3BWGA

The crystal structure of possible transcriptional regulator yydk from bacillus subtilis subsp. subtilis str. 168
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
229
structure length
223
Chain Sequence
QQIATEIETYIEEHQLQQGDKLPVLETLMAQFEVSKSTITKSLELLEQKGAIFQVRGSGIFVRKHKRKGYISLLSNQGDFNVTSKVIELDVRKPTPEAAENLNIGMDEDIYYVKRVRYINGQTLCYEESYYTKSIVTYLNNEIVSHSIFHYIREGLGLKIGFSDLFLHVGQLNEEEAEYLGLEAGLPKLYIESIFHLTNGQPFDYSKISYNYEQSQFVVQANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of possible transcriptional regulator YydK from Bacillus subtilis subsp. subtilis str. 168.
rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transcription regulator
molecule keywords Uncharacterized HTH-type transcriptional regulator yydK
total genus 58
structure length 223
sequence length 229
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
A PF07702 UTRA UTRA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bwgA01
3.40.1410.10 Alpha Beta 3-Layer(aba) Sandwich Chorismate lyase Chorismate lyase-like 3bwgA02
1IAWA 1TTYA 2ZFWA 4L5IA 2Y0MA 2CFXA 4NQWA 2K86A 3KEQA 3KP2A 1IN5A 2OGGA 3DQVC 4IHSA 1QQIA 2D1VA 3RKXA 2ZNYA 4CICA 1FBSA 1P2FA 2M30A 4WXCA 2GAUA 3F8NA 1Z6RA 2D2WA 1TQMA 3F23A 3WE2A 4RB0A 2IA2A 1EH8A 2H09A 3H3UA 2OU2A 3GWZA 3VB2A 5KK1A 5DD8A 1FWZA 5AIPA 4G7HF 3LAPA 5L3CA 3LWFA 3ZMSA 4LK0F 3KETA 5BS6A 4I98B 4GYIA 1B1BA 2FQ3A 1QGPA 1XGNA 4WXDA 1FW9A 2LF7A 2VT3A 2A3SA 2RN7A 3VFZA 1Z6TA 3IC7A 4P9FA 2A6EF 2E1NA 2QQ9A 4CDGA 1PDNC 2Q8KA 2P6SA 2RV8A 4HA8A 2F5FA 5BOXA 5IT9Z 1DP7P 5BMZA 4RGUA 3WU1B 2GA2A 3DP7A 5ILSA 1I1SA 2FA1A 3I53A 2WTEA 4LD5A 6PAXA 4AIJA 3TO6A 2AXLA 5CVJA 1G1BA 2FU4A 4HF0A 4EJUA 4HOBA 1EV7A 3I58A 2MD5A 1S3JA 3JAMZ 2BYVE 1W5TA 1MJBA 4ESJA 2HKXA 2H27A 3K9TA 4HX4A 2TDXA 3LQRA 3QRFF 1IN7A 5FFXA 3RYPA 1HSTA 2YX7A 3K1MA 2XUBA 3T0YA 1YS7A 1OYYA 2MLGA 4ENJA 1ZGJA 3CUOA 3FF5A 3CUQC 3FXUA 5HOOA 4FHTA 1U5TB 1K78A 4ON0A 4LK1F 2EV0A 3WG9A 1YG2A 3M7GA 1U78A 5IT3A 2A68F 5HDKA 1TNTA 2A61A 2DI3A 1BC8C 4CZZA 2HFHA 3EDPA 2ZBKA 4MNUA 1PUEE 1ZRFA 5K5RA 2IPQX 4IJAA 2DAOA 2DK8A 2P7VB 4M6XA 4HX7A 5J8CA 1FPQA 5D4SA 1G3SA 2Z3YA 3HSEA 4MEYF 2LF8A 1U2WA 3VODA 4LMYA 2VBZA 5CVUA 4K2EA 1LEBA 3CLOA 1ON1A 2A69F 1LQ1A 3GEZA 2VE8A 3EETA 3WU0A 1D8KA 1NHAA 2NNYA 1H9TA 1WQ2A 3HYIA 1STZA 3M1EA 1TT8A 1DPRA 2K02A 4FX0A 1SD6A 2KIMA 1HW5A 1ZRDA 1KU2A 3OV8A 1XSXA 1OR7A 2MH2A 4OIQF 5LEJA 3T8TA 3JAMK 4I09A 1IXRC 2VOOA 1K7AA 1ZLJA 2ETHA 1FYKA 1B6AA 3GFIA 3J7AO 3L7WA 2XRNA 4Z2YA 3QPHA 2XROA 3ZQ7A 3K2ZA 1T98A 2XASA 2GXGA 2L4AA 3K1PA 3F6VA 2YX4A 2K7LA 2GQQA 3TDUC 3RYRA 5E1ZB 1KQ9A 1ZGAA 4I7HA 1W5SA 2RA5A 2FBIA 2PKHA 5BQTA 5ILUA 4HX8A 2AHCA 4Y13A 1DDNA 3LAJA 3GO5A 4LGWA 4AVPA 4E70A 1F5TA 4G8XA 2JT1A 2DLLA 1BJAA 4A2UA 1U3EM 5DUKA 2O0YA 2P5VA 3WTTC 3P9CA 4UV9A 2IVMA 1FYLA 1TLHB 5HDGA 2EFOA 2EA2A 3O2PE 2R7FA 1YQAA 4LLNA 2ADUA 3CJNA 2KIUA 3I59A 2P8TA 5J8FA 2A6HF 1BI2A 5A2QZ 5H6QA 3H3ZA 1HW2A 2ZMEB 2DK5A 3DPTA 3TDZC 4ASNA 2VODA 2GZWA 1KGSA 2VC0A 3TO7A 1V3FA 4ZH4F 3C18A 3ECHA 4L9NA 1ZG1A 1DPUA 2RQPA 1FSEA 3RI4A 3J80Z 2B0LA 1IN4A 5DEQA 3KE2A 3TGNA 3HRTA 1LEAA 2E7WA 2HGCA 5JVTA 3GZ5A 3CO7C 1DUXC 4ETSA 4F7ZA 1J75A 3WTUC 4P96A 2BGCA 1H0MA 2XKPA 1ON2A 3NQOA 2UXNA 3B02A 4IXAA 2X0LA 1A04A 1GVJA 3V7SA 4ENNA 3E6MA 1WSUA 2UZKA 3HFIA 1AOYA 2M5WA 5EEGA 4MQVA 3WTZA 5K5OA 4KN7X 1FZPB 3MEXA 2JPBA 1XCVA 2H94A 4G9YA 3WTYC 1CF7B 1YFHA 4CYDA 3ZN1A 1YIOA 1TQIA 1R36A 2ZNZA 3KZYA 2QM3A 4U0YA 1BI3A 1P92A 2QYOA 2F2EA 4OMZA 1OYIA 2V79A 3ABTA 2M8EA 3BROA 2QUFA 4P55A 4ZSKA 1J5YA 2KRFA 1F9NA 3GFMA 5AONA 4UHTA 4A6EA 5LHGA 2ZMEA 1MKMA 4O3MA 4A0ZA 4AIKA 5ED4A 2G9WA 5E8IA 5FD5A 5CLSA 5LBQA 4B09A 3WGHA 2QQBA 3TO9A 1MGTA 3MQ0A 1TNSA 3TOAA 5DV5A 4TV7A 1O3RA 1F1ZA 3NEUA 1IRFA 1FY7A 2HOEA 5J6XA 3V8JA 1BN5A 2COMA 5E8GA 3P9IA 3E5UA 5HS9A 4A12A 2L02A 1RNLA 2EFWA 2HR3A 3V7RA 4D0PA 4IRIA 5DD4A 1G4DA 3HTUA 1Z05A 2Z5UA 4M6YA 4WX9A 3U2RA 5F64A 2F5EA 1I1GA 3MCZA 1XGOA 2YSRA 2HYGD 3K1NA 4BAYA 4AWXB 1XLRA 2VBXA 3E6DA 5FO5A 2ZKZA 3M9AA 4ZSBA 4KYWA 3FZVA 4CGZA 1Y0UA 4RB1A 4U0VA 2O6GE 3L2CA 4ZZLA 3HHHA 2E1CA 3ROUA 1KQ0A 4EJWA 3ELKA 2W57A 2X4HA 3W6KB 4LLGF 2HEOA 1RUNA 2XVCA 3FXQA 4MGRA 1HXDA 5LLQA 2CO5A 2PEXA 1USSA 4ZYHA 2QVOA 1USTA 3H92A 4KDPA 1MJAA 4NB5A 2OQRA 3EYYA 4S05A 2YU3A 1U6GA 3QAHA 1YLFA 5IT9K 4ZYEA 2L54A 3GLXA 3KP4A 3I59B 2DQRA 2YR2A 3GFLA 2Z33A 1WWXA 4UVBA 4EM2A 4Y15A 5DDGA 4Q47A 1QZZA 3CDHA 4Q48A 4R1HA 5HLIA 2DPDA 4XBFA 1KU9A 4L0YB 4MEXF 2W85A 4FT8A 2GIVA 3TOBA 2D45A 2RDPA 3K69A 2WC2A 1S7OA 5LRRA 1TBXA 4G7OF 4P5OA 3BOQA 3HHGA 4HLYA 4HDVA 1L3LA 3RDIA 1FYMA 1SAXA 2OOIA 1JD3A 1BC7C 1RIOH 2JPCA 1JGSA 4IPAA 3IKTA 5L3FA 2EFQA 3GUDA 4RAZA 2H6BA 4UNOA 2L01A 2RKHA 3C1DA 4RS8A 2OBPA 3KP7A 1BOAA 3OOPA 3P9KA 3LA2A 5EEHA 2PI0A 1R1TA 2HS5A 1LVAA 2DBBA 5KVRA 2XAFA 4HV6A 2GXBA 2ZXJA 1IRGA 5H20A 5HS8A 3HOSA 4QWQA 2O61A 4M73A 4HDUA 4A0XA 3ZMZA 5LHIA 2V1XA 2MBFA 4OIOF 2PG4A 2MC3A 4KUMA 1XSVA 5DCMB 5HLGA 1Z7UA 5FGMA 1BI1A 4RGSA 3V8LA 3HUGA 1XD7A 1SFUA 4HLXA 3Q9SA 1OPCA 2QLZA 3GFJA 1KA8A 1S29A 3BZ6A 1O7FA 2XAGA 3GX4X 4M71A 4L9VA 3SHFA 1Q1HA 5D8LB 1YO5C 1Z9CA 5H6RA 4ZYDA 5D5XB 3DPLC 2EV6A 1U5TC 1MZBA 3HRUA 3E6BA 4RB3C 2HDCA 3MWMA 1ODDA 1LDDA 1S8NA 1XGMA 4GXOA 5CYVA 2DU9A 1D5VA 5CVRA 1W7PB 1B4AA 4BXUA 3CTAA 2EK5A 3LQQA 4I0AA 2DO7A 2PMHA 5K1YA 1IZ1A 3ZMVA 3WTVC 1P4WA 1WRJA 4KMUX 3C7JA 4I01A 4KIFA 2VXZA 1HKSA 2RGVA 1QO0D 1FBQA 4KIGA 2W84A 1R7JA 2XAHA 4EJOA 2ISZA 5CJ9A 2K4JA 2PQ8A 4UV8A 4GO1A 1T6SA 2IA1A 3U1DA 4EJTA 2OD5A 3W6JB 2LKPA 1J9IA 5JFRA 4IRGA 3RKWA 3KLOA 4MTEA 4BHPA 4KNYA 4WF2A 2IT0A 2GWRA 1UHMA 5D5UB 1D3YA 1S6LA 1QZYA 4PGHA 2IKKA 2A5YB 3L00A 2RNJA 3L5ZA 3FM5A 1SMYF 4L5JA 2HWVA 2OAZA 1K79A 4KIBA 2A07F 4YFNF 1ZYRF 2NWIA 4OU0A 4R8HA 4DQ2A 4LLLA 3ULQB 4YG2F 4M74A 2F5CA 4IHTA 2KJBA 1R22A 3LA3A 5D6FA 3EYIA 3CUQA 3WE3A 1ZARA 4WCGA 2O3FA 3RJPA 3QU6A 2FNPA 3RKYA 2VBYA 1XSDA 3BPVA 2FA5A 1VTNC 2JZYA 1QPMA 1BBYA 1IUYA 1YW9A 4A6DA 3ZPLA 3G73A 3IRRA 2WWYA 1BIAA 5D5VB 2M87A 1F4KA 2FMYA 3MZYA 2KIFA 4HAMA 1R58A 3GZ6A 3B73A 3G3ZA 3FMSA 3R0AA 4QLCU 3CO6C 2Q2EA 3BJAA 4I0BA 4HW0A 1W7PD 1UB9A 2WV0A 5BPDA 1CF7A 1FOKA 1MD0A 3ZN0A 2FE3A 2NRAC 3R6SA 2QQAA 3P7NA 3I54A 5D5WB 5DCFA 3JSOA 3F22A 1JHFA 2NAZA 3ECOA 1V4RA 3ML6A 3KP3A 3HRMA 4HV5A 1WI9A 3IL2A 2VC1A 2CG4A 2P4WA 5TRDA 2M45A 1W7PA 3FXRA 1LJ9A 1P4AA 3J81K 3GF2A 1J0RA 4CHUA 5E17F 3KFWX 3BPXA 3QOPA 1BI0A 3R61A 1GHCA 2CW0F 1GXPA 1SD7A 2CWEA 5E18F 5CVVA 2QENA 3SZTA 1XCBA 1D8JA 2F5DA 4BNCA 4HF2A 1XMKA 1PP7U 1B9NA 2JSCA 4UXNA 2CYYA 2FXAA 1S7AA 2R7DA 1FP1D 1P4XA 1I5ZA 4KMFA 4O6JA 1KU7A 4LG0A 3KP6A 2LDUA 1O57A 5TJJA 4N9HA 4IVNA 4MQ9F 5K5QA 4PGGA 2RC4A 5ICEA 1FSHA 3D5LA 5LEKA 2M1BA 3FM3A 1G6NA 3DEUA 1G81A 4LG0B 4OIRF 1R23A 4CO8A 4Y17A 2STWA 2BV6A 5E1WA 2ZO4A 3E97A 1SMTA 2HKOA 3MFKA 3T1BA 5LGNA 4Q4ZF 5DCMA 4UVAA 2QWWA 5L3GA 1R00A 2HYFA 4L0ZB 5HDNA 3WGGA 1J7KA 3BJ6A 3R60A 2W25A 4KN4X 3N97A 2L4MA 4JK1X 1J59A 2BE5F 2XHKA 1ULYA 1SD5A 4MHGA 2MLKA 2L3DA 1HW1A 2VN2A 3LSTA 3TKYA 4HQEA 2PMUA 1SD4A 2CSOA 3I5UA 1WKMA 3L9FA 1KYWA 3TQNA 1RUOA 2OA4A 1HKQA 4MTDA 4RAYA 3BDDA 1JXSA 2HZTA 1QNTA 1P6RA 2GA1A 5LGTA 3KCCA 3DDVA 5ILVA 1CGPA 2NYXA 4HQMA 3DFGA 3IWZA 3QU3A 3F8CA 2Z9OA 3FMRA 1T0FA 3HTSB 1G3WA 2Z99A 4GGGA 1BM9A 4A0YA 1OKRA 1YYVA 5BPIA 3V7CA 4U7DA 1I6XA 4XSXF 1IF1A 2MH9A 3R0JA 4OOIA 4NHJA 4WK8F 3ZMTA 2R3SA 3FMQA 3REOA 3HOTA 3PQKA 3K0LA 1IW7F 3JTGA 1O3QA 3DF8A 4UUVA 3ZP5A 2XKOA 2D1HA 3V4GA 3IWFA 1ZH5A 4FX4A 5LGUA 2G7HA 3EUHA 1EH6A 3L09A 2XAJA 4A5MA 3QP5A 1ZLKA 1I27A 4XLNF 1XGSA 1JHHA 1FX7A 2LNBA 5D6EA 5D8KB 3RIRA 4CXFA 4HZFA 3CUQB 2ESNA 5HS7A 4LB6B 3MAJA 4M9XA 2V1UA 2XGXA 1LB2A 2NS0A 3LFKA 2PLYA 2OZ6A 4EQQA 3RPUA 2P5KA 3F3XA 1ZHFA 3LA7A 1ZREA 1E17A 4JQFA 4KICA 3VEPA 4ZSIA 3RPQA 3J81Z 2AS5F 2EFPA 1Z1DA 1XDUA 1K78B 1G3TA 1SFEA 2P7CB 3WTWC 2V6CA 2PJPA 1Z91A 3BWGA 1BIBA 1G3YA 1TW3A 4RGRA 2FSWA 3E5QA 4IF4A 4HBLA 3GYHX 1REPC 2PBIA 2O8XA 1T38A 1R5HA 4EJVA 3DXJF 2VT2A 3Q9VA 1T39A 2IRFG 3FWEA 4PDKA 2Q0OA 1H9GA 2JRTA 3E6CC 2EWNA 2YPRA 2CQKA 3BY6A 3JSPA 4I02A 4BQAA 4AD9A 1LDKB 1UFMA 3ISPA 4GYGA 2H6CA 1FLIA 5ICFA 3HRSA 2J5OA 4ZZDA 1HSJA 3IRQA 4IRHA 5DUIA 2OQGA 2W24A 5FFZA 4HYEA 4RB2C 3LHEA 2CGPA 2VE9A 3DV8A 2FBHA 4G6QA 1O3TA 1ZG3A 2EJRA 3JW4A 4U7BA 1FNNA 5L3BA 3IKVA 3J80K 4OIPF 4L9JA 1AWCA 3Q5FA 2KKOA 5ICCA 4U88A 1XN7A 2OZUA 1ONVA 3BJOA 5JI6A 5LRSA 3WODF 5FB2A 1OYWA 4H0EA 4Q5SF 5FLXK 1B9MA 4OINF 2EV5A 5F6FA 4ENMA 1HQCA 3VOEA 2DW4A 3F8LA 1GXQA 2DTRA 2Y75A 1OMIA 3HIFA 1KU3A 2P6TA 1YW8A 2FOKA 3T5XA 4BHBA 1R1VA 2C6YA 1FT9A 1O3SA 3C3WA 4A5NA 2ISYA 1XDSA 1UHWA 3PFIA 4OMYA 5D4RA 2IW5A 2DT5A 1X3UA 2G7UA 1SFXA 1YW7A 4L18B 4BHCA 3MZHA 2EB7A 1T2KA 1ZN2A 2UWMA 5HVQC 5ICGA 4BH9A 3M8EA 2HQNA 2FRHA 3F72A 3FHZA 2IP2A 2P19A 4N0BA 1LDJA 4B8XA 2KJCA 4LJZF 2K27A 3WTSC 4HF1A 2XAQA 3T8RA 2DQLA 3F8BA 2V9VA 5DYMA 2P5LC 4G7ZF 3F21A 1O7LA 4R79A 3GXOA 1JE8A 1UCRA 2FNAA 4N9IA 1B59A 3V8KA 5LHHA 3WTXC 1J2XA 3SQNA 2FMLA 1IXSB 2PN6A 3ZMDA 4M9SA 3IHUA 2VOPA 4EM0B 2UXXA 3R4KA 4YIFA 2EFNA 2VBWA 4AIHA 1K6OA 2ZJ2A 2HTJA 2RVCA 3F8FA 1U8RA 1R5GA 2HTSA 3BP8A 2Y48A 1FC3A 4XLPF 4WXHA 2IA0A 2QZ8A 3NRVA 2STTA 3WGIA 4EGYA 5L3DA 3QPTA 4KT5C 5A2QK 5AIQA 4G6DA 1MDMB 3RTRA 3QP6A 1KYZA 3JTHA 4JBAA 4EV0A 2PFBA 4PZJA 3I0TA 3CNVA 1R1UA 4UVCA 3D0SA 3F6OA 2QBYA 3U9GA 5F1RA 2FBKA 4XSZF 1MDMA 3SXYA 2DPUA 3PQJA 2ACJA 3SFZA 2FF4A 2BEOA 5HLHA 4ZYGA 2XIGA 3F8MA 1EH7A 3GW2A 2FEZA 2XV4S 2QBYB 4YFKF 4I2OA 3E5XA 2E7XA 4M72A 4S04A 3EQLF 1YS6A 4YIIA 4P9UA 4EM1A 3DKWA 2ESHA 1IN6A 2VONA 1ZG5A 1QBJA 5ERIA 4YFXF 5JR3A 1FP2A 4KA4A 1XMAA 3I4PA 2NNNA 3SZPA 1U5TA 3KLNA 1YTYA 4GCVA 3FX3A 4G94A 4LB5A 2ELHA 3ZMUA 1TW2A 3N4MA 1HKTA 1ZAOA 1IXCA 4ESFA 2IJLA 1W4MA 4KFCA 2EA4A 1LNWA 4EMSA 1E2XA 5CVIA 4EVIA 3O3KA 2ZCWA 2J5PA 4WWCA 5L3EA 3HSRA 1RI7A 1IN8A 4M9ZA 4PCQA 4LFUA 3KP5A 2V1DA 2HQRA 3O6BB 2O03A 4RGXA 1HBXG 3M8FA 3GVAA 3AAFA 4O5VA 1TQPA 4EGZA 3ABUA 3I71A 3KEOA 1PP8F 3I64A 5JHUA 1MJ9A 1C0WA 4XRFA 2LSOA 4BYYA 3KZZA 5FLXZ 4ESBA 1L0OC 1RZ4A 5E20A 3E3VA 1XB4A 2DFIA 3ERED 3S2WA 1KQ8A 4U0WA 4DNCA 1ZRCA 5E1XA 2MA3A 2BBYA 4L9TA 3HSFA 5FD6A 2JTVA 2K4BA 1FBUA 4ENKA 3COAC
