 A;  3VFZ A;  1T6S A;  2EA4 A;  4R8H A;  4A2U A;  1IRG A;  1UHM A;  2DK5 A;  1EH6 A;  2TDX A;  4EV0 A;  3JAM Z;  2EB7 A;  1YW7 A;  1XGS A;  2NS0 A;  1FBQ A;  3K1N A;  4G7H F;  5HVQ C;  2GXB A;  1LB2 A;  4HDV A;  1SD6 A;  1OYI A;  2PJP A;  1IN4 A;  4YFN F;  4ZSK A;  2ZKZ A;  1ON2 A;  3L2C A;  4R79 A;  3QP5 A;  3RIR A;  3KP2 A;  1TTY A;  1S8N A;  1FLI A;  4ENK A;  4P9U A;  2DAO A;  1Z91 A;  1HW2 A;  2A07 F;  5FO5 A;  1G1B A;  4M6Y A;  5LGT A;  1BBY A;  2P5V A;  3ZPL A;  2Z3Y A;  1KU9 A;  4Y17 A;  1IXS B;  2J5O A;  1MKM A;  4EM2 A;  3F8C A;  1P4A A;  4UHT A;  2HEO A;  5HLI A;  2LNB A;  3E5U A;  1Z9C A;  3ROU A;  2XVC A;  2O61 A;  5CVV A;  3RKY A;  2M1B A;  3EYY A;  4KUM A;  5LEK A;  2ETH A;  5FFX A;  5ILS A;  1U8R A;  5L3E A;  2HFH A;  2HZT A;  3RKW A;  4IF4 A;  2EFN A;  3KFW X;  1OYY A;  3WGH A;  5K5O A;  3IC7 A;  1B1B A;  3QOP A;  3ZMT A;  3FZV A;  1D8J A;  4FHT A;  2IKK A;  3I5U A;  3ZP5 A;  4AD9 A;  4G7Z F;  4O6J A;  4XBF A;  3FXQ A;  3FMQ A;  3T8R A;  1XDU A;  1TT8 A;  3HSR A;  2MH9 A;  2J5P A;  3GFL A;  2RC4 A;  3R0A A;  1ULY A;  2VN2 A;  1SAX A;  2CG4 A;  5DCF A;  3MFK A;  3WGG A;  5J8F A;  3V8J A;  1XCB A;  3T1B A;  2WC2 A;  2K4B A;  1U5T B;  3I59 A;  1KGS A;  2EFO A;  3F6V A;  2EJR A;  4YIF A;  5KK1 A;  1ONV A;  2Z33 A;  4ZH4 F;  1ZGA A;  2F2E A;  3FX3 A;  2MC3 A;  3B02 A;  2RDP A;  1F9N A;  1G4D A;  4RGX A;  2QQA A;  1R1V A;  3HRS A;  2OQG A;  1KQ0 A;  5J6X A;  3SZP A;  1SMT A;  4WF2 A;  4EQQ A;  2FSW A;  1VTN C;  4HV6 A;  2HTJ A;  2JT1 A;  1GVJ A;  2RGV A;  1ZRF A;  3SXY A;  1H0M A;  1G3Y A;  2PEX A;  4UXN A;  1YQA A;  2L4M A;  3JTH A;  2RVC A;  4ESF A;  5K5Q A;  5D5W B;  1IN7 A;  4L18 B;  3IWZ A;  1O57 A;  4HX4 A;  1H9G A;  4ETS A;  1GHC A;  1S3J A;  4I7H A;  1XSV A;  1LQ1 A;  1F1Z A;  2CYY A;  3RDI A;  2W57 A;  4RB0 A;  3GFI A;  3KLN A;  4LK0 F;  1G81 A;  2R3S A;  2OOI A;  1DP7 P;  3VOD A;  1C0W A;  1WSU A;  2NRA C;  4HX8 A;  2L01 A;  2QWW A;  2A5Y B;  3DP7 A;  1IRF A;  1RZ4 A;  2KIU A;  4Q48 A;  1ZG3 A;  4NHJ A;  1BJA A;  3FM3 A;  1U3E M;  1B6A A;  2Z5U A;  3RI4 A;  1HW1 A;  3B73 A;  2ESN A;  2P5K A;  4EJV A;  2CWE A;  5BOX A;  4BQA A;  1HSJ A;  4BHB A;  4IHT A;  