chains in the Genus database with same CATH superfamily
3MKYB 1IAWA 1X1AA 1TTYA 3X2QH 2ZFWA 3S1NJ 4L5IA 2Y0MA 4FE7A 1F43A 2W4SA 2CFXA 4NQWA 1DP3A 2LP0A 4C2TA 2K86A 2KRHA 3KEQA 2JA8J 3KP2A 1IN5A 2OGGA 3HXLA 2EINH 3DQVC 4ZTFA 4IHSA 3OYCA 3A01A 1QQIA 2D1VA 3RKXA 2H8WA 1FMWA 2ZNYA 3QYBA 4XORA 1B72A 5HNHA 3KYLA 2IGMA 2MABA 3BLYA 4PUSA 4CICA 3G2BA 5DM6F 1FBSA 1P2FA 2M30A 2V26A 4WXCA 3P5JA 1ENHA 2KPMA 2KZGA 5HLTA 2GAUA 3F8NA 1Z6RA 2D2WA 3K70D 5J47A 2VJJA 3DPUA 2L7ZA 1TQMA 5IYCJ 3F23A 3WE2A 2E5NA 4RB0A 1R4MB 2IA2A 3BR0A 1EH8A 2DA4A 2H09A 4FQGA 3H5RA 3OYMA 3H3UA 2OU2A 3GWZA 3VB2A 2Z1DA 1MNMC 2AHQA 5KK1A 3TW7A 5DD8A 2ECBA 2GLOA 5JHFA 3FXJA 1FWZA 3CCEI 3PO2J 5AIPA 4G7HF 1N78A 4X6AJ 3CCUI 3LAPA 4C30A 4YELA 1YI2I 3IAS2 5L3CA 3LWFA 3L1PA 3ZMSA 4LK0F 2VI6A 3KETA 2ZMEC 5BS6A 4XN3A 4I98B 4GYIA 1B1BA 1ZELA 2XPVA 1QGPA 1XGNA 2FQ3A 4WXDA 1FW9A 2E71A 2LF7A 2VT3A 4BQQA 2A3SA 2RN7A 3VFZA 2L7MP 1Z6TA 3IC7A 5KAIC 3S14J 4P9FA 2A6EF 1GDTA 4HNTA 2E1NA 1GV5A 2NOJB 4P1WA 2QQ9A 4CDGA 1PDNC 2Q8KA 2P6SA 2RV8A 3Q0VA 4HA8A 3DWLE 3A0HC 3MN2A 4JOMA 2A6TA 3BR3A 3HJEA 2F5FA 2XGCA 1YIJI 5BOXA 4Y33A 2DDAA 5IT9Z 1DP7P 5BMZA 3ERMA 4RGUA 3WU1B 2GA2A 1JJ8C 3DP7A 2L9VA 1A35A 5ILSA 5JVGF 1I1SA 2FA1A 3I53A 5J1UA 2DOEA 2WTEA 2F4IA 4LD5A 6PAXA 3S2DJ 4F91B 2EBIA 5H2FC 1WJBA 4AIJA 1VQPI 3TO6A 3OOUA 2BY1A 2M8GX 2AXLA 5CVJA 2KZVA 1G1BA 2FU4A 3SYTA 4HF0A 3A0BC 4EJUA 4HOBA 1EV7A 4C3HJ 4I99C 9ANTA 1VQLI 2CJJA 3I58A 2MD5A 1ETYA 2L7FP 1S3JA 3JAMZ 2BYVE 2FUG2 1W5TA 3ZR8X 2CV2A 1MJBA 4ESJA 3ABLH 2HKXA 4YIRX 2H27A 4C3JJ 3K9TA 1MMSA 2NVTJ 1OR7C 4HX4A 2TDXA 3LQRA 3ZQLA 1IN7A 3QRFF 5FFXA 3RYPA 3CD6I 3F0CA 1HSTA 3TEDA 2YX7A 3K1MA 2X1EA 3JRFA 2XUBA 2QEXI 5F08A 3T0YA 1YS7A 4M6VA 3EUAA 2MFZA 3AG1H 1QRYA 3BC8A 1OYYA 2MLGA 2VQLA 3H1CA 1ZGJA 4ENJA 3DTEA 1IGNA 3CUOA 1Z21A 4BJ6C 3FF5A 3CUQC 3FXUA 1JKRC 1SEUA 5HOOA 4Y52J 4FHTA 1U5TB 1K78A 3A1YA 4ON0A 1AA7A 2ZC2A 1X3ZB 1W5CC 4LK1F 3WHCA 4DOZA 2EV0A 3WG9A 2EZLA 3OMYA 1YG2A 1WJ5A 1UG2A 3TW6A 1TWFJ 3BCBA 2ZJPF 2ZJRF 3M7GA 3BTLA 4A3GJ 1U78A 5IT3A 2A68F 3PSIA 5HDKA 5F04A 4M3BA 1TNTA 2A61A 2DI3A 4OAZA 1BC8C 4CZZA 2HFHA 3BQYA 3EDPA 2ZBKA 2IS2A 4MNUA 4MO7A 1PUEE 1ZRFA 5K5RA 2ID3A 2IPQX 1Z3YA 1YOVB 1DGWY 4IJAA 2DAOA 2DK8A 1ZR4A 3SDGA 2P7VB 4M6XA 3OYBA 4HX7A 4V2GA 5J8CA 1IUFA 2LRDA 1FPQA 4RM3A 5D4SA 1G3SA 2Z3YA 3HSEA 3H9GA 4PFOA 4MEYF 1BL0A 2LF8A 1U2WA 3VODA 4LMYA 4F55A 2VBZA 5CVUA 4K2EA 1LEBA 3PNTA 4E7SA 2X85A 3CLOA 4LOCA 1ON1A 2A69F 1LQ1A 2Y0SN 2H1LA 3GEZA 4HNUA 2VE8A 1HA8A 2OF7A 3EETA 4CCNA 3VDXA 3WU0A 1UMQA 1D8KA 4CCJA 1K61A 1NHAA 2VKDA 2NNYA 1AU7A 2E5ZA 1OCTC 2XGEA 1H9TA 1WQ2A 2RQQA 3HYIA 1STZA 3M1EA 1N77A 2Y31A 4BUPA 1QVUA 3PM1A 4GFBA 5GADJ 1K4SA 2IBDA 1TT8A 1DPRA 2K02A 1RKTA 4FX0A 1SD6A 1WJAA 3VYSB 2KIMA 1HW5A 3TBIA 3ZQIA 1JGGA 1U0JA 1ZRDA 1KU2A 3OV8A 1XSXA 1OR7A 5TISC 1EJ9A 2MH2A 1R9TJ 2EZIA 4OIQF 5LEJA 3T8TA 3JAMK 4I09A 1IXRC 3VYUB 2VOOA 1K7AA 4Y4RA 2HDWA 2YS9A 1ZLJA 1XX5A 2ETHA 1FYKA 1B6AA 4B4CA 1HOMA 3GFIA 4IHWA 2EQRA 2W48A 4NC7A 3J7AO 3DLLF 1P9QC 1OFCX 1YE9A 3L7WA 3B6CA 2XRNA 2Z16A 4Z2YA 3QPHA 2XROA 3ZQ7A 4BBRJ 3K2ZA 4PSXA 1T98A 2XASA 2GXGA 2L4AA 2LREA 3K1PA 2R7UA 3F6VA 1G2HA 2E60A 2YX4A 2K7LA 2RREA 2GQQA 3TDUC 3FK6A 3OSFA 4BY7J 2CMPA 3RYRA 5E3MA 2QA4I 1WJCA 5E1ZB 1KQ9A 1ZGAA 4I7HA 3WU2C 1W5SA 2RA5A 2FBIA 1XPXA 4XICA 3KYDB 5FLMJ 2PKHA 1BA5A 1NTCA 3D5SC 2OC6A 5BQTA 3JRBA 2DJNA 3LNQA 5ILUA 1E3PA 3S1QJ 4HX8A 2AHCA 2LKXA 3IH2A 4Y13A 1Z77A 4BACA 3K4JA 5K7FA 3O8GA 1DDNA 2MW8A 3LAJA 3GO5A 2WADA 5IP7J 2VL8A 4LGWA 3MKWB 3DU6A 4AVPA 3BG9A 4E70A 1F5TA 4G8XA 2JT1A 2DLLA 1BJAA 4A2UA 2M9HA 2BY0A 5EEAA 1U3EM 3HGYA 5DUKA 3MKLA 1VQOI 1QHGA 2O0YA 2P5VA 2P81A 3WTTC 3QYFA 2RNGA 3P9CA 4J00A 4UV9A 5LD2C 1K6YA 2KDOA 3L2WA 2IVMA 1FYLA 1ACIA 1TLHB 5HDGA 2EFOA 1WHUA 2EA2A 3O2PE 3CF5F 3OL3A 1DU6A 4XK4A 3RZOJ 2HXOA 1LE8A 2R7FA 1YQAA 4LLNA 2ADUA 3CJNA 1BJZA 1YHQI 2KIUA 1N75A 3I59A 4XQFA 2P8TA 1PUFA 2GM4A 5J8FA 2CV0A 1U8BA 2A6HF 2JUGA 1R71A 3K2AA 5EGOB 1VQ5I 1BI2A 1NG6A 5H6QA 5A2QZ 4D7MA 3H3ZA 1HW2A 2ZMEB 4BE2A 2DK5A 3DPTA 3CLQA 3TDZC 4ASNA 4E7KA 2LBFA 2VODA 3JRIA 2M7BA 2QGUA 4A93J 2GZWA 3HZJA 2CQ7A 1KGSA 2VC0A 3TO7A 1V3FA 1G59A 4ZH4F 3C18A 1VQKI 1Z67A 4ZJZA 4XKWA 4XOTA 3ECHA 4L9NA 3OYFA 1ZG1A 1DPUA 2RQPA 1FSEA 1OCOH 2HOSA 3RI4A 3J80Z 2B0LA 3LFUA 1IN4A 5DEQA 3KE2A 1Y1WJ 3TGNA 3HRTA 1LEAA 2E7WA 4C3IJ 4X1EA 2HGCA 5JVTA 1S9HA 2HNHA 3GZ5A 1ETXA 3OR2C 1VQ9I 3CO7C 1I50J 1DUXC 3W2WA 4ETSA 3K4CA 4F7ZA 3H35A 2DT6A 1J75A 3K4MA 2XF5A 3GTJJ 3WTUC 4BE1A 4P96A 2BGCA 1H0MA 2XKPA 1ON2A 3DEWA 3NQOA 5FKNA 2UXNA 3B02A 3LSMA 4IXAA 2X0LA 1A04A 1GVJA 3V7SA 4ENNA 3E6MA 1YITI 1WSUA 2UZKA 1HDDC 2R7TA 3HFIA 1AKHA 1AOYA 2M5WA 4UB6C 3KPHA 3IH3A 5EEGA 4JX5A 4MQVA 3ZQCA 3WTZA 5K5OA 4QIWN 2I5UA 1HLVA 4KN7X 1FZPB 3MEXA 2JPBA 1XCVA 2H94A 4G9YA 3RKQA 2WB1N 4PK4A 3RQIA 2R7QA 3WTYC 1CF7B 3W2VA 1YFHA 4BJ5C 4CYDA 4IQ4A 3ZN1A 3K4BA 3PNVA 2HPMA 1YIOA 4ZDLA 1TQIA 1R36A 1MH4A 2ZNZA 2LY1A 2CW8A 1WFXA 3KZYA 5C4JJ 1VFCA 2QM3A 4U0YA 3OYLA 1BI3A 1P92A 5IY5H 2QYOA 3K4NA 2F2EA 2HPIA 4IOCF 2HVSA 4OMZA 2LYCA 5IOZA 1OYIA 4HSRA 2MD0A 2V79A 2X6WA 3BG5A 3SEZA 2EILH 2X9DA 3ABTA 3ZQHA 4DGWB 1T33A 2M8EA 2E1MB 3BROA 3BZCA 2QUFA 4P55A 3ZGKA 4BBSJ 4ZSKA 1W0TA 1J5YA 2KRFA 1F9NA 1MW7A 1GT0C 5E3OA 3GFMA 5AONA 1YX3A 2DMUA 1TT0A 1WZ2A 1Y8RB 4NBQA 3SFIA 4UHTA 4A6EA 2P0WA 3J7ZI 5LHGA 2ZMEA 4S0HB 1MKMA 4DJAA 4AC0A 3NARA 4O3MA 3PFYA 3ABKH 1SFOJ 4A0ZA 4AIKA 5ED4A 2G9WA 5E8IA 5FD5A 5CLSA 5LBQA 4B09A 3WGHA 2K85A 2QQBA 3TO9A 4CZCA 1MGTA 2MC4A 3MQ0A 2UUZA 3OWTA 4BQNA 4DW6A 1R49A 1TNSA 3TOAA 5DV5A 1IG7A 4TV7A 2JQ7A 2EIJH 1O3RA 1WJFA 2MG4A 1F1ZA 3NEUA 1IRFA 1FY7A 2HOEA 1AKHB 5J6XA 4QPQA 1RPWA 3V8JA 1BN5A 2COMA 5E8GA 3P9IA 3E5UA 4IQJA 5HS9A 4A12A 2L02A 3G1LA 1XMXA 1RNLA 2EFWA 2HR3A 4A3EJ 1MBEA 3V7RA 1OCPA 4DBRA 4D0PA 4IRIA 3AL0B 3HEFA 3CQZJ 1X58A 1E3OC 1SC7A 2CQQA 3HOWJ 4I76A 2E2HJ 5DD4A 2CH0A 3HTUA 1Z05A 1G4DA 2Z5UA 4M6YA 4WX9A 3U2RA 1T8IA 2KDZA 4NQWB 5F64A 1MSFC 4CCKA 3W2AA 3FISA 2F5EA 5EGOA 1I1GA 3GCMA 3MCZA 1XGOA 2YSRA 1VQ8I 2HYGD 3K1NA 2DDBA 4BAYA 4AWXB 4M3DA 1XLRA 1VNDA 2VBXA 3E6DA 5FO5A 1D1CA 2IAIA 2ZKZA 3L2VA 1JT0A 3M9AA 2IS6A 4ZSBA 3CF2A 4KYWA 3S32A 3FZVA 1EKEA 2GOXB 3DBRB 4CGZA 1I6HJ 4BY1J 2XAUA 1Y0UA 4RB1A 4U0VA 2O6GE 3BTIA 3BT9A 3L2CA 3RZDJ 3I4MJ 4ZZLA 4A3KJ 3HHHA 2E1CA 3ROUA 3L2QA 1KQ0A 1X1CA 4EJWA 1ZGWA 4RAFA 3ELKA 2W57A 3HG9A 2X4HA 3W6KB 2L9RA 4LLGF 5B66C 1H8AC 5DM7F 2HEOA 1QVTA 1RUNA 2XVCA 3FXQA 3HGGA 2XC7A 4MGRA 1HXDA 1A6QA 2M34A 5LLQA 2CO5A 2X6XA 2AQFA 3JRAA 2PEXA 1USSA 1QA6A 1FOWA 1FIAA 3CZ6A 4E7JA 3K10A 3DBHB 4ZYHA 2DMTA 2DN0A 1A5JA 2QVOA 1USTA 3H92A 3S16J 2DA5A 3ZOBA 4KDPA 4IL6C 1MJAA 4NB5A 3G4SI 2E2IJ 3GTLJ 2OQRA 3EYYA 4DIQA 1PVEA 3H0DA 4S05A 2GOMA 3M4OJ 2HVQA 3E0JB 2YU3A 1LUJB 3B6AA 1U6GA 4KJZA 3S3MA 3JRGA 3QAHA 3GTOJ 1YLFA 4GDFA 2F5VA 5IT9K 1V55H 2EIKH 3CP2A 2QQ8A 5GP9A 2ME6A 4ZYEA 2L54A 2PMZN 5M5YJ 4NNJA 1JKQC 3GLXA 3KP4A 1J09A 3I59B 4XN0A 2DQRA 1UAAA 2NVUB 1ZKGA 2YR2A 3GFLA 2Z33A 1WWXA 1I3AA 4UVBA 3DKYA 4EM2A 4Y15A 5DDGA 4Q47A 1OISA 1QZZA 3CDHA 3DTKA 4Q48A 4R1HA 5HLIA 2DPDA 2VJ4A 4DZJA 4MFEA 4XBFA 1KU9A 3HOZJ 4L0YB 4B1RA 4MEXF 1D5YA 1OCRH 2W85A 4PJLA 4FT8A 3SZGA 2GIVA 1UELB 3CESA 4NUBA 1B8IB 3TOBA 2D45A 1NH3A 4BGDA 2RDPA 3K69A 2WC2A 4KT6A 1S7OA 1KZHA 4V19K 5LRRA 1TBXA 1TWCJ 4G7OF 4P5OA 3BOQA 3HHGA 2VXDA 4HLYA 4IX7A 2R7RA 2K9LA 4HDVA 1L3LA 4DYRA 3RDIA 2VJ5A 1FYMA 3OYNA 2F48A 1SAXA 1RR7A 4PJMA 2OOIA 1X1PA 3U21A 3GBGA 4XRSG 3LSKA 1DQUA 1BC7C 1JD3A 1RIOH 2E19A 2JPCA 1JGSA 1ORKA 4IPAA 3IKTA 5L3FA 2EFQA 3GUDA 4RAZA 2H6BA 2O7OA 4UNOA 1HDPA 2HQ5A 2L01A 1N25A 2RKHA 3C1DA 1XTAA 4UUSA 2IGNA 3S15J 3H3VK 4RS8A 2OBPA 3KP7A 4CA0A 4N4OB 1BOAA 3BTCA 3OOPA 3P9KA 3LA2A 1A36A 5EEHA 2PI0A 1ITYA 1R1TA 2KFDA 1YRNB 3NAUA 4HEA2 2HS5A 1LVAA 2VASA 2OV7A 3DCFA 3GTPJ 1R5ID 2NVYJ 3OYDA 3PSFA 1ETQA 2DBBA 2VJIA 4G12A 5KVRA 2XAFA 4HV6A 3ZQQA 2GXBA 2DYSH 2ZXJA 1IRGA 5H20A 4YEJA 1MMGA 5HS8A 3C2BA 3HOSA 4QWQA 3BTJA 2O61A 3C2HA 4M73A 3E7LA 2CUJA 1JTYA 4HDUA 4OAYA 4A0XA 3S1MJ 3ZMZA 2IGKA 5LHIA 2V1XA 2MBFA 5KCMA 4OIOF 3LSJA 1PYVA 2PG4A 4CUGA 1GLNA 2OJED 2MC3A 4KUMA 1XSVA 2CQNA 5DCMB 2JA7J 5HLGA 4LIUA 3LOCA 2NVQJ 3ZCOA 1Z7UA 3BG6A 1UZCA 5FGMA 2KP6A 1BI1A 2NS8A 4KISA 4RGSA 2IEKA 5IYDJ 3V8LA 3HUGA 1XD7A 1SFUA 5K7HA 4HLXA 3Q9SA 5M5XJ 1OPCA 2QLZA 1WGXA 3CJTB 3GFJA 5EZGA 1KA8A 2DOAA 1S29A 2LH9A 3BZ6A 1O7FA 2XAGA 3GX4X 4M71A 4L9VA 1QHHD 3SHFA 1Q1HA 3RCOA 3JRHA 4IZZA 5D8LB 1YO5C 1JUMA 1Z9CA 3OYGA 3L2UA 1MBFA 2HYJA 2R7WA 1WH7A 5H6RA 4ZYDA 2CV1A 5D5XB 1VQNI 3LL7A 1T95A 2R5ZA 3M8JA 3DPLC 3IV5A 2EV6A 1U5TC 3JRDA 1MMNA 4XKVA 1MZBA 3HRUA 2XSJC 3E6BA 1K83J 4UY8I 4F3QA 4RB3C 2HDCA 3MWMA 5IYBJ 4AU7A 2XGDA 3C2GA 3LSIA 1NK3P 2LY2A 1ODDA 3OSGA 1LDDA 1S8NA 1XGMA 2XRLA 4G6TB 4GXOA 5CYVA 2DXIA 2DU9A 3SEQA 1TWHJ 1APLC 1D5VA 4RLQA 5CVRA 2CUFA 3OS1A 2QSGX 1LKXA 1W7PB 3TL4X 1OCCH 3DKXA 1B4AA 4XKCA 4XLEA 4BXUA 4D5CA 3S3NA 3CTAA 2VKVA 2EK5A 1WJEA 5F0HA 5FRMA 2R93J 3LQQA 4I0AA 2DO7A 2HOTA 4B3AA 2PMHA 1IZ1A 3ZMVA 5K1YA 3WTVC 2XPUA 3CJQB 1P4WA 1WRJA 4KMUX 3C7JA 5IOYA 3HOXJ 4I01A 3CJRB 2VQCA 4KIFA 2LMDA 2VXZA 1HKSA 1TWGJ 2RGVA 1QO0D 4ABZA 1FBQA 4KIGA 3MMYB 2W84A 5J4VA 1R7JA 2L7KA 2XAHA 4CCOA 4EJOA 2BW3A 2R7VA 2ISZA 5CJ9A 2K4JA 2PQ8A 4UV8A 4BU2A 3IH4A 4GO1A 1JI8A 1T6SA 2IA1A 3U1DA 2G0EA 2XDVA 5CKTA 4MIMA 4EJTA 1MNDA 2OD5A 1AHDP 1FJLA 4FETA 3W6JB 2LKPA 1J9IA 5JFRA 2N8GA 4IRGA 3Q3SA 3RKWA 1RETA 3KLOA 2TRTA 4MTEA 5J40A 3PJRA 2DOFA 3QYEA 4BHPA 4JYKA 4WF2A 4KNYA 1D0XA 2IT0A 2GWRA 1P7JA 2W00A 2Y2ZA 1UHMA 3A4CA 4A3IJ 5D5UB 3CC4I 1D3YA 4AUXA 1B72B 1S6LA 3OIPA 4CSWA 2KMUA 2DYRH 3NWSA 1QZYA 5B1AH 4PGHA 3UR3C 2IKKA 2V9KA 2A5YB 2ZSIB 1D1BA 3ABMH 3L00A 4YRVA 2ZSHB 4J01A 2RNJA 3L5ZA 3E1SA 2CUZA 4IHYA 3AL0C 3FM5A 1SANA 1OQYA 2CRGA 1SMYF 2JWTA 4L5JA 3VYTB 2R5YB 3S1RJ 2HWVA 2OAZA 2K3FA 2HU9A 3QQAA 1K79A 3HC7A 5GTHC 4KIBA 2A07F 1SVMA 2LY9A 1X2NA 2V1NA 4IHXA 3HUGB 1HCRA 4YFNF 1ZYRF 2NWIA 2Q2EB 4OU0A 4R8HA 4DQ2A 4LLLA 4XMYA 3LMMA 1TP4A 3ULQB 4A3DJ 1Y0NA 1U9NA 4YG2F 4M74A 2F5CA 2AXTC 1WJDA 4IHTA 3PL8A 2KJBA 3UNGC 1MIJA 1R22A 3LA3A 2OCCH 2DODA 5D6FA 5KNLA 3EYIA 3CUQA 3WE3A 1ZARA 4WCGA 2O3FA 3RJPA 3QU6A 4BKXA 2FNPA 3K70C 4RAGA 3RKYA 5EDNA 2ID6A 1QPIA 4X0GA 2VBYA 1XSDA 3VSKA 2H8RA 3W3CA 3BPVA 2FA5A 3OYJA 2B63J 1MNEA 1VTNC 2EZHA 3I4NJ 2E1MC 2JZYA 1QPMA 1BBYA 4JP0A 4AVZA 5IP6A 2FX0A 4RM2A 5F0FA 1ZR2A 2RAEA 3K6GA 1IUYA 3HOVJ 1YW9A 4A6DA 3ZPLA 1I39A 5IP9J 3FBNB 3G73A 2ZB9A 4NC8A 1UJ8A 3IRRA 2WY7Q 2DFHA 4EATA 1LFUP 3K4KA 2WWYA 1BIAA 4ZDOA 1T0FC 5D5VB 2M87A 3K4LA 2YUSA 1F4KA 2EH3A 5FROA 3HPHA 4E7IA 3MVPA 2FMYA 3MZYA 4XRSA 2KIFA 4HAMA 1A6IA 1R58A 2BVMA 4Y7NJ 2PJRB 3GZ6A 2WAEA 3B73A 3G3ZA 2X6OA 4GRIA 3FMSA 3R0AA 4F93B 4QLCU 3CO6C 2Q2EA 3BJAA 4I0BA 2E36A 1ZQ3P 2R0QC 2ECCA 3M07A 5TGTA 4HW0A 1W7PD 3OL4A 1UB9A 2WV0A 4XLAA 5BPDA 2LK2A 1CF7A 5CPRB 2LD5A 1FOKA 1MD0A 3GTKJ 3ZN0A 3BZKA 1JUSA 2FE3A 2W82A 2NRAC 3R6SA 2QSFX 2AO9A 5E3LA 2QQAA 3P7NA 4A3JJ 4II3A 1EF4A 1X1DA 1Z7LA 3I54A 4V2FA 5D5WB 2E1OA 3DU5A 5DCFA 3JSOA 4ANJA 1JHFA 3F22A 3G71I 2NAZA 3ECOA 3FXOA 3JRCA 1V4RA 3ML6A 3GLLA 3KP3A 3HRMA 2WY8Q 4HV5A 1WI9A 3IL2A 2VC1A 2CG4A 1Z3XA 2WAQN 1HC8A 1E0EA 4MFDA 2P4WA 2BY3A 3OIOA 3S8PA 4E4HA 5TRDA 1LPQA 4XL9A 2M45A 1W7PA 1YJ9I 3FXRA 1LJ9A 4HRIA 1P4AA 2HOAA 3J81K 4IOAF 1UG0A 3GF2A 1O4XA 1J0RA 5KHDA 1S7EA 1IRZA 4CHUA 5E17F 1TWAJ 3KFWX 3BPXA 3Q0WA 1BI0A 3QOPA 3R61A 4ZC3A 1GHCA 2CW0F 1GXPA 2AQEA 1SD7A 3BR1A 3OY9A 2CWEA 5E18F 4W1UA 5CVVA 2QENA 2JVHA 3SZTA 2VKEA 2L9NA 1BW5A 3HM5A 4CYCB 1LVKA 4M3GA 5FKMA 3HOUJ 1XCBA 1RR8C 1D8JA 2F5DA 3EUKL 4BNCA 4B48A 4ZTJA 4HF2A 2FD5A 3DEEA 1XMKA 1JTXA 4XOPA 1PP7U 1B9NA 5JLXA 1D0ZA 2XF6A 3H36A 3HL2A 1T08B 2JSCA 2H1KA 2KQRA 2VQHA 4UXNA 3ZXSA 2R92J 2CYYA 2FXAA 1S7AA 1QZEA 2R7DA 2K9SA 1FP1D 1P4XA 1I5ZA 4KMFA 5GAHJ 2DFEA 4O6JA 4BEHB 4LG0A 4D9JA 1KU7A 4UUTA 2YU9J 3KP6A 2LDUA 1TZLA 1O57A 2F4MB 4E7ZA 5TJJA 4N9HA 4IVNA 4MQ9F 4BDZA 4RA2A 1ETKA 3FIWA 5K5QA 2EPFA 4PGGA 1YJNI 2BHYA 2RC4A 5ICEA 1FSHA 4XONA 4RBOA 4U87A 3D5LA 4JX6A 4PFPA 5LEKA 3HB9A 2M1BA 2W1OA 4HNVA 2JA5J 2V4JC 3FM3A 5EG0B 1G6NA 2WAFA 3DEUA 2Y0SA 1WPKA 1G81A 5F0CA 3TP3A 3MZ8A 4ZDPA 5FKOA 4LG0B 4OIRF 1DU0A 2BOLA 3K7AJ 1R23A 4CO8A 5F1JA 2V7FA 3FXMA 4Y17A 2STWA 2BV6A 1IC8A 1JJ6C 3H0GJ 5E1WA 2OUMA 2ZO4A 3E97A 1SMTA 2HKOA 3MFKA 3T1BA 2VIXA 5LGNA 1LE8B 5C4XJ 4Q4ZF 5DCMA 1X4PA 4UVAA 1YJWI 1S5LC 3PNYA 1VQ7I 2QWWA 2XB0X 5L3GA 1R00A 2HYFA 2Y69H 4IHVA 4L0ZB 5HDNA 3WGGA 1TC3C 1J7KA 3BJ6A 3R60A 2W25A 4KN4X 1SVOA 3ASOH 3FKJA 3N97A 2L4MA 4JK1X 1J59A 3CCYA 2BE5F 1GVDA 2IS4A 2BY2A 2XHKA 4E7HA 1P7IA 1ULYA 3PO3J 1G8XA 5C44J 3QWLA 2KL4A 1SD5A 3GZNB 1DGRM 4N4NB 4MHGA 4BXFA 2MLKA 2F4OB 2L3DA 1HW1A 2VN2A 3ONQA 2XPWA 1W36C 3LSTA 2O5RA 3TKYA 4HQEA 1H88C 1KONA 2PMUA 1SD4A 2CSOA 3G1MA 3I5UA 3PUBA 5J1YA 3CCRI 1WKMA 3L9FA 1KYWA 4AM3A 3TQNA 1RUOA 2OA4A 1HKQA 1MBKA 3BR5A 4MTDA 2ZFUA 4RAYA 3BDDA 1JXSA 2HZTA 1QNTA 1MBGA 2R7XA 4NDLA 5B5EC 1P6RA 2GA1A 2R5YA 2CQXA 4ITVA 5LGTA 3KCCA 2LR8A 3DDVA 4FISA 5ILVA 5DS9A 2NXNB 1CGPA 2NYXA 4HQMA 3RQ4A 2ICWG 2R7SA 3DFGA 3IWZA 4C9YA 3QU3A 3F8CA 2Z9OA 3MKZA 3FMRA 1T0FA 3HTSB 3BR6A 1G3WA 1BW6A 4BQOA 2Z99A 4CYCA 2NS7A 4GGGA 1BM9A 4A0YA 5GPAA 3PIOF 5B3SH 1OKRA 2Z2SB 1YYVA 3N05A 4BEHA 3A2KA 2L9SA 5M3FJ 5BPIA 3V7CA 1JUPA 2JJ7A 4U7DA 2MSYA 1I6XA 4XSXF 5EZHA 1IF1A 2I8DA 3HPGA 4PJJA 3CCLI 2MH9A 2WB1A 3I56I 3R0JA 4LG3A 4OOIA 4NHJA 4WK8F 3FDYA 1MSEC 5GPCA 3ZMTA 3EUHC 3RPUD 2JUCA 2R3SA 3FMQA 3REOA 3CMYA 3IAM2 3HOTA 4LITA 3PQKA 3K0LA 1IW7F 2ZXIA 3JTGA 2HXIA 1O3QA 3DF8A 3ASNH 5K7ZA 1D1AA 4UUVA 2GBYA 1D0YA 3MD2A 3ZP5A 2XKOA 2D1HA 2FQ4A 3V4GA 2FOWA 4C2MJ 1CQTA 2M0CA 5FRNA 4RMNA 3IWFA 1HF0A 3VYRB 4CH7A 1ZH5A 2JSPA 1LFBA 4FX4A 5LGUA 2G7HA 3EUHA 1EH6A 3L09A 2XAJA 4A5MA 3WG7H 1GUUA 1TT5B 2QKLB 2JN6A 4PJNA 1V5EA 3QP5A 1ZLKA 1I27A 4RLFA 4MLOA 3ZQGA 3H9QA 3CCSI 4XLNF 1XGSA 1FEXA 1JHHA 3H5NA 3M1CA 1FX7A 2O9LA 2LNBA 4QPOA 5D6EA 5GAEJ 5D8KB 2DFFA 1R6RA 3RIRA 4CXFA 4B43A 4XRMA 4E7LA 4HZFA 1YX5A 3CUQB 2M4KA 1VF9A 2ESNA 3CDLA 5E3NA 2HZDA 5HS7A 2M7AA 4LB6B 3GTGJ 3H5AA 1XG1A 3MAJA 4M9XA 5EYRA 3H9JA 2V1UA 2XGXA 1LB2A 2KIQA 5LFAA 2K5CA 2NS0A 3LFKA 2JVGA 2OZ6A 2PLYA 4EQQA 3RPUA 3QPSA 2P5KA 5C3EJ 1Y8QB 3F3XA 1ZHFA 3LA7A 1T56A 3I55I 4BL0B 3CCVI 1ZREA 1E17A 1I3QJ 4JQFA 4KICA 3VEPA 4IEJA 2PX9A 2KT0A 4ZSIA 3G1OA 1ETOA 3RPQA 3J81Z 2AS5F 2EFPA 2HVRA 1Z1DA 1XDUA 1K78B 1G3TA 1SFEA 2P7CB 3WTWC 2XF7A 2V6CA 5JLWA 1K4TA 2PJPA 2COBA 3M3YJ 1Z91A 3BWGA 3LSPA 1BIBA 1G3YA 3KYCB 1IDZA 1TW3A 4RGRA 4FCYA 1VQ4I 4HSTA 2FSWA 5J1RA 3J7YJ 3E5QA 4IF4A 4HBLA 3FK7A 3GYHX 1FOYA 2KHMA 1REPC 1LFPA 2PBIA 1MBHA 1PJRA 2O8XA 1T38A 4RDUA 1R5HA 4EJVA 2D5VA 3DXJF 2VT2A 3Q9VA 2HI3A 1T39A 2IRFG 4M3FA 3CCQI 1V5GA 3FWEA 2O8KA 3PUFA 3PIPF 4PDKA 2L5QA 2Q0OA 1H9GA 3FKIJ 3IP4B 2DMQA 2JRTA 3E6CC 2EWNA 2YPRA 2CQKA 3S2HJ 3BY6A 4M3EA 3JSPA 4I02A 4CCLA 4BQAA 5FLVA 4AD9A 2R7ZJ 1LDKB 1UFMA 1ETVA 3ISPA 4GYGA 2H6CA 4W97A 1FLIA 2OCEA 1BOBA 4LIVA 5ICFA 1IJWC 1X1BA 2JA6J 3HRSA 1WVRA 2J5OA 2B7EA 2Y9YA 1WH5A 2CUEA 4ZZDA 3BR2A 2X6YA 2A5WA 3AKZA 3JCUC 1IRXA 2X1CA 1HSJA 4UB8C 2BW3B 3IRQA 2R7OA 2DA2A 4IRHA 1XS9A 1OLTA 5DUIA 2OQGA 3F9KA 2W24A 5FFZA 1UHSA 4HYEA 4RB2C 3LHEA 2B9SA 2CGPA 1V54H 2LC2A 2K9MA 2VE9A 3DV8A 2FBHA 4G6QA 3HOYJ 2DT7B 3D5RC 1O3TA 1ZG3A 2EJRA 2MGQA 3JW4A 1V5FA 3ESWB 3OIQA 2ZJQF 4U7BA 5HODA 1FNNA 3LSRA 4BE0A 5L3BA 3IKVA 3RSNA 3J80K 4OIPF 4L9JA 2CS3A 1AWCA 3Q5FA 1F36A 2KKOA 4F92B 1SFKA 3S17J 4HG2A 1BR1A 3VSLA 2V6EA 4E6KG 1OCZH 5ICCA 4U88A 4PJ0C 1FTTA 3ZQFA 1XN7A 3OYKA 2OZUA 2K9NA 3BQZA 3NWTA 3OYEA 2HQAA 1ONVA 4OWRB 3BJOA 1Q1VA 5JI6A 4NC6A 2IGOA 2JRMA 5LRSA 3WODF 3KX2A 1OYWA 5FB2A 2VUMJ 3GTMJ 2TCTA 2DA1A 3KIOA 4AYBA 4H0EA 4Q5SF 5FLXK 1ERDA 2X51A 1B9MA 4OINF 2EV5A 5F6FA 4ENMA 5J3LA 1HQCA 1X2MA 2QF7A 2JMWA 3VOEA 2DW4A 3DBLB 4EEFG 4F52A 1GXQA 2DTRA 3F8LA 2VPLA 5B1BH 2Y75A 3IUOA 4BDYA 1OMIA 2LLKA 1MBJA 3HIFA 1KU3A 2P6TA 1YW8A 2FOKA 3A01B 1W36D 3T5XA 4BHBA 1R1VA 2C6YA 1FT9A 1O3SA 1IV8A 3C3WA 4A5NA 2PJRA 2ISYA 2ZXWH 2OPTA 1XDSA 1UHWA 3EPZA 2EZKA 3PFIA 3OYHA 3L2RA 2ZXHA 4OMYA 5D4RA 1MH3A 4DYCA 2IW5A 4B3XA 2DT5A 4J19A 1A31A 1X3UA 2G7UA 1SFXA 4AYBN 1YW7A 4L18B 4BHCA 2X48A 1RKWA 3MZHA 2VLAA 2EB7A 1T2KA 1ZN2A 2KRCA 4QSHA 2UWMA 5HVQC 5ICGA 4IKFA 2M2EA 4BH9A 3M8EA 2HQNA 1FTZA 4FE4A 2EIMH 2FRHA 3F72A 3TP0A 3FHZA 1ETWA 5EJCA 2KLOA 1XC5A 2IP2A 2P19A 3HBLA 1W1WE 1FIPA 4N0BA 2V9PA 2OTJI 1LDJA 1VI0A 3D1NI 4B8XA 3V42A 2KJCA 4LJZF 2K27A 3DTIA 2R4GA 3WTSC 1B8IA 2WA0A 4HF1A 2XAQA 3T8RA 3CDIA 2XSDC 2DQLA 5CQEA 3F8BA 2V9VA 5DYMA 2P5LC 4G7ZF 1FMVA 3F21A 1O7LA 4R79A 3GXOA 2ME0A 1JE8A 2E2JJ 1POGA 2NVXJ 1UCRA 2LOOA 2FNAA 4N9IA 1B59A 2A05A 3V8KA 5LHHA 3WTXC 5IPAA 1J2XA 3SQNA 1U9OA 1Y39A 3QPLA 2VQGA 4XLHA 3CMAI 5E79C 2FMLA 2Y30A 1IXSB 1JT6A 2Q1ZB 2DA7A 2PN6A 3ZMDA 4M9SA 3IHUA 2VOPA 3FXLA 4EM0B 3UKGA 2UXXA 1S72I 3R4KA 4YIFA 3AFHA 2EFNA 2BHZA 2VBWA 2CW7A 4AIHA 4UUSB 2ZJ2A 4A3FJ 1K6OA 2HTJA 2RVCA 1PUFB 3F8FA 1MMDA 1U8RA 4QTRA 1ZTRA 1R5GA 2HTSA 1GV2A 2Y48A 3BP8A 1QU3A 1FC3A 4XLPF 4WXHA 2LKSA 5KAFC 2IA0A 2QZ8A 1BR2A 3NRVA 3HKZN 5GTIC 4I6ZA 2W7NA 2STTA 2M0MA 3LSHA 3WGIA 4EGYA 3OYIA 4IO9F 3QOEA 4A3LJ 3BG3A 3JREA 5L3DA 1X4OA 3QPTA 2DA6A 4KT5C 5HNFA 4BXXJ 2K3PA 1FOXA 5A2QK 4B47A 