4EMS A;  1BI0 A;  2A61 A;  2V1X A;  3GFM A;  5EEH A;  2WV0 A;  5H6R A;  4KIB A;  1MDM A;  5HDN A;  1D3Y A;  1I1G A;  1QZZ A;  2EA2 A;  2FNA A;  2XRO A;  2KRF A;  1R22 A;  1LDD A;  2FBK A;  2UXX A;  4Y15 A;  5BPI A;  3FHZ A;  4ZSB A;  2QQB A;  2QUF A;  2DBB A;  2D1V A;  2RNJ A;  1D5V A;  2OU2 A;  4HBL A;  2VBZ A;  5ICG A;  3U1D A;  2XKO A;  4WXH A;  2GWR A;  1H9T A;  1PDN C;  1USS A;  1FW9 A;  5D8K B;  1KA8 A;  4EM0 B;  4IRH A;  3M8E A;  3U9G A;  1F4K A;  2FRH A;  1KQ8 A;  2FNP A;  1T39 A;  2COM A;  1XB4 A;  4KA4 A;  1OMI A;  1FSE A;  2BV6 A;  5E20 A;  3I54 A;  5CVU A;  1GXP A;  2O3F A;  3LAP A;  1J75 A;  4PDK A;  4XSZ F;  2EK5 A;  1R5H A;  3HHG A;  2ZNY A;  4HA8 A;  1NHA A;  5ICF A;  2DK8 A;  5E8I A;  4LG0 A;  4UUV A;  4JK1 X;  4ENM A;  4B09 A;  2R7F A;  2GXG A;  2H27 A;  2HGC A;  3RYP A;  5CLS A;  2HKO A;  2YPR A;  3VEP A;  2FA5 A;  2MA3 A;  3G73 A;  4U7D A;  4GGG A;  1Q1H A;  3M7G A;  5KVR A;  3KLO A;  5L3G A;  4EGY A;  4PGG A;  4Q47 A;  1W7P A;  4RGS A;  3GFJ A;  2MLG A;  2WWY A;  4HLY A;  1WWX A;  4U7B A;  2P6S A;  3LWF A;  2BEO A;  3HHH A;  1ZLK A;  3BRO A;  4M71 A;  4O5V A;  5LGN A;  3ZQ7 A;  1UFM A;  2OA4 A;  3MAJ A;  3CUQ A;  2IA1 A;  4EVI A;  4A0Y A;  4XLN F;  3T5X A;  1PP7 U;  3V8K A;  1BC7 C;  4OIP F;  4RAY A;  1ZRD A;  3E5X A;  1XGM A;  2FU4 A;  2Q2E A;  5ERI A;  2G9W A;  2O6G E;  3J7A O;  2A68 F;  3WGI A;  3BJO A;  1T98 A;  1U2W A;  3GVA A;  2C6Y A;  4N0B A;  1L3L A;  2W24 A;  3D5L A;  2K27 A;  2L02 A;  2H6C A;  2RQP A;  1RUO A;  1XDS A;  3WTV C;  1P92 A;  2EFQ A;  2G7U A;  3SQN A;  3ELK A;  5F64 A;  1HXD A;  2K86 A;  1QGP A;  3JSO A;  1CF7 A;  4O3M A;  2MH2 A;  1ZRE A;  3HRU A;  1PUE E;  2A6E F;  3SHF A;  1TNS A;  4BYY A;  5HS9 A;  5E1X A;  1HBX G;  2JPB A;  4AVP A;  2JRT A;  2KKO A;  4M72 A;  2HS5 A;  2IPQ X;  2EV6 A;  3FWE A;  2ZXJ A;  2E1N A;  3TDZ C;  4I2O A;  3IHU A;  5HOO A;  3TKY A;  1EH7 A;  4LG0 B;  5AIQ A;  3HTS B;  1QPM A;  1J2X A;  3KCC A;  3K2Z A;  4CZZ A;  1K78 A;  3MZH A;  2LSO A;  2V6C A;  4ENJ A;  4CHU A;  1TQM A;  3H3Z A;  3ZN0 A;  2RV8 A;  5LGU A;  4HF0 A;  2LF7 A;  3CNV A;  3R4K A;  1SD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...