1RRJA 5AIQA 2K9QA 2BXYA 2DA3A 2VPRA 4G6DA 3CP8A 3RTRA 1MDMB 3QP6A 1KYZA 2NOGA 3JTHA 1IO2A 3KZIC 5EG0A 4JBAA 4EV0A 1E3HA 2PFBA 4JX4A 4PZJA 3SJMA 3I0TA 3CNVA 4A3BJ 1R1UA 4UVCA 1BR4A 3D0SA 2LVSA 3F6OA 2QBYA 3U9GA 1VQMI 1Y1VJ 2FBKA 4XSZF 4BJTA 4PSWA 5F1RA 2IXSA 5M3MJ 2X1DA 2R5ZB 2L0KA 1MDMA 2BXZA 3SXYA 2GIZA 2DPUA 4Z6YA 3I9V2 3PQJA 4XIDA 2ACJA 3SFZA 2FF4A 4AIDA 2ELJA 2BEOA 3CC7I 5HLHA 1Z0XA 3VPRA 4ZYGA 2XIGA 3Q0UA 3F8MA 1EH7A 3GW2A 1W0UA 2HDDA 2FEZA 2XV4S 2QBYB 4YFKF 4CCMA 2QKMB 5FJ8J 4I2OA 1SVLA 5M5WJ 3TMOA 3E5XA 3CCMI 2E7XA 3OS0A 2QSHX 4A3MJ 4DBQA 5BNGA 4M72A 2L2OA 3OR1C 2MYSA 4S04A 3SDBA 2CFOA 3EQLF 1YS6A 4YIIA 3HDDA 3KEYA 4P9UA 4A69C 4EM1A 3DKWA 2ESHA 1IN6A 4XM3A 2VONA 3A02A 4D5FA 1ZG5A 1QBJA 3A03A 5ERIA 4DYQA 3AG3H 3AG2H 4YFXF 1SAUA 2BZTA 5F27A 1ZK8A 5JR3A 3S93A 5DTDA 1FP2A 1WI3A 1XMAA 2E34A 3I4PA 4KA4A 3FHNA 4A3CJ 1Y56A 3OS2A 1H89C 2NNNA 3FBIB 2DTZA 3HKZA 3BCAA 2XB5A 3SZPA 1U5TA 3KLNA 2VKHA 1YTYA 1VZ0A 4FASD 4GCVA 5EF6A 3FX3A 4G94A 4FTHA 1OJLA 4LB5A 2ELHA 4KITB 3ZMUA 4C2UA 1TW2A 4II2A 3N4MA 1ZAOA 1HKTA 1IXCA 4ESFA 2IJLA 1JKPC 1WCMJ 2DMPA 1W4MA 2JA2A 1Y6IA 1YRNA 4KFCA 2EA4A 1LNWA 4EMSA 1E2XA 5FKLA 5CVIA 4EVIA 2E35A 3O3KA 1IDYA 4DZPA 1JKOC 2ELKA 4ZYAA 1RC9A 2ZCWA 3WHBA 2J5PA 4WWCA 3CC2I 2M3AA 3HSRA 1RI7A 5L3EA 3GMEA 5CQGA 1IN8A 4HPQA 3AG4H 4M9ZA 2Y9ZA 4PCQA 4LFUA 4D1QA 2K40A 3KP5A 2QCOA 3I3LA 1NG7A 5FKKA 3QODA 3BG7A 1X19A 3OYAA 5J4YA 2V1DA 3G6EI 1NK2P 2HQRA 3O6BB 2FJ1A 3CMMA 2O03A 4RGXA 1HBXG 2UV1A 3GVAA 3M8FA 3AAFA 3DLAA 4O5VA 2KISA 3U1KA 5GAGJ 1TQPA 4EGZA 1RESA 2DMNA 3J7AY 2LG4A 3ABUA 3I71A 3KEOA 1PP8F 2LTPA 3I64A 3ZRGA 1MJ9A 5JHUA 2DCEA 2F6CA 4XLFA 2LBFB 1C0WA 4XRFA 1X3WB 2LSOA 4BYYA 2LFBA 3W6VA 3KZZA 5FLXZ 3LSGA 3O8HA 4ESBA 1L0OC 3GTQJ 1M1EB 3CMEI 4XNFA 1RZ4A 1TL8A 1EA3A 5E20A 4L5EA 4BS9A 3E3VA 1XB4A 2DFIA 3S2WA 3ERED 3CCJI 2IS1A 2VB6A 1KQ8A 4U0WA 4DNCA 4Y3OA 2CU7A 4H4KC 2WAQA 4D7NA 2WV1A 3S3OA 2PMZA 1IV6A 4B44A 1VQ6I 2M4GA 1ZRCA 2WBMA 5E1XA 2MA3A 2GXAA 2BVLA 2BBYA 3JR9A 3FXKA 2JK3A 4L9TA 3HSFA 5FD6A 2OTLI 1R4NB 4XKBA 2JTVA 1MMAA 2DJIA 3VWBA 2K4BA 1FBUA 4ENKA 4XR6A 3COAC 2I10A 4XLCA
chains in the Genus database with same CATH topology
1IAWA 1TTYA 2ZFWA 4L5IA 2Y0MA 2CFXA 4NQWA 2K86A 3KEQA 3KP2A 1IN5A 2OGGA 3DQVC 4IHSA 1QQIA 2D1VA 3RKXA 2ZNYA 4CICA 1FBSA 1P2FA 2M30A 4WXCA 2GAUA 3F8NA 1Z6RA 2D2WA 1TQMA 3F23A 3WE2A 4RB0A 2IA2A 1EH8A 2H09A 3H3UA 2OU2A 3GWZA 3VB2A 5KK1A 5DD8A 1FWZA 5AIPA 4G7HF 3LAPA 5L3CA 3LWFA 3ZMSA 4LK0F 3KETA 5BS6A 4I98B 4GYIA 1B1BA 2FQ3A 1QGPA 1XGNA 4WXDA 1FW9A 2LF7A 2VT3A 2A3SA 2RN7A 3VFZA 1Z6TA 3IC7A 4P9FA 2A6EF 2E1NA 2QQ9A 4CDGA 1PDNC 2Q8KA 2P6SA 2RV8A 4HA8A 2F5FA 5BOXA 5IT9Z 1DP7P 5BMZA 4RGUA 3WU1B 2GA2A 3DP7A 5ILSA 1I1SA 2FA1A 3I53A 2WTEA 4LD5A 6PAXA 4AIJA 3TO6A 2AXLA 5CVJA 1G1BA 2FU4A 4HF0A 4EJUA 4HOBA 1EV7A 3I58A 2MD5A 1S3JA 3JAMZ 2BYVE 1W5TA 1MJBA 4ESJA 2HKXA 2H27A 3K9TA 4HX4A 2TDXA 3LQRA 3QRFF 1IN7A 5FFXA 3RYPA 1HSTA 2YX7A 3K1MA 2XUBA 3T0YA 1YS7A 1OYYA 2MLGA 4ENJA 1ZGJA 3CUOA 3FF5A 3CUQC 3FXUA 5HOOA 4FHTA 1U5TB 1K78A 4ON0A 4LK1F 2EV0A 3WG9A 1YG2A 3M7GA 1U78A 5IT3A 2A68F 5HDKA 1TNTA 2A61A 2DI3A 1BC8C 4CZZA 2HFHA 3EDPA 2ZBKA 4MNUA 1PUEE 1ZRFA 5K5RA 2IPQX 4IJAA 2DAOA 2DK8A 2P7VB 4M6XA 4HX7A 5J8CA 1FPQA 5D4SA 1G3SA 2Z3YA 3HSEA 4MEYF 2LF8A 1U2WA 3VODA 4LMYA 2VBZA 5CVUA 4K2EA 1LEBA 3CLOA 1ON1A 2A69F 1LQ1A 3GEZA 2VE8A 3EETA 3WU0A 1D8KA 1NHAA 2NNYA 1H9TA 1WQ2A 3HYIA 1STZA 3M1EA 1TT8A 1DPRA 2K02A 4FX0A 1SD6A 2KIMA 1HW5A 1ZRDA 1KU2A 3OV8A 1XSXA 1OR7A 2MH2A 4OIQF 5LEJA 3T8TA 3JAMK 4I09A 1IXRC 2VOOA 1K7AA 1ZLJA 2ETHA 1FYKA 1B6AA 3GFIA 3J7AO 3L7WA 2XRNA 4Z2YA 3QPHA 2XROA 3ZQ7A 3K2ZA 1T98A 2XASA 2GXGA 2L4AA 3K1PA 3F6VA 2YX4A 2K7LA 2GQQA 3TDUC 3RYRA 5E1ZB 1KQ9A 1ZGAA 4I7HA 1W5SA 2RA5A 2FBIA 2PKHA 5BQTA 5ILUA 4HX8A 2AHCA 4Y13A 1DDNA 3LAJA 3GO5A 4LGWA 4AVPA 4E70A 1F5TA 4G8XA 2JT1A 2DLLA 1BJAA 4A2UA 1U3EM 5DUKA 2O0YA 2P5VA 3WTTC 3P9CA 4UV9A 2IVMA 1FYLA 1TLHB 5HDGA 2EFOA 2EA2A 3O2PE 2R7FA 1YQAA 4LLNA 2ADUA 3CJNA 2KIUA 3I59A 2P8TA 5J8FA 2A6HF 1BI2A 5A2QZ 5H6QA 3H3ZA 1HW2A 2ZMEB 2DK5A 3DPTA 3TDZC 4ASNA 2VODA 2GZWA 1KGSA 2VC0A 3TO7A 1V3FA 4ZH4F 3C18A 3ECHA 4L9NA 1ZG1A 1DPUA 2RQPA 1FSEA 3RI4A 3J80Z 2B0LA 1IN4A 5DEQA 3KE2A 3TGNA 3HRTA 1LEAA 2E7WA 2HGCA 5JVTA 3GZ5A 3CO7C 1DUXC 4ETSA 4F7ZA 1J75A 3WTUC 4P96A 2BGCA 1H0MA 2XKPA 1ON2A 3NQOA 2UXNA 3B02A 4IXAA 2X0LA 1A04A 1GVJA 3V7SA 4ENNA 3E6MA 1WSUA 2UZKA 3HFIA 1AOYA 2M5WA 5EEGA 4MQVA 3WTZA 5K5OA 4KN7X 1FZPB 3MEXA 2JPBA 1XCVA 2H94A 4G9YA 3WTYC 1CF7B 1YFHA 4CYDA 3ZN1A 1YIOA 1TQIA 1R36A 2ZNZA 3KZYA 2QM3A 4U0YA 1BI3A 1P92A 2QYOA 2F2EA 4OMZA 1OYIA 2V79A 3ABTA 2M8EA 3BROA 2QUFA 4P55A 4ZSKA 1J5YA 2KRFA 1F9NA 3GFMA 5AONA 4UHTA 4A6EA 5LHGA 2ZMEA 1MKMA 4O3MA 4A0ZA 4AIKA 5ED4A 2G9WA 5E8IA 5FD5A 5CLSA 5LBQA 4B09A 3WGHA 2QQBA 3TO9A 1MGTA 3MQ0A 1TNSA 3TOAA 5DV5A 4TV7A 1O3RA 1F1ZA 3NEUA 1IRFA 1FY7A 2HOEA 5J6XA 3V8JA 1BN5A 2COMA 5E8GA 3P9IA 3E5UA 5HS9A 4A12A 2L02A 1RNLA 2EFWA 2HR3A 3V7RA 4D0PA 4IRIA 5DD4A 1G4DA 3HTUA 1Z05A 2Z5UA 4M6YA 4WX9A 3U2RA 5F64A 2F5EA 1I1GA 3MCZA 1XGOA 2YSRA 2HYGD 3K1NA 4BAYA 4AWXB 1XLRA 2VBXA 3E6DA 5FO5A 2ZKZA 3M9AA 4ZSBA 4KYWA 3FZVA 4CGZA 1Y0UA 4RB1A 4U0VA 2O6GE 3L2CA 4ZZLA 3HHHA 2E1CA 3ROUA 1KQ0A 4EJWA 3ELKA 2W57A 2X4HA 3W6KB 4LLGF 2HEOA 1RUNA 2XVCA 3FXQA 4MGRA 1HXDA 5LLQA 2CO5A 2PEXA 1USSA 4ZYHA 2QVOA 1USTA 3H92A 4KDPA 1MJAA 4NB5A 2OQRA 3EYYA 4S05A 2YU3A 1U6GA 3QAHA 1YLFA 5IT9K 4ZYEA 2L54A 3GLXA 3KP4A 3I59B 2DQRA 2YR2A 3GFLA 2Z33A 1WWXA 4UVBA 4EM2A 4Y15A 5DDGA 4Q47A 1QZZA 3CDHA 4Q48A 4R1HA 5HLIA 2DPDA 4XBFA 1KU9A 4L0YB 4MEXF 2W85A 4FT8A 2GIVA 3TOBA 2D45A 2RDPA 3K69A 2WC2A 1S7OA 5LRRA 1TBXA 4G7OF 4P5OA 3BOQA 3HHGA 4HLYA 4HDVA 1L3LA 3RDIA 1FYMA 1SAXA 2OOIA 1JD3A 1BC7C 1RIOH 2JPCA 1JGSA 4IPAA 3IKTA 5L3FA 2EFQA 3GUDA 4RAZA 2H6BA 4UNOA 2L01A 2RKHA 3C1DA 4RS8A 2OBPA 3KP7A 1BOAA 3OOPA 3P9KA 3LA2A 5EEHA 2PI0A 1R1TA 2HS5A 1LVAA 2DBBA 5KVRA 2XAFA 4HV6A 2GXBA 2ZXJA 1IRGA 5H20A 5HS8A 3HOSA 4QWQA 2O61A 4M73A 4HDUA 4A0XA 3ZMZA 5LHIA 2V1XA 2MBFA 4OIOF 2PG4A 2MC3A 4KUMA 1XSVA 5DCMB 5HLGA 1Z7UA 5FGMA 1BI1A 4RGSA 3V8LA 3HUGA 1XD7A 1SFUA 4HLXA 3Q9SA 1OPCA 2QLZA 3GFJA 1KA8A 1S29A 3BZ6A 1O7FA 2XAGA 3GX4X 4M71A 4L9VA 3SHFA 1Q1HA 5D8LB 1YO5C 1Z9CA 5H6RA 4ZYDA 5D5XB 3DPLC 2EV6A 1U5TC 1MZBA 3HRUA 3E6BA 4RB3C 2HDCA 3MWMA 1ODDA 1LDDA 1S8NA 1XGMA 4GXOA 5CYVA 2DU9A 1D5VA 5CVRA 1W7PB 1B4AA 4BXUA 3CTAA 2EK5A 3LQQA 4I0AA 2DO7A 2PMHA 5K1YA 1IZ1A 3ZMVA 3WTVC 1P4WA 1WRJA 4KMUX 3C7JA 4I01A 4KIFA 2VXZA 1HKSA 2RGVA 1QO0D 1FBQA 4KIGA 2W84A 1R7JA 2XAHA 4EJOA 2ISZA 5CJ9A 2K4JA 2PQ8A 4UV8A 4GO1A 1T6SA 2IA1A 3U1DA 4EJTA 2OD5A 3W6JB 2LKPA 1J9IA 5JFRA 4IRGA 3RKWA 3KLOA 4MTEA 4BHPA 4KNYA 4WF2A 2IT0A 2GWRA 1UHMA 5D5UB 1D3YA 1S6LA 1QZYA 4PGHA 2IKKA 2A5YB 3L00A 2RNJA 3L5ZA 3FM5A 1SMYF 4L5JA 2HWVA 2OAZA 1K79A 4KIBA 2A07F 4YFNF 1ZYRF 2NWIA 4OU0A 4R8HA 4DQ2A 4LLLA 3ULQB 4YG2F 4M74A 2F5CA 4IHTA 2KJBA 1R22A 3LA3A 5D6FA 3EYIA 3CUQA 3WE3A 1ZARA 4WCGA 2O3FA 3RJPA 3QU6A 2FNPA 3RKYA 2VBYA 1XSDA 3BPVA 2FA5A 1VTNC 2JZYA 1QPMA 1BBYA 1IUYA 1YW9A 4A6DA 3ZPLA 3G73A 3IRRA 2WWYA 1BIAA 5D5VB 2M87A 1F4KA 2FMYA 3MZYA 2KIFA 4HAMA 1R58A 3GZ6A 3B73A 3G3ZA 3FMSA 3R0AA 4QLCU 3CO6C 2Q2EA 3BJAA 4I0BA 4HW0A 1W7PD 1UB9A 2WV0A 5BPDA 1CF7A 1FOKA 1MD0A 3ZN0A 2FE3A 2NRAC 3R6SA 2QQAA 3P7NA 3I54A 5D5WB 5DCFA 3JSOA 3F22A 1JHFA 2NAZA 3ECOA 1V4RA 3ML6A 3KP3A 3HRMA 4HV5A 1WI9A 3IL2A 2VC1A 2CG4A 2P4WA 5TRDA 2M45A 1W7PA 3FXRA 1LJ9A 1P4AA 3J81K 3GF2A 1J0RA 4CHUA 5E17F 3KFWX 3BPXA 3QOPA 1BI0A 3R61A 1GHCA 2CW0F 1GXPA 1SD7A 2CWEA 5E18F 5CVVA 2QENA 3SZTA 1XCBA 1D8JA 2F5DA 4BNCA 4HF2A 1XMKA 1PP7U 1B9NA 2JSCA 4UXNA 2CYYA 2FXAA 1S7AA 2R7DA 1FP1D 1P4XA 1I5ZA 4KMFA 4O6JA 1KU7A 4LG0A 3KP6A 2LDUA 1O57A 5TJJA 4N9HA 4IVNA 4MQ9F 5K5QA 4PGGA 2RC4A 5ICEA 1FSHA 3D5LA 5LEKA 2M1BA 3FM3A 1G6NA 3DEUA 1G81A 4LG0B 4OIRF 1R23A 4CO8A 4Y17A 2STWA 2BV6A 5E1WA 2ZO4A 3E97A 1SMTA 2HKOA 3MFKA 3T1BA 5LGNA 4Q4ZF 5DCMA 4UVAA 2QWWA 5L3GA 1R00A 2HYFA 4L0ZB 5HDNA 3WGGA 1J7KA 3BJ6A 3R60A 2W25A 4KN4X 3N97A 2L4MA 4JK1X 1J59A 2BE5F 2XHKA 1ULYA 1SD5A 4MHGA 2MLKA 2L3DA 1HW1A 2VN2A 3LSTA 3TKYA 4HQEA 2PMUA 1SD4A 2CSOA 3I5UA 1WKMA 3L9FA 1KYWA 3TQNA 1RUOA 2OA4A 1HKQA 4MTDA 4RAYA 3BDDA 1JXSA 2HZTA 1QNTA 1P6RA 2GA1A 5LGTA 3KCCA 3DDVA 5ILVA 1CGPA 2NYXA 4HQMA 3DFGA 3IWZA 3QU3A 3F8CA 2Z9OA 3FMRA 1T0FA 3HTSB 1G3WA 2Z99A 4GGGA 1BM9A 4A0YA 1OKRA 1YYVA 5BPIA 3V7CA 4U7DA 1I6XA 4XSXF 1IF1A 2MH9A 3R0JA 4OOIA 4NHJA 4WK8F 3ZMTA 2R3SA 3FMQA 3REOA 3HOTA 3PQKA 3K0LA 1IW7F 3JTGA 1O3QA 3DF8A 4UUVA 3ZP5A 2XKOA 2D1HA 3V4GA 3IWFA 1ZH5A 4FX4A 5LGUA 2G7HA 3EUHA 1EH6A 3L09A 2XAJA 4A5MA 3QP5A 1ZLKA 1I27A 4XLNF 1XGSA 1JHHA 1FX7A 2LNBA 5D6EA 5D8KB 3RIRA 4CXFA 4HZFA 3CUQB 2ESNA 5HS7A 4LB6B 3MAJA 4M9XA 2V1UA 2XGXA 1LB2A 2NS0A 3LFKA 2PLYA 2OZ6A 4EQQA 3RPUA 2P5KA 3F3XA 1ZHFA 3LA7A 1ZREA 1E17A 4JQFA 4KICA 3VEPA 4ZSIA 3RPQA 3J81Z 2AS5F 2EFPA 1Z1DA 1XDUA 1K78B 1G3TA 1SFEA 2P7CB 3WTWC 2V6CA 2PJPA 1Z91A 3BWGA 1BIBA 1G3YA 1TW3A 4RGRA 2FSWA 3E5QA 4IF4A 4HBLA 3GYHX 1REPC 2PBIA 2O8XA 1T38A 1R5HA 4EJVA 3DXJF 2VT2A 3Q9VA 1T39A 2IRFG 3FWEA 4PDKA 2Q0OA 1H9GA 2JRTA 3E6CC 2EWNA 2YPRA 2CQKA 3BY6A 3JSPA 4I02A 4BQAA 4AD9A 1LDKB 1UFMA 3ISPA 4GYGA 2H6CA 1FLIA 5ICFA 3HRSA 2J5OA 4ZZDA 1HSJA 3IRQA 4IRHA 5DUIA 2OQGA 2W24A 5FFZA 4HYEA 4RB2C 3LHEA 2CGPA 2VE9A 3DV8A 2FBHA 4G6QA 1O3TA 1ZG3A 2EJRA 3JW4A 4U7BA 1FNNA 5L3BA 3IKVA 3J80K 4OIPF 4L9JA 1AWCA 3Q5FA 2KKOA 5ICCA 4U88A 1XN7A 2OZUA 1ONVA 3BJOA 5JI6A 5LRSA 3WODF 5FB2A 1OYWA 4H0EA 4Q5SF 5FLXK 1B9MA 4OINF 2EV5A 5F6FA 4ENMA 1HQCA 3VOEA 2DW4A 3F8LA 1GXQA 2DTRA 2Y75A 1OMIA 3HIFA 1KU3A 2P6TA 1YW8A 2FOKA 3T5XA 4BHBA 1R1VA 2C6YA 1FT9A 1O3SA 3C3WA 4A5NA 2ISYA 1XDSA 1UHWA 3PFIA 4OMYA 5D4RA 2IW5A 2DT5A 1X3UA 2G7UA 1SFXA 1YW7A 4L18B 4BHCA 3MZHA 2EB7A 1T2KA 1ZN2A 2UWMA 5HVQC 5ICGA 4BH9A 3M8EA 2HQNA 2FRHA 3F72A 3FHZA 2IP2A 2P19A 4N0BA 1LDJA 4B8XA 2KJCA 4LJZF 2K27A 3WTSC 4HF1A 2XAQA 3T8RA 2DQLA 3F8BA 2V9VA 5DYMA 2P5LC 4G7ZF 3F21A 1O7LA 4R79A 3GXOA 1JE8A 1UCRA 2FNAA 4N9IA 1B59A 3V8KA 5LHHA 3WTXC 1J2XA 3SQNA 2FMLA 1IXSB 2PN6A 3ZMDA 4M9SA 3IHUA 2VOPA 4EM0B 2UXXA 3R4KA 4YIFA 2EFNA 2VBWA 4AIHA 1K6OA 2ZJ2A 2HTJA 2RVCA 3F8FA 1U8RA 1R5GA 2HTSA 3BP8A 2Y48A 1FC3A 4XLPF 4WXHA 2IA0A 2QZ8A 3NRVA 2STTA 3WGIA 4EGYA 5L3DA 3QPTA 4KT5C 5A2QK 5AIQA 4G6DA 1MDMB 3RTRA 3QP6A 1KYZA 3JTHA 4JBAA 4EV0A 2PFBA 4PZJA 3I0TA 3CNVA 1R1UA 4UVCA 3D0SA 3F6OA 2QBYA 3U9GA 5F1RA 2FBKA 4XSZF 1MDMA 3SXYA 2DPUA 3PQJA 2ACJA 3SFZA 2FF4A 2BEOA 5HLHA 4ZYGA 2XIGA 3F8MA 1EH7A 3GW2A 2FEZA 2XV4S 2QBYB 4YFKF 4I2OA 3E5XA 2E7XA 4M72A 4S04A 3EQLF 1YS6A 4YIIA 4P9UA 4EM1A 3DKWA 2ESHA 1IN6A 2VONA 1ZG5A 1QBJA 5ERIA 4YFXF 5JR3A 1FP2A 4KA4A 1XMAA 3I4PA 2NNNA 3SZPA 1U5TA 3KLNA 1YTYA 4GCVA 3FX3A 4G94A 4LB5A 2ELHA 3ZMUA 1TW2A 3N4MA 1HKTA 1ZAOA 1IXCA 4ESFA 2IJLA 1W4MA 4KFCA 2EA4A 1LNWA 4EMSA 1E2XA 5CVIA 4EVIA 3O3KA 2ZCWA 2J5PA 4WWCA 5L3EA 3HSRA 1RI7A 1IN8A 4M9ZA 4PCQA 4LFUA 3KP5A 2V1DA 2HQRA 3O6BB 2O03A 4RGXA 1HBXG 3M8FA 3GVAA 3AAFA 4O5VA 1TQPA 4EGZA 3ABUA 3I71A 3KEOA 1PP8F 3I64A 5JHUA 1MJ9A 1C0WA 4XRFA 2LSOA 4BYYA 3KZZA 5FLXZ 4ESBA 1L0OC 1RZ4A 5E20A 3E3VA 1XB4A 2DFIA 3ERED 3S2WA 1KQ8A 4U0WA 4DNCA 1ZRCA 5E1XA 2MA3A 2BBYA 4L9TA 3HSFA 5FD6A 2JTVA 2K4BA 1FBUA 4ENKA 3COAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IAW A;  1TTY A;  2ZFW A;  4L5I A;  2Y0M A;  2CFX A;  4NQW A;  2K86 A;  3KEQ A;  3KP2 A;  1IN5 A;  2OGG A;  3DQV C;  4IHS A;  1QQI A;  2D1V A;  3RKX A;  2ZNY A;  4CIC A;  1FBS A;  1P2F A;  2M30 A;  4WXC A;  2GAU A;  3F8N A;  1Z6R A;  2D2W A;  1TQM A;  3F23 A;  3WE2 A;  4RB0 A;  2IA2 A;  1EH8 A;  2H09 A;  3H3U A;  2OU2 A;  3GWZ A;  3VB2 A;  5KK1 A;  5DD8 A;  1FWZ A;  5AIP A;  4G7H F;  3LAP A;  5L3C A;  3LWF A;  3ZMS A;  4LK0 F;  3KET A;  5BS6 A;  4I98 B;  4GYI A;  1B1B A;  2FQ3 A;  1QGP A;  1XGN A;  4WXD A;  1FW9 A;  2LF7 A;  2VT3 A;  2A3S A;  2RN7 A;  3VFZ A;  1Z6T A;  3IC7 A;  4P9F A;  2A6E F;  2E1N A;  2QQ9 A;  4CDG A;  1PDN C;  2Q8K A;  2P6S A;  2RV8 A;  4HA8 A;  2F5F A;  5BOX A;  5IT9 Z;  1DP7 P;  5BMZ A;  4RGU A;  3WU1 B;  2GA2 A;  3DP7 A;  5ILS A;  1I1S A;  2FA1 A;  3I53 A;  2WTE A;  4LD5 A;  6PAX A;  4AIJ A;  3TO6 A;  2AXL A;  5CVJ A;  1G1B A;  2FU4 A;  4HF0 A;  4EJU A;  4HOB A;  1EV7 A;  3I58 A;  2MD5 A;  1S3J A;  3JAM Z;  2BYV E;  1W5T A;  1MJB A;  4ESJ A;  2HKX A;  2H27 A;  3K9T A;  4HX4 A;  2TDX A;  3LQR A;  3QRF F;  1IN7 A;  5FFX A;  3RYP A;  1HST A;  2YX7 A;  3K1M A;  2XUB A;  3T0Y A;  1YS7 A;  1OYY A;  2MLG A;  4ENJ A;  1ZGJ A;  3CUO A;  3FF5 A;  3CUQ C;  3FXU A;  5HOO A;  4FHT A;  1U5T B;  1K78 A;  4ON0 A;  4LK1 F;  2EV0 A;  3WG9 A;  1YG2 A;  3M7G A;  1U78 A;  5IT3 A;  2A68 F;  5HDK A;  1TNT A;  2A61 A;  2DI3 A;  1BC8 C;  4CZZ A;  2HFH A;  3EDP A;  2ZBK A;  4MNU A;  1PUE E;  1ZRF A;  5K5R A;  2IPQ X;  4IJA A;  2DAO A;  2DK8 A;  2P7V B;  4M6X A;  4HX7 A;  5J8C A;  1FPQ A;  5D4S A;  1G3S A;  2Z3Y A;  3HSE A;  4MEY F;  2LF8 A;  1U2W A;  3VOD A;  4LMY A;  2VBZ A;  5CVU A;  4K2E A;  1LEB A;  3CLO A;  1ON1 A;  2A69 F;  1LQ1 A;  3GEZ A;  2VE8 A;  3EET A;  3WU0 A;  1D8K A;  1NHA A;  2NNY A;  1H9T A;  1WQ2 A;  3HYI A;  1STZ A;  3M1E A;  1TT8 A;  1DPR A;  2K02 A;  4FX0 A;  1SD6 A;  2KIM A;  1HW5 A;  1ZRD A;  1KU2 A;  3OV8 A;  1XSX A;  1OR7 A;  2MH2 A;  4OIQ F;  5LEJ A;  3T8T A;  3JAM K;  4I09 A;  1IXR C;  2VOO A;  1K7A A;  1ZLJ A;  2ETH A;  1FYK A;  1B6A A;  3GFI A;  3J7A O;  3L7W A;  2XRN A;  4Z2Y A;  3QPH A;  2XRO A;  3ZQ7 A;  3K2Z A;  1T98 A;  2XAS A;  2GXG A;  2L4A A;  3K1P A;  3F6V A;  2YX4 A;  2K7L A;  2GQQ A;  3TDU C;  3RYR A;  5E1Z B;  1KQ9 A;  1ZGA A;  4I7H A;  1W5S A;  2RA5 A;  2FBI A;  2PKH A;  5BQT A;  5ILU A;  4HX8 A;  2AHC A;  4Y13 A;  1DDN A;  3LAJ A;  3GO5 A;  4LGW A;  4AVP A;  4E70 A;  1F5T A;  4G8X A;  2JT1 A;  2DLL A;  1BJA A;  4A2U A;  1U3E M;  5DUK A;  2O0Y A;  2P5V A;  3WTT C;  3P9C A;  4UV9 A;  2IVM A;  1FYL A;  1TLH B;  5HDG A;  2EFO A;  2EA2 A;  3O2P E;  2R7F A;  1YQA A;  4LLN A;  2ADU A;  3CJN A;  2KIU A;  3I59 A;  2P8T A;  5J8F A;  2A6H F;  1BI2 A;  5A2Q Z;  5H6Q A;  3H3Z A;  1HW2 A;  2ZME B;  2DK5 A;  3DPT A;  3TDZ C;  4ASN A;  2VOD A;  2GZW A;  1KGS A;  2VC0 A;  3TO7 A;  1V3F A;  4ZH4 F;  3C18 A;  3ECH A;  4L9N A;  1ZG1 A;  1DPU A;  2RQP A;  1FSE A;  3RI4 A;  3J80 Z;  2B0L A;  1IN4 A;  5DEQ A;  3KE2 A;  3TGN A;  3HRT A;  1LEA A;  2E7W A;  2HGC A;  5JVT A;  3GZ5 A;  3CO7 C;  1DUX C;  4ETS A;  4F7Z A;  1J75 A;  3WTU C;  4P96 A;  2BGC A;  1H0M A;  2XKP A;  1ON2 A;  3NQO A;  2UXN A;  3B02 A;  4IXA A;  2X0L A;  1A04 A;  1GVJ A;  3V7S A;  4ENN A;  3E6M A;  1WSU A;  2UZK A;  3HFI A;  1AOY A;  2M5W A;  5EEG A;  4MQV A;  3WTZ A;  5K5O A;  4KN7 X;  1FZP B;  3MEX A;  2JPB A;  1XCV A;  2H94 A;  4G9Y A;  3WTY C;  1CF7 B;  1YFH A;  4CYD A;  3ZN1 A;  1YIO A;  1TQI A;  1R36 A;  2ZNZ A;  3KZY A;  2QM3 A;  4U0Y A;  1BI3 A;  1P92 A;  2QYO A;  2F2E A;  4OMZ A;  1OYI A;  2V79 A;  3ABT A;  2M8E A;  3BRO A;  2QUF A;  4P55 A;  4ZSK A;  1J5Y A;  2KRF A;  1F9N A;  3GFM A;  5AON A;  4UHT A;  4A6E A;  5LHG A;  2ZME A;  1MKM A;  4O3M A;  4A0Z A;  4AIK A;  5ED4 A;  2G9W A;  5E8I A;  5FD5 A;  5CLS A;  5LBQ A;  4B09 A;  3WGH A;  2QQB A;  3TO9 A;  1MGT A;  3MQ0 A;  1TNS A;  3TOA A;  5DV5 A;  4TV7 A;  1O3R A;  1F1Z A;  3NEU A;  1IRF A;  1FY7 A;  2HOE A;  5J6X A;  3V8J A;  1BN5 A;  2COM A;  5E8G A;  3P9I A;  3E5U A;  5HS9 A;  4A12 A;  2L02 A;  1RNL A;  2EFW A;  2HR3 A;  3V7R A;  4D0P A;  4IRI A;  5DD4 A;  1G4D A;  3HTU A;  1Z05 A;  2Z5U A;  4M6Y A;  4WX9 A;  3U2R A;  5F64 A;  2F5E A;  1I1G A;  3MCZ A;  1XGO A;  2YSR A;  2HYG D;  3K1N A;  4BAY A;  4AWX B;  1XLR A;  2VBX A;  3E6D A;  5FO5 A;  2ZKZ A;  3M9A A;  4ZSB A;  4KYW A;  3FZV A;  4CGZ A;  1Y0U A;  4RB1 A;  4U0V A;  2O6G E;  3L2C A;  4ZZL A;  3HHH A;  2E1C A;  3ROU A;  1KQ0 A;  4EJW A;  3ELK A;  2W57 A;  2X4H A;  3W6K B;  4LLG F;  2HEO A;  1RUN A;  2XVC A;  3FXQ A;  4MGR A;  1HXD A;  5LLQ A;  2CO5 A;  2PEX A;  1USS A;  4ZYH A;  2QVO A;  1UST A;  3H92 A;  4KDP A;  1MJA A;  4NB5 A;  2OQR A;  3EYY A;  4S05 A;  2YU3 A;  1U6G A;  3QAH A;  1YLF A;  5IT9 K;  4ZYE A;  2L54 A;  3GLX A;  3KP4 A;  3I59 B;  2DQR A;  2YR2 A;  3GFL A;  2Z33 A;  1WWX A;  4UVB A;  4EM2 A;  4Y15 A;  5DDG A;  4Q47 A;  1QZZ A;  3CDH A;  4Q48 A;  4R1H A;  5HLI A;  2DPD A;  4XBF A;  1KU9 A;  4L0Y B;  4MEX F;  2W85 A;  4FT8 A;  2GIV A;  3TOB A;  2D45 A;  2RDP A;  3K69 A;  2WC2 A;  1S7O A;  5LRR A;  1TBX A;  4G7O F;  4P5O A;  3BOQ A;  3HHG A;  4HLY A;  4HDV A;  1L3L A;  3RDI A;  1FYM A;  1SAX A;  2OOI A;  1JD3 A;  1BC7 C;  1RIO H;  2JPC A;  1JGS A;  4IPA A;  3IKT A;  5L3F A;  2EFQ A;  3GUD A;  4RAZ A;  2H6B A;  4UNO A;  2L01 A;  2RKH A;  3C1D A;  4RS8 A;  2OBP A;  3KP7 A;  1BOA A;  3OOP A;  3P9K A;  3LA2 A;  5EEH A;  2PI0 A;  1R1T A;  2HS5 A;  1LVA A;  2DBB A;  5KVR A;  2XAF A;  4HV6 A;  2GXB A;  2ZXJ A;  1IRG A;  5H20 A;  5HS8 A;  3HOS A;  4QWQ A;  2O61 A;  4M73 A;  4HDU A;  4A0X A;  3ZMZ A;  5LHI A;  2V1X A;  2MBF A;  4OIO F;  2PG4 A;  2MC3 A;  4KUM A;  1XSV A;  5DCM B;  5HLG A;  1Z7U A;  5FGM A;  1BI1 A;  4RGS A;  3V8L A;  3HUG A;  1XD7 A;  1SFU A;  4HLX A;  3Q9S A;  1OPC A;  2QLZ A;  3GFJ A;  1KA8 A;  1S29 A;  3BZ6 A;  1O7F A;  2XAG A;  3GX4 X;  4M71 A;  4L9V A;  3SHF A;  1Q1H A;  5D8L B;  1YO5 C;  1Z9C A;  5H6R A;  4ZYD A;  5D5X B;  3DPL C;  2EV6 A;  1U5T C;  1MZB A;  3HRU A;  3E6B A;  4RB3 C;  2HDC A;  3MWM A;  1ODD A;  1LDD A;  1S8N A;  1XGM A;  4GXO A;  5CYV A;  2DU9 A;  1D5V A;  5CVR A;  1W7P B;  1B4A A;  4BXU A;  3CTA A;  2EK5 A;  3LQQ A;  4I0A A;  2DO7 A;  2PMH A;  5K1Y A;  1IZ1 A;  3ZMV A;  3WTV C;  1P4W A;  1WRJ A;  4KMU X;  3C7J A;  4I01 A;  4KIF A;  2VXZ A;  1HKS A;  2RGV A;  1QO0 D;  1FBQ A;  4KIG A;  2W84 A;  1R7J A;  2XAH A;  4EJO A;  2ISZ A;  5CJ9 A;  2K4J A;  2PQ8 A;  4UV8 A;  4GO1 A;  1T6S A;  2IA1 A;  3U1D A;  4EJT A;  2OD5 A;  3W6J B;  2LKP A;  1J9I A;  5JFR A;  4IRG A;  3RKW A;  3KLO A;  4MTE A;  4BHP A;  4KNY A;  4WF2 A;  2IT0 A;  2GWR A;  1UHM A;  5D5U B;  1D3Y A;  1S6L A;  1QZY A;  4PGH A;  2IKK A;  2A5Y B;  3L00 A;  2RNJ A;  3L5Z A;  3FM5 A;  1SMY F;  4L5J A;  2HWV A;  2OAZ A;  1K79 A;  4KIB A;  2A07 F;  4YFN F;  1ZYR F;  2NWI A;  4OU0 A;  4R8H A;  4DQ2 A;  4LLL A;  3ULQ B;  4YG2 F;  4M74 A;  2F5C A;  4IHT A;  2KJB A;  1R22 A;  3LA3 A;  5D6F A;  3EYI A;  3CUQ A;  3WE3 A;  1ZAR A;  4WCG A;  2O3F A;  3RJP A;  3QU6 A;  2FNP A;  3RKY A;  2VBY A;  1XSD A;  3BPV A;  2FA5 A;  1VTN C;  2JZY A;  1QPM A;  1BBY A;  1IUY A;  1YW9 A;  4A6D A;  3ZPL A;  3G73 A;  3IRR A;  2WWY A;  1BIA A;  5D5V B;  2M87 A;  1F4K A;  2FMY A;  3MZY A;  2KIF A;  4HAM A;  1R58 A;  3GZ6 A;  3B73 A;  3G3Z A;  3FMS A;  3R0A A;  4QLC U;  3CO6 C;  2Q2E A;  3BJA A;  4I0B A;  4HW0 A;  1W7P D;  1UB9 A;  2WV0 A;  5BPD A;  1CF7 A;  1FOK A;  1MD0 A;  3ZN0 A;  2FE3 A;  2NRA C;  3R6S A;  2QQA A;  3P7N A;  3I54 A;  5D5W B;  5DCF A;  3JSO A;  3F22 A;  1JHF A;  2NAZ A;  3ECO A;  1V4R A;  3ML6 A;  3KP3 A;  3HRM A;  4HV5 A;  1WI9 A;  3IL2 A;  2VC1 A;  2CG4 A;  2P4W A;  5TRD A;  2M45 A;  1W7P A;  3FXR A;  1LJ9 A;  1P4A A;  3J81 K;  3GF2 A;  1J0R A;  4CHU A;  5E17 F;  3KFW X;  3BPX A;  3QOP A;  1BI0 A;  3R61 A;  1GHC A;  2CW0 F;  1GXP A;  1SD7 A;  2CWE A;  5E18 F;  5CVV A;  2QEN A;  3SZT A;  1XCB A;  1D8J A;  2F5D A;  4BNC A;  4HF2 A;  1XMK A;  1PP7 U;  1B9N A;  2JSC A;  4UXN A;  2CYY A;  2FXA A;  1S7A A;  2R7D A;  1FP1 D;  1P4X A;  1I5Z A;  4KMF A;  4O6J A;  1KU7 A;  4LG0 A;  3KP6 A;  2LDU A;  1O57 A;  5TJJ A;  4N9H A;  4IVN A;  4MQ9 F;  5K5Q A;  4PGG A;  2RC4 A;  5ICE A;  1FSH A;  3D5L A;  5LEK A;  2M1B A;  3FM3 A;  1G6N A;  3DEU A;  1G81 A;  4LG0 B;  4OIR F;  1R23 A;  4CO8 A;  4Y17 A;  2STW A;  2BV6 A;  5E1W A;  2ZO4 A;  3E97 A;  1SMT A;  2HKO A;  3MFK A;  3T1B A;  5LGN A;  4Q4Z F;  5DCM A;  4UVA A;  2QWW A;  5L3G A;  1R00 A;  2HYF A;  4L0Z B;  5HDN A;  3WGG A;  1J7K A;  3BJ6 A;  3R60 A;  2W25 A;  4KN4 X;  3N97 A;  2L4M A;  4JK1 X;  1J59 A;  2BE5 F;  2XHK A;  1ULY A;  1SD5 A;  4MHG A;  2MLK A;  2L3D A;  1HW1 A;  2VN2 A;  3LST A;  3TKY A;  4HQE A;  2PMU A;  1SD4 A;  2CSO A;  3I5U A;  1WKM A;  3L9F A;  1KYW A;  3TQN A;  1RUO A;  2OA4 A;  1HKQ A;  4MTD A;  4RAY A;  3BDD A;  1JXS A;  2HZT A;  1QNT A;  1P6R A;  2GA1 A;  5LGT A;  3KCC A;  3DDV A;  5ILV A;  1CGP A;  2NYX A;  4HQM A;  3DFG A;  3IWZ A;  3QU3 A;  3F8C A;  2Z9O A;  3FMR A;  1T0F A;  3HTS B;  1G3W A;  2Z99 A;  4GGG A;  1BM9 A;  4A0Y A;  1OKR A;  1YYV A;  5BPI A;  3V7C A;  4U7D A;  1I6X A;  4XSX F;  1IF1 A;  2MH9 A;  3R0J A;  4OOI A;  4NHJ A;  4WK8 F;  3ZMT A;  2R3S A;  3FMQ A;  3REO A;  3HOT A;  3PQK A;  3K0L A;  1IW7 F;  3JTG A;  1O3Q A;  3DF8 A;  4UUV A;  3ZP5 A;  2XKO A;  2D1H A;  3V4G A;  3IWF A;  1ZH5 A;  4FX4 A;  5LGU A;  2G7H A;  3EUH A;  1EH6 A;  3L09 A;  2XAJ A;  4A5M A;  3QP5 A;  1ZLK A;  1I27 A;  4XLN F;  1XGS A;  1JHH A;  1FX7 A;  2LNB A;  5D6E A;  5D8K B;  3RIR A;  4CXF A;  4HZF A;  3CUQ B;  2ESN A;  5HS7 A;  4LB6 B;  3MAJ A;  4M9X A;  2V1U A;  2XGX A;  1LB2 A;  2NS0 A;  3LFK A;  2PLY A;  2OZ6 A;  4EQQ A;  3RPU A;  2P5K A;  3F3X A;  1ZHF A;  3LA7 A;  1ZRE A;  1E17 A;  4JQF A;  4KIC A;  3VEP A;  4ZSI A;  3RPQ A;  3J81 Z;  2AS5 F;  2EFP A;  1Z1D A;  1XDU A;  1K78 B;  1G3T A;  1SFE A;  2P7C B;  3WTW C;  2V6C A;  2PJP A;  1Z91 A;  3BWG A;  1BIB A;  1G3Y A;  1TW3 A;  4RGR A;  2FSW A;  3E5Q A;  4IF4 A;  4HBL A;  3GYH X;  1REP C;  2PBI A;  2O8X A;  1T38 A;  1R5H A;  4EJV A;  3DXJ F;  2VT2 A;  3Q9V A;  1T39 A;  2IRF G;  3FWE A;  4PDK A;  2Q0O A;  1H9G A;  2JRT A;  3E6C C;  2EWN A;  2YPR A;  2CQK A;  3BY6 A;  3JSP A;  4I02 A;  4BQA A;  4AD9 A;  1LDK B;  1UFM A;  3ISP A;  4GYG A;  2H6C A;  1FLI A;  5ICF A;  3HRS A;  2J5O A;  4ZZD A;  1HSJ A;  3IRQ A;  4IRH A;  5DUI A;  2OQG A;  2W24 A;  5FFZ A;  4HYE A;  4RB2 C;  3LHE A;  2CGP A;  2VE9 A;  3DV8 A;  2FBH A;  4G6Q A;  1O3T A;  1ZG3 A;  2EJR A;  3JW4 A;  4U7B A;  1FNN A;  5L3B A;  3IKV A;  3J80 K;  4OIP F;  4L9J A;  1AWC A;  3Q5F A;  2KKO A;  5ICC A;  4U88 A;  1XN7 A;  2OZU A;  1ONV A;  3BJO A;  5JI6 A;  5LRS A;  3WOD F;  5FB2 A;  1OYW A;  4H0E A;  4Q5S F;  5FLX K;  1B9M A;  4OIN F;  2EV5 A;  5F6F A;  4ENM A;  1HQC A;  3VOE A;  2DW4 A;  3F8L A;  1GXQ A;  2DTR A;  2Y75 A;  1OMI A;  3HIF A;  1KU3 A;  2P6T A;  1YW8 A;  2FOK A;  3T5X A;  4BHB A;  1R1V A;  2C6Y A;  1FT9 A;  1O3S A;  3C3W A;  4A5N A;  2ISY A;  1XDS A;  1UHW A;  3PFI A;  4OMY A;  5D4R A;  2IW5 A;  2DT5 A;  1X3U A;  2G7U A;  1SFX A;  1YW7 A;  4L18 B;  4BHC A;  3MZH A;  2EB7 A;  1T2K A;  1ZN2 A;  2UWM A;  5HVQ C;  5ICG A;  4BH9 A;  3M8E A;  2HQN A;  2FRH A;  3F72 A;  3FHZ A;  2IP2 A;  2P19 A;  4N0B A;  1LDJ A;  4B8X A;  2KJC A;  4LJZ F;  2K27 A;  3WTS C;  4HF1 A;  2XAQ A;  3T8R A;  2DQL A;  3F8B A;  2V9V A;  5DYM A;  2P5L C;  4G7Z F;  3F21 A;  1O7L A;  4R79 A;  3GXO A;  1JE8 A;  1UCR A;  2FNA A;  4N9I A;  1B59 A;  3V8K A;  5LHH A;  3WTX C;  1J2X A;  3SQN A;  2FML A;  1IXS B;  2PN6 A;  3ZMD A;  4M9S A;  3IHU A;  2VOP A;  4EM0 B;  2UXX A;  3R4K A;  4YIF A;  2EFN A;  2VBW A;  4AIH A;  1K6O A;  2ZJ2 A;  2HTJ A;  2RVC A;  3F8F A;  1U8R A;  1R5G A;  2HTS A;  3BP8 A;  2Y48 A;  1FC3 A;  4XLP F;  4WXH A;  2IA0 A;  2QZ8 A;  3NRV A;  2STT A;  3WGI A;  4EGY A;  5L3D A;  3QPT A;  4KT5 C;  5A2Q K;  5AIQ A;  4G6D A;  1MDM B;  3RTR A;  3QP6 A;  1KYZ A;  3JTH A;  4JBA A;  4EV0 A;  2PFB A;  4PZJ A;  3I0T A;  3CNV A;  1R1U A;  4UVC A;  3D0S A;  3F6O A;  2QBY A;  3U9G A;  5F1R A;  2FBK A;  4XSZ F;  1MDM A;  3SXY A;  2DPU A;  3PQJ A;  2ACJ A;  3SFZ A;  2FF4 A;  2BEO A;  5HLH A;  4ZYG A;  2XIG A;  3F8M A;  1EH7 A;  3GW2 A;  2FEZ A;  2XV4 S;  2QBY B;  4YFK F;  4I2O A;  3E5X A;  2E7X A;  4M72 A;  4S04 A;  3EQL F;  1YS6 A;  4YII A;  4P9U A;  4EM1 A;  3DKW A;  2ESH A;  1IN6 A;  2VON A;  1ZG5 A;  1QBJ A;  5ERI A;  4YFX F;  5JR3 A;  1FP2 A;  4KA4 A;  1XMA A;  3I4P A;  2NNN A;  3SZP A;  1U5T A;  3KLN A;  1YTY A;  4GCV A;  3FX3 A;  4G94 A;  4LB5 A;  2ELH A;  3ZMU A;  1TW2 A;  3N4M A;  1HKT A;  1ZAO A;  1IXC A;  4ESF A;  2IJL A;  1W4M A;  4KFC A;  2EA4 A;  1LNW A;  4EMS A;  1E2X A;  5CVI A;  4EVI A;  3O3K A;  2ZCW A;  2J5P A;  4WWC A;  5L3E A;  3HSR A;  1RI7 A;  1IN8 A;  4M9Z A;  4PCQ A;  4LFU A;  3KP5 A;  2V1D A;  2HQR A;  3O6B B;  2O03 A;  4RGX A;  1HBX G;  3M8F A;  3GVA A;  3AAF A;  4O5V A;  1TQP A;  4EGZ A;  3ABU A;  3I71 A;  3KEO A;  1PP8 F;  3I64 A;  5JHU A;  1MJ9 A;  1C0W A;  4XRF A;  2LSO A;  4BYY A;  3KZZ A;  5FLX Z;  4ESB A;  1L0O C;  1RZ4 A;  5E20 A;  3E3V A;  1XB4 A;  2DFI A;  3ERE D;  3S2W A;  1KQ8 A;  4U0W A;  4DNC A;  1ZRC A;  5E1X A;  2MA3 A;  2BBY A;  4L9T A;  3HSF A;  5FD6 A;  2JTV A;  2K4B A;  1FBU A;  4ENK A;  3COA C; 
#chains in the Genus database with same CATH topology
 3MKY B;  1IAW A;  1X1A A;  1TTY A;  3X2Q H;  2ZFW A;  3S1N J;  4L5I A;  2Y0M A;  4FE7 A;  1F43 A;  2W4S A;  2CFX A;  4NQW A;  1DP3 A;  2LP0 A;  4C2T A;  2K86 A;  2KRH A;  3KEQ A;  2JA8 J;  3KP2 A;  1IN5 A;  2OGG A;  3HXL A;  2EIN H;  3DQV C;  4ZTF A;  4IHS A;  3OYC A;  3A01 A;  1QQI A;  2D1V A;  3RKX A;  2H8W A;  1FMW A;  2ZNY A;  3QYB A;  4XOR A;  1B72 A;  5HNH A;  3KYL A;  2IGM A;  2MAB A;  3BLY A;  4PUS A;  4CIC A;  3G2B A;  5DM6 F;  1FBS A;  1P2F A;  2M30 A;  2V26 A;  4WXC A;  3P5J A;  1ENH A;  2KPM A;  2KZG A;  5HLT A;  2GAU A;  3F8N A;  1Z6R A;  2D2W A;  3K70 D;  5J47 A;  2VJJ A;  3DPU A;  2L7Z A;  1TQM A;  5IYC J;  3F23 A;  3WE2 A;  2E5N A;  4RB0 A;  1R4M B;  2IA2 A;  3BR0 A;  1EH8 A;  2DA4 A;  2H09 A;  4FQG A;  3H5R A;  3OYM A;  3H3U A;  2OU2 A;  3GWZ A;  3VB2 A;  2Z1D A;  1MNM C;  2AHQ A;  5KK1 A;  3TW7 A;  5DD8 A;  2ECB A;  2GLO A;  5JHF A;  3FXJ A;  1FWZ A;  3CCE I;  3PO2 J;  5AIP A;  4G7H F;  1N78 A;  4X6A J;  3CCU I;  3LAP A;  4C30 A;  4YEL A;  1YI2 I;  3IAS 2;  5L3C A;  3LWF A;  3L1P A;  3ZMS A;  4LK0 F;  2VI6 A;  3KET A;  2ZME C;  5BS6 A;  4XN3 A;  4I98 B;  4GYI A;  1B1B A;  1ZEL A;  2XPV A;  1QGP A;  1XGN A;  2FQ3 A;  4WXD A;  1FW9 A;  2E71 A;  2LF7 A;  2VT3 A;  4BQQ A;  2A3S A;  2RN7 A;  3VFZ A;  2L7M P;  1Z6T A;  3IC7 A;  5KAI C;  3S14 J;  4P9F A;  2A6E F;  1GDT A;  4HNT A;  2E1N A;  1GV5 A;  2NOJ B;  4P1W A;  2QQ9 A;  4CDG A;  1PDN C;  2Q8K A;  2P6S A;  2RV8 A;  3Q0V A;  4HA8 A;  3DWL E;  3A0H C;  3MN2 A;  4JOM A;  2A6T A;  3BR3 A;  3HJE A;  2F5F A;  2XGC A;  1YIJ I;  5BOX A;  4Y33 A;  2DDA A;  5IT9 Z;  1DP7 P;  5BMZ A;  3ERM A;  4RGU A;  3WU1 B;  2GA2 A;  1JJ8 C;  3DP7 A;  2L9V A;  1A35 A;  5ILS A;  5JVG F;  1I1S A;  2FA1 A;  3I53 A;  5J1U A;  2DOE A;  2WTE A;  2F4I A;  4LD5 A;  6PAX A;  3S2D J;  4F91 B;  2EBI A;  5H2F C;  1WJB A;  4AIJ A;  1VQP I;  3TO6 A;  3OOU A;  2BY1 A;  2M8G X;  2AXL A;  5CVJ A;  2KZV A;  1G1B A;  2FU4 A;  3SYT A;  4HF0 A;  3A0B C;  4EJU A;  4HOB A;  1EV7 A;  4C3H J;  4I99 C;  9ANT A;  1VQL I;  2CJJ A;  3I58 A;  2MD5 A;  1ETY A;  2L7F P;  1S3J A;  3JAM Z;  2BYV E;  2FUG 2;  1W5T A;  3ZR8 X;  2CV2 A;  1MJB A;  4ESJ A;  3ABL H;  2HKX A;  4YIR X;  2H27 A;  4C3J J;  3K9T A;  1MMS A;  2NVT J;  1OR7 C;  4HX4 A;  2TDX A;  3LQR A;  3ZQL A;  1IN7 A;  3QRF F;  5FFX A;  3RYP A;  3CD6 I;  3F0C A;  1HST A;  3TED A;  2YX7 A;  3K1M A;  2X1E A;  3JRF A;  2XUB A;  2QEX I;  5F08 A;  3T0Y A;  1YS7 A;  4M6V A;  3EUA A;  2MFZ A;  3AG1 H;  1QRY A;  3BC8 A;  1OYY A;  2MLG A;  2VQL A;  3H1C A;  1ZGJ A;  4ENJ A;  3DTE A;  1IGN A;  3CUO A;  1Z21 A;  4BJ6 C;  3FF5 A;  3CUQ C;  3FXU A;  1JKR C;  1SEU A;  5HOO A;  4Y52 J;  4FHT A;  1U5T B;  1K78 A;  3A1Y A;  4ON0 A;  1AA7 A;  2ZC2 A;  1X3Z B;  1W5C C;  4LK1 F;  3WHC A;  4DOZ A;  2EV0 A;  3WG9 A;  2EZL A;  3OMY A;  1YG2 A;  1WJ5 A;  1UG2 A;  3TW6 A;  1TWF J;  3BCB A;  2ZJP F;  2ZJR F;  3M7G A;  3BTL A;  4A3G J;  1U78 A;  5IT3 A;  2A68 F;  3PSI A;  5HDK A;  5F04 A;  4M3B A;  1TNT A;  2A61 A;  2DI3 A;  4OAZ A;  1BC8 C;  4CZZ A;  2HFH A;  3BQY A;  3EDP A;  2ZBK A;  2IS2 A;  4MNU A;  4MO7 A;  1PUE E;  1ZRF A;  5K5R A;  2ID3 A;  2IPQ X;  1Z3Y A;  1YOV B;  1DGW Y;  4IJA A;  2DAO A;  2DK8 A;  1ZR4 A;  3SDG A;  2P7V B;  4M6X A;  3OYB A;  4HX7 A;  4V2G A;  5J8C A;  1IUF A;  2LRD A;  1FPQ A;  4RM3 A;  5D4S A;  1G3S A;  2Z3Y A;  3HSE A;  3H9G A;  4PFO A;  4MEY F;  1BL0 A;  2LF8 A;  1U2W A;  3VOD A;  4LMY A;  4F55 A;  2VBZ A;  5CVU A;  4K2E A;  1LEB A;  3PNT A;  4E7S A;  2X85 A;  3CLO A;  4LOC A;  1ON1 A;  2A69 F;  1LQ1 A;  2Y0S N;  2H1L A;  3GEZ A;  4HNU A;  2VE8 A;  1HA8 A;  2OF7 A;  3EET A;  4CCN A;  3VDX A;  3WU0 A;  1UMQ A;  1D8K A;  4CCJ A;  1K61 A;  1NHA A;  2VKD A;  2NNY A;  1AU7 A;  2E5Z A;  1OCT C;  2XGE A;  1H9T A;  1WQ2 A;  2RQQ A;  3HYI A;  1STZ A;  3M1E A;  1N77 A;  2Y31 A;  4BUP A;  1QVU A;  3PM1 A;  4GFB A;  5GAD J;  1K4S A;  2IBD A;  1TT8 A;  1DPR A;  2K02 A;  1RKT A;  4FX0 A;  1SD6 A;  1WJA A;  3VYS B;  2KIM A;  1HW5 A;  3TBI A;  3ZQI A;  1JGG A;  1U0J A;  1ZRD A;  1KU2 A;  3OV8 A;  1XSX A;  1OR7 A;  5TIS C;  1EJ9 A;  2MH2 A;  1R9T J;  2EZI A;  4OIQ F;  5LEJ A;  3T8T A;  3JAM K;  4I09 A;  1IXR C;  3VYU B;  2VOO A;  1K7A A;  4Y4R A;  2HDW A;  2YS9 A;  1ZLJ A;  1XX5 A;  2ETH A;  1FYK A;  1B6A A;  4B4C A;  1HOM A;  3GFI A;  4IHW A;  2EQR A;  2W48 A;  4NC7 A;  3J7A O;  3DLL F;  1P9Q C;  1OFC X;  1YE9 A;  3L7W A;  3B6C A;  2XRN A;  2Z16 A;  4Z2Y A;  3QPH A;  2XRO A;  3ZQ7 A;  4BBR J;  3K2Z A;  4PSX A;  1T98 A;  2XAS A;  2GXG A;  2L4A A;  2LRE A;  3K1P A;  2R7U A;  3F6V A;  1G2H A;  2E60 A;  2YX4 A;  2K7L A;  2RRE A;  2GQQ A;  3TDU C;  3FK6 A;  3OSF A;  4BY7 J;  2CMP A;  3RYR A;  5E3M A;  2QA4 I;  1WJC A;  5E1Z B;  1KQ9 A;  1ZGA A;  4I7H A;  3WU2 C;  1W5S A;  2RA5 A;  2FBI A;  1XPX A;  4XIC A;  3KYD B;  5FLM J;  2PKH A;  1BA5 A;  1NTC A;  3D5S C;  2OC6 A;  5BQT A;  3JRB A;  2DJN A;  3LNQ A;  5ILU A;  1E3P A;  3S1Q J;  4HX8 A;  2AHC A;  2LKX A;  3IH2 A;  4Y13 A;  1Z77 A;  4BAC A;  3K4J A;  5K7F A;  3O8G A;  1DDN A;  2MW8 A;  3LAJ A;  3GO5 A;  2WAD A;  5IP7 J;  2VL8 A;  4LGW A;  3MKW B;  3DU6 A;  4AVP A;  3BG9 A;  4E70 A;  1F5T A;  4G8X A;  2JT1 A;  2DLL A;  1BJA A;  4A2U A;  2M9H A;  2BY0 A;  5EEA A;  1U3E M;  3HGY A;  5DUK A;  3MKL A;  1VQO I;  1QHG A;  2O0Y A;  2P5V A;  2P81 A;  3WTT C;  3QYF A;  2RNG A;  3P9C A;  4J00 A;  4UV9 A;  5LD2 C;  1K6Y A;  2KDO A;  3L2W A;  2IVM A;  1FYL A;  1ACI A;  1TLH B;  5HDG A;  2EFO A;  1WHU A;  2EA2 A;  3O2P E;  3CF5 F;  3OL3 A;  1DU6 A;  4XK4 A;  3RZO J;  2HXO A;  1LE8 A;  2R7F A;  1YQA A;  4LLN A;  2ADU A;  3CJN A;  1BJZ A;  1YHQ I;  2KIU A;  1N75 A;  3I59 A;  4XQF A;  2P8T A;  1PUF A;  2GM4 A;  5J8F A;  2CV0 A;  1U8B A;  2A6H F;  2JUG A;  1R71 A;  3K2A A;  5EGO B;  1VQ5 I;  1BI2 A;  1NG6 A;  5H6Q A;  5A2Q Z;  4D7M A;  3H3Z A;  1HW2 A;  2ZME B;  4BE2 A;  2DK5 A;  3DPT A;  3CLQ A;  3TDZ C;  4ASN A;  4E7K A;  2LBF A;  2VOD A;  3JRI A;  2M7B A;  2QGU A;  4A93 J;  2GZW A;  3HZJ A;  2CQ7 A;  1KGS A;  2VC0 A;  3TO7 A;  1V3F A;  1G59 A;  4ZH4 F;  3C18 A;  1VQK I;  1Z67 A;  4ZJZ A;  4XKW A;  4XOT A;  3ECH A;  4L9N A;  3OYF A;  1ZG1 A;  1DPU A;  2RQP A;  1FSE A;  1OCO H;  2HOS A;  3RI4 A;  3J80 Z;  2B0L A;  3LFU A;  1IN4 A;  5DEQ A;  3KE2 A;  1Y1W J;  3TGN A;  3HRT A;  1LEA A;  2E7W A;  4C3I J;  4X1E A;  2HGC A;  5JVT A;  1S9H A;  2HNH A;  3GZ5 A;  1ETX A;  3OR2 C;  1VQ9 I;  3CO7 C;  1I50 J;  1DUX C;  3W2W A;  4ETS A;  3K4C A;  4F7Z A;  3H35 A;  2DT6 A;  1J75 A;  3K4M A;  2XF5 A;  3GTJ J;  3WTU C;  4BE1 A;  4P96 A;  2BGC A;  1H0M A;  2XKP A;  1ON2 A;  3DEW A;  3NQO A;  5FKN A;  2UXN A;  3B02 A;  3LSM A;  4IXA A;  2X0L A;  1A04 A;  1GVJ A;  3V7S A;  4ENN A;  3E6M A;  1YIT I;  1WSU A;  2UZK A;  1HDD C;  2R7T A;  3HFI A;  1AKH A;  1AOY A;  2M5W A;  4UB6 C;  3KPH A;  3IH3 A;  5EEG A;  4JX5 A;  4MQV A;  3ZQC A;  3WTZ A;  5K5O A;  4QIW N;  2I5U A;  1HLV A;  4KN7 X;  1FZP B;  3MEX A;  2JPB A;  1XCV A;  2H94 A;  4G9Y A;  3RKQ A;  2WB1 N;  4PK4 A;  3RQI A;  2R7Q A;  3WTY C;  1CF7 B;  3W2V A;  1YFH A;  4BJ5 C;  4CYD A;  4IQ4 A;  3ZN1 A;  3K4B A;  3PNV A;  2HPM A;  1YIO A;  4ZDL A;  1TQI A;  1R36 A;  1MH4 A;  2ZNZ A;  2LY1 A;  2CW8 A;  1WFX A;  3KZY A;  5C4J J;  1VFC A;  2QM3 A;  4U0Y A;  3OYL A;  1BI3 A;  1P92 A;  5IY5 H;  2QYO A;  3K4N A;  2F2E A;  2HPI A;  4IOC F;  2HVS A;  4OMZ A;  2LYC A;  5IOZ A;  1OYI A;  4HSR A;  2MD0 A;  2V79 A;  2X6W A;  3BG5 A;  3SEZ A;  2EIL H;  2X9D A;  3ABT A;  3ZQH A;  4DGW B;  1T33 A;  2M8E A;  2E1M B;  3BRO A;  3BZC A;  2QUF A;  4P55 A;  3ZGK A;  4BBS J;  4ZSK A;  1W0T A;  1J5Y A;  2KRF A;  1F9N A;  1MW7 A;  1GT0 C;  5E3O A;  3GFM A;  5AON A;  1YX3 A;  2DMU A;  1TT0 A;  1WZ2 A;  1Y8R B;  4NBQ A;  3SFI A;  4UHT A;  4A6E A;  2P0W A;  3J7Z I;  5LHG A;  2ZME A;  4S0H B;  1MKM A;  4DJA A;  4AC0 A;  3NAR A;  4O3M A;  3PFY A;  3ABK H;  1SFO J;  4A0Z A;  4AIK A;  5ED4 A;  2G9W A;  5E8I A;  5FD5 A;  5CLS A;  5LBQ A;  4B09 A;  3WGH A;  2K85 A;  2QQB A;  3TO9 A;  4CZC A;  1MGT A;  2MC4 A;  3MQ0 A;  2UUZ A;  3OWT A;  4BQN A;  4DW6 A;  1R49 A;  1TNS A;  3TOA A;  5DV5 A;  1IG7 A;  4TV7 A;  2JQ7 A;  2EIJ H;  1O3R A;  1WJF A;  2MG4 A;  1F1Z A;  3NEU A;  1IRF A;  1FY7 A;  2HOE A;  1AKH B;  5J6X A;  4QPQ A;  1RPW A;  3V8J A;  1BN5 A;  2COM A;  5E8G A;  3P9I A;  3E5U A;  4IQJ A;  5HS9 A;  4A12 A;  2L02 A;  3G1L A;  1XMX A;  1RNL A;  2EFW A;  2HR3 A;  4A3E J;  1MBE A;  3V7R A;  1OCP A;  4DBR A;  4D0P A;  4IRI A;  3AL0 B;  3HEF A;  3CQZ J;  1X58 A;  1E3O C;  1SC7 A;  2CQQ A;  3HOW J;  4I76 A;  2E2H J;  5DD4 A;  2CH0 A;  3HTU A;  1Z05 A;  1G4D A;  2Z5U A;  4M6Y A;  4WX9 A;  3U2R A;  1T8I A;  2KDZ A;  4NQW B;  5F64 A;  1MSF C;  4CCK A;  3W2A A;  3FIS A;  2F5E A;  5EGO A;  1I1G A;  3GCM A;  3MCZ A;  1XGO A;  2YSR A;  1VQ8 I;  2HYG D;  3K1N A;  2DDB A;  4BAY A;  4AWX B;  4M3D A;  1XLR A;  1VND A;  2VBX A;  3E6D A;  5FO5 A;  1D1C A;  2IAI A;  2ZKZ A;  3L2V A;  1JT0 A;  3M9A A;  2IS6 A;  4ZSB A;  3CF2 A;  4KYW A;  3S32 A;  3FZV A;  1EKE A;  2GOX B;  3DBR B;  4CGZ A;  1I6H J;  4BY1 J;  2XAU A;  1Y0U A;  4RB1 A;  4U0V A;  2O6G E;  3BTI A;  3BT9 A;  3L2C A;  3RZD J;  3I4M J;  4ZZL A;  4A3K J;  3HHH A;  2E1C A;  3ROU A;  3L2Q A;  1KQ0 A;  1X1C A;  4EJW A;  1ZGW A;  4RAF A;  3ELK A;  2W57 A;  3HG9 A;  2X4H A;  3W6K B;  2L9R A;  4LLG F;  5B66 C;  1H8A C;  5DM7 F;  2HEO A;  1QVT A;  1RUN A;  2XVC A;  3FXQ A;  3HGG A;  2XC7 A;  4MGR A;  1HXD A;  1A6Q A;  2M34 A;  5LLQ A;  2CO5 A;  2X6X A;  2AQF A;  3JRA A;  2PEX A;  1USS A;  1QA6 A;  1FOW A;  1FIA A;  3CZ6 A;  4E7J A;  3K10 A;  3DBH B;  4ZYH A;  2DMT A;  2DN0 A;  1A5J A;  2QVO A;  1UST A;  3H92 A;  3S16 J;  2DA5 A;  3ZOB A;  4KDP A;  4IL6 C;  1MJA A;  4NB5 A;  3G4S I;  2E2I J;  3GTL J;  2OQR A;  3EYY A;  4DIQ A;  1PVE A;  3H0D A;  4S05 A;  2GOM A;  3M4O J;  2HVQ A;  3E0J B;  2YU3 A;  1LUJ B;  3B6A A;  1U6G A;  4KJZ A;  3S3M A;  3JRG A;  3QAH A;  3GTO J;  1YLF A;  4GDF A;  2F5V A;  5IT9 K;  1V55 H;  2EIK H;  3CP2 A;  2QQ8 A;  5GP9 A;  2ME6 A;  4ZYE A;  2L54 A;  2PMZ N;  5M5Y J;  4NNJ A;  1JKQ C;  3GLX A;  3KP4 A;  1J09 A;  3I59 B;  4XN0 A;  2DQR A;  1UAA A;  2NVU B;  1ZKG A;  2YR2 A;  3GFL A;  2Z33 A;  1WWX A;  1I3A A;  4UVB A;  3DKY A;  4EM2 A;  4Y15 A;  5DDG A;  4Q47 A;  1OIS A;  1QZZ A;  3CDH A;  3DTK A;  4Q48 A;  4R1H A;  5HLI A;  2DPD A;  2VJ4 A;  4DZJ A;  4MFE A;  4XBF A;  1KU9 A;  3HOZ J;  4L0Y B;  4B1R A;  4MEX F;  1D5Y A;  1OCR H;  2W85 A;  4PJL A;  4FT8 A;  3SZG A;  2GIV A;  1UEL B;  3CES A;  4NUB A;  1B8I B;  3TOB A;  2D45 A;  1NH3 A;  4BGD A;  2RDP A;  3K69 A;  2WC2 A;  4KT6 A;  1S7O A;  1KZH A;  4V19 K;  5LRR A;  1TBX A;  1TWC J;  4G7O F;  4P5O A;  3BOQ A;  3HHG A;  2VXD A;  4HLY A;  4IX7 A;  2R7R A;  2K9L A;  4HDV A;  1L3L A;  4DYR A;  3RDI A;  2VJ5 A;  1FYM A;  3OYN A;  2F48 A;  1SAX A;  1RR7 A;  4PJM A;  2OOI A;  1X1P A;  3U21 A;  3GBG A;  4XRS G;  3LSK A;  1DQU A;  1BC7 C;  1JD3 A;  1RIO H;  2E19 A;  2JPC A;  1JGS A;  1ORK A;  4IPA A;  3IKT A;  5L3F A;  2EFQ A;  3GUD A;  4RAZ A;  2H6B A;  2O7O A;  4UNO A;  1HDP A;  2HQ5 A;  2L01 A;  1N25 A;  2RKH A;  3C1D A;  1XTA A;  4UUS A;  2IGN A;  3S15 J;  3H3V K;  4RS8 A;  2OBP A;  3KP7 A;  4CA0 A;  4N4O B;  1BOA A;  3BTC A;  3OOP A;  3P9K A;  3LA2 A;  1A36 A;  5EEH A;  2PI0 A;  1ITY A;  1R1T A;  2KFD A;  1YRN B;  3NAU A;  4HEA 2;  2HS5 A;  1LVA A;  2VAS A;  2OV7 A;  3DCF A;  3GTP J;  1R5I D;  2NVY J;  3OYD A;  3PSF A;  1ETQ A;  2DBB A;  2VJI A;  4G12 A;  5KVR A;  2XAF A;  4HV6 A;  3ZQQ A;  2GXB A;  2DYS H;  2ZXJ A;  1IRG A;  5H20 A;  4YEJ A;  1MMG A;  5HS8 A;  3C2B A;  3HOS A;  4QWQ A;  3BTJ A;  2O61 A;  3C2H A;  4M73 A;  3E7L A;  2CUJ A;  1JTY A;  4HDU A;  4OAY A;  4A0X A;  3S1M J;  3ZMZ A;  2IGK A;  5LHI A;  2V1X A;  2MBF A;  5KCM A;  4OIO F;  3LSJ A;  1PYV A;  2PG4 A;  4CUG A;  1GLN A;  2OJE D;  2MC3 A;  4KUM A;  1XSV A;  2CQN A;  5DCM B;  2JA7 J;  5HLG A;  4LIU A;  3LOC A;  2NVQ J;  3ZCO A;  1Z7U A;  3BG6 A;  1UZC A;  5FGM A;  2KP6 A;  1BI1 A;  2NS8 A;  4KIS A;  4RGS A;  2IEK A;  5IYD J;  3V8L A;  3HUG A;  1XD7 A;  1SFU A;  5K7H A;  4HLX A;  3Q9S A;  5M5X J;  1OPC A;  2QLZ A;  1WGX A;  3CJT B;  3GFJ A;  5EZG A;  1KA8 A;  2DOA A;  1S29 A;  2LH9 A;  3BZ6 A;  1O7F A;  2XAG A;  3GX4 X;  4M71 A;  4L9V A;  1QHH D;  3SHF A;  1Q1H A;  3RCO A;  3JRH A;  4IZZ A;  5D8L B;  1YO5 C;  1JUM A;  1Z9C A;  3OYG A;  3L2U A;  1MBF A;  2HYJ A;  2R7W A;  1WH7 A;  5H6R A;  4ZYD A;  2CV1 A;  5D5X B;  1VQN I;  3LL7 A;  1T95 A;  2R5Z A;  3M8J A;  3DPL C;  3IV5 A;  2EV6 A;  1U5T C;  3JRD A;  1MMN A;  4XKV A;  1MZB A;  3HRU A;  2XSJ C;  3E6B A;  1K83 J;  4UY8 I;  4F3Q A;  4RB3 C;  2HDC A;  3MWM A;  5IYB J;  4AU7 A;  2XGD A;  3C2G A;  3LSI A;  1NK3 P;  2LY2 A;  1ODD A;  3OSG A;  1LDD A;  1S8N A;  1XGM A;  2XRL A;  4G6T B;  4GXO A;  5CYV A;  2DXI A;  2DU9 A;  3SEQ A;  1TWH J;  1APL C;  1D5V A;  4RLQ A;  5CVR A;  2CUF A;  3OS1 A;  2QSG X;  1LKX A;  1W7P B;  3TL4 X;  1OCC H;  3DKX A;  1B4A A;  4XKC A;  4XLE A;  4BXU A;  4D5C A;  3S3N A;  3CTA A;  2VKV A;  2EK5 A;  1WJE A;  5F0H A;  5FRM A;  2R93 J;  3LQQ A;  4I0A A;  2DO7 A;  2HOT A;  4B3A A;  2PMH A;  1IZ1 A;  3ZMV A;  5K1Y A;  3WTV C;  2XPU A;  3CJQ B;  1P4W A;  1WRJ A;  4KMU X;  3C7J A;  5IOY A;  3HOX J;  4I01 A;  3CJR B;  2VQC A;  4KIF A;  2LMD A;  2VXZ A;  1HKS A;  1TWG J;  2RGV A;  1QO0 D;  4ABZ A;  1FBQ A;  4KIG A;  3MMY B;  2W84 A;  5J4V A;  1R7J A;  2L7K A;  2XAH A;  4CCO A;  4EJO A;  2BW3 A;  2R7V A;  2ISZ A;  5CJ9 A;  2K4J A;  2PQ8 A;  4UV8 A;  4BU2 A;  3IH4 A;  4GO1 A;  1JI8 A;  1T6S A;  2IA1 A;  3U1D A;  2G0E A;  2XDV A;  5CKT A;  4MIM A;  4EJT A;  1MND A;  2OD5 A;  1AHD P;  1FJL A;  4FET A;  3W6J B;  2LKP A;  1J9I A;  5JFR A;  2N8G A;  4IRG A;  3Q3S A;  3RKW A;  1RET A;  3KLO A;  2TRT A;  4MTE A;  5J40 A;  3PJR A;  2DOF A;  3QYE A;  4BHP A;  4JYK A;  4WF2 A;  4KNY A;  1D0X A;  2IT0 A;  2GWR A;  1P7J A;  2W00 A;  2Y2Z A;  1UHM A;  3A4C A;  4A3I J;  5D5U B;  3CC4 I;  1D3Y A;  4AUX A;  1B72 B;  1S6L A;  3OIP A;  4CSW A;  2KMU A;  2DYR H;  3NWS A;  1QZY A;  5B1A H;  4PGH A;  3UR3 C;  2IKK A;  2V9K A;  2A5Y B;  2ZSI B;  1D1B A;  3ABM H;  3L00 A;  4YRV A;  2ZSH B;  4J01 A;  2RNJ A;  3L5Z A;  3E1S A;  2CUZ A;  4IHY A;  3AL0 C;  3FM5 A;  1SAN A;  1OQY A;  2CRG A;  1SMY F;  2JWT A;  4L5J A;  3VYT B;  2R5Y B;  3S1R J;  2HWV A;  2OAZ A;  2K3F A;  2HU9 A;  3QQA A;  1K79 A;  3HC7 A;  5GTH C;  4KIB A;  2A07 F;  1SVM A;  2LY9 A;  1X2N A;  2V1N A;  4IHX A;  3HUG B;  1HCR A;  4YFN F;  1ZYR F;  2NWI A;  2Q2E B;  4OU0 A;  4R8H A;  4DQ2 A;  4LLL A;  4XMY A;  3LMM A;  1TP4 A;  3ULQ B;  4A3D J;  1Y0N A;  1U9N A;  4YG2 F;  4M74 A;  2F5C A;  2AXT C;  1WJD A;  4IHT A;  3PL8 A;  2KJB A;  3UNG C;  1MIJ A;  1R22 A;  3LA3 A;  2OCC H;  2DOD A;  5D6F A;  5KNL A;  3EYI A;  3CUQ A;  3WE3 A;  1ZAR A;  4WCG A;  2O3F A;  3RJP A;  3QU6 A;  4BKX A;  2FNP A;  3K70 C;  4RAG A;  3RKY A;  5EDN A;  2ID6 A;  1QPI A;  4X0G A;  2VBY A;  1XSD A;  3VSK A;  2H8R A;  3W3C A;  3BPV A;  2FA5 A;  3OYJ A;  2B63 J;  1MNE A;  1VTN C;  2EZH A;  3I4N J;  2E1M C;  2JZY A;  1QPM A;  1BBY A;  4JP0 A;  4AVZ A;  5IP6 A;  2FX0 A;  4RM2 A;  5F0F A;  1ZR2 A;  2RAE A;  3K6G A;  1IUY A;  3HOV J;  1YW9 A;  4A6D A;  3ZPL A;  1I39 A;  5IP9 J;  3FBN B;  3G73 A;  2ZB9 A;  4NC8 A;  1UJ8 A;  3IRR A;  2WY7 Q;  2DFH A;  4EAT A;  1LFU P;  3K4K A;  2WWY A;  1BIA A;  4ZDO A;  1T0F C;  5D5V B;  2M87 A;  3K4L A;  2YUS A;  1F4K A;  2EH3 A;  5FRO A;  3HPH A;  4E7I A;  3MVP A;  2FMY A;  3MZY A;  4XRS A;  2KIF A;  4HAM A;  1A6I A;  1R58 A;  2BVM A;  4Y7N J;  2PJR B;  3GZ6 A;  2WAE A;  3B73 A;  3G3Z A;  2X6O A;  4GRI A;  3FMS A;  3R0A A;  4F93 B;  4QLC U;  3CO6 C;  2Q2E A;  3BJA A;  4I0B A;  2E36 A;  1ZQ3 P;  2R0Q C;  2ECC A;  3M07 A;  5TGT A;  4HW0 A;  1W7P D;  3OL4 A;  1UB9 A;  2WV0 A;  4XLA A;  5BPD A;  2LK2 A;  1CF7 A;  5CPR B;  2LD5 A;  1FOK A;  1MD0 A;  3GTK J;  3ZN0 A;  3BZK A;  1JUS A;  2FE3 A;  2W82 A;  2NRA C;  3R6S A;  2QSF X;  2AO9 A;  5E3L A;  2QQA A;  3P7N A;  4A3J J;  4II3 A;  1EF4 A;  1X1D A;  1Z7L A;  3I54 A;  4V2F A;  5D5W B;  2E1O A;  3DU5 A;  5DCF A;  3JSO A;  4ANJ A;  1JHF A;  3F22 A;  3G71 I;  2NAZ A;  3ECO A;  3FXO A;  3JRC A;  1V4R A;  3ML6 A;  3GLL A;  3KP3 A;  3HRM A;  2WY8 Q;  4HV5 A;  1WI9 A;  3IL2 A;  2VC1 A;  2CG4 A;  1Z3X A;  2WAQ N;  1HC8 A;  1E0E A;  4MFD A;  2P4W A;  2BY3 A;  3OIO A;  3S8P A;  4E4H A;  5TRD A;  1LPQ A;  4XL9 A;  2M45 A;  1W7P A;  1YJ9 I;  3FXR A;  1LJ9 A;  4HRI A;  1P4A A;  2HOA A;  3J81 K;  4IOA F;  1UG0 A;  3GF2 A;  1O4X A;  1J0R A;  5KHD A;  1S7E A;  1IRZ A;  4CHU A;  5E17 F;  1TWA J;  3KFW X;  3BPX A;  3Q0W A;  1BI0 A;  3QOP A;  3R61 A;  4ZC3 A;  1GHC A;  2CW0 F;  1GXP A;  2AQE A;  1SD7 A;  3BR1 A;  3OY9 A;  2CWE A;  5E18 F;  4W1U A;  5CVV A;  2QEN A;  2JVH A;  3SZT A;  2VKE A;  2L9N A;  1BW5 A;  3HM5 A;  4CYC B;  1LVK A;  4M3G A;  5FKM A;  3HOU J;  1XCB A;  1RR8 C;  1D8J A;  2F5D A;  3EUK L;  4BNC A;  4B48 A;  4ZTJ A;  4HF2 A;  2FD5 A;  3DEE A;  1XMK A;  1JTX A;  4XOP A;  1PP7 U;  1B9N A;  5JLX A;  1D0Z A;  2XF6 A;  3H36 A;  3HL2 A;  1T08 B;  2JSC A;  2H1K A;  2KQR A;  2VQH A;  4UXN A;  3ZXS A;  2R92 J;  2CYY A;  2FXA A;  1S7A A;  1QZE A;  2R7D A;  2K9S A;  1FP1 D;  1P4X A;  1I5Z A;  4KMF A;  5GAH J;  2DFE A;  4O6J A;  4BEH B;  4LG0 A;  4D9J A;  1KU7 A;  4UUT A;  2YU9 J;  3KP6 A;  2LDU A;  1TZL A;  1O57 A;  2F4M B;  4E7Z A;  5TJJ A;  4N9H A;  4IVN A;  4MQ9 F;  4BDZ A;  4RA2 A;  1ETK A;  3FIW A;  5K5Q A;  2EPF A;  4PGG A;  1YJN I;  2BHY A;  2RC4 A;  5ICE A;  1FSH A;  4XON A;  4RBO A;  4U87 A;  3D5L A;  4JX6 A;  4PFP A;  5LEK A;  3HB9 A;  2M1B A;  2W1O A;  4HNV A;  2JA5 J;  2V4J C;  3FM3 A;  5EG0 B;  1G6N A;  2WAF A;  3DEU A;  2Y0S A;  1WPK A;  1G81 A;  5F0C A;  3TP3 A;  3MZ8 A;  4ZDP A;  5FKO A;  4LG0 B;  4OIR F;  1DU0 A;  2BOL A;  3K7A J;  1R23 A;  4CO8 A;  5F1J A;  2V7F A;  3FXM A;  4Y17 A;  2STW A;  2BV6 A;  1IC8 A;  1JJ6 C;  3H0G J;  5E1W A;  2OUM A;  2ZO4 A;  3E97 A;  1SMT A;  2HKO A;  3MFK A;  3T1B A;  2VIX A;  5LGN A;  1LE8 B;  5C4X J;  4Q4Z F;  5DCM A;  1X4P A;  4UVA A;  1YJW I;  1S5L C;  3PNY A;  1VQ7 I;  2QWW A;  2XB0 X;  5L3G A;  1R00 A;  2HYF A;  2Y69 H;  4IHV A;  4L0Z B;  5HDN A;  3WGG A;  1TC3 C;  1J7K A;  3BJ6 A;  3R60 A;  2W25 A;  4KN4 X;  1SVO A;  3ASO H;  3FKJ A;  3N97 A;  2L4M A;  4JK1 X;  1J59 A;  3CCY A;  2BE5 F;  1GVD A;  2IS4 A;  2BY2 A;  2XHK A;  4E7H A;  1P7I A;  1ULY A;  3PO3 J;  1G8X A;  5C44 J;  3QWL A;  2KL4 A;  1SD5 A;  3GZN B;  1DGR M;  4N4N B;  4MHG A;  4BXF A;  2MLK A;  2F4O B;  2L3D A;  1HW1 A;  2VN2 A;  3ONQ A;  2XPW A;  1W36 C;  3LST A;  2O5R A;  3TKY A;  4HQE A;  1H88 C;  1KON A;  2PMU A;  1SD4 A;  2CSO A;  3G1M A;  3I5U A;  3PUB A;  5J1Y A;  3CCR I;  1WKM A;  3L9F A;  1KYW A;  4AM3 A;  3TQN A;  1RUO A;  2OA4 A;  1HKQ A;  1MBK A;  3BR5 A;  4MTD A;  2ZFU A;  4RAY A;  3BDD A;  1JXS A;  2HZT A;  1QNT A;  1MBG A;  2R7X A;  4NDL A;  5B5E C;  1P6R A;  2GA1 A;  2R5Y A;  2CQX A;  4ITV A;  5LGT A;  3KCC A;  2LR8 A;  3DDV A;  4FIS A;  5ILV A;  5DS9 A;  2NXN B;  1CGP A;  2NYX A;  4HQM A;  3RQ4 A;  2ICW G;  2R7S A;  3DFG A;  3IWZ A;  4C9Y A;  3QU3 A;  3F8C A;  2Z9O A;  3MKZ A;  3FMR A;  1T0F A;  3HTS B;  3BR6 A;  1G3W A;  1BW6 A;  4BQO A;  2Z99 A;  4CYC A;  2NS7 A;  4GGG A;  1BM9 A;  4A0Y A;  5GPA A;  3PIO F;  5B3S H;  1OKR A;  2Z2S B;  1YYV A;  3N05 A;  4BEH A;  3A2K A;  2L9S A;  5M3F J;  5BPI A;  3V7C A;  1JUP A;  2JJ7 A;  4U7D A;  2MSY A;  1I6X A;  4XSX F;  5EZH A;  1IF1 A;  2I8D A;  3HPG A;  4PJJ A;  3CCL I;  2MH9 A;  2WB1 A;  3I56 I;  3R0J A;  4LG3 A;  4OOI A;  4NHJ A;  4WK8 F;  3FDY A;  1MSE C;  5GPC A;  3ZMT A;  3EUH C;  3RPU D;  2JUC A;  2R3S A;  3FMQ A;  3REO A;  3CMY A;  3IAM 2;  3HOT A;  4LIT A;  3PQK A;  3K0L A;  1IW7 F;  2ZXI A;  3JTG A;  2HXI A;  1O3Q A;  3DF8 A;  3ASN H;  5K7Z A;  1D1A A;  4UUV A;  2GBY A;  1D0Y A;  3MD2 A;  3ZP5 A;  2XKO A;  2D1H A;  2FQ4 A;  3V4G A;  2FOW A;  4C2M J;  1CQT A;  2M0C A;  5FRN A;  4RMN A;  3IWF A;  1HF0 A;  3VYR B;  4CH7 A;  1ZH5 A;  2JSP A;  1LFB A;  4FX4 A;  5LGU A;  2G7H A;  3EUH A;  1EH6 A;  3L09 A;  2XAJ A;  4A5M A;  3WG7 H;  1GUU A;  1TT5 B;  2QKL B;  2JN6 A;  4PJN A;  1V5E A;  3QP5 A;  1ZLK A;  1I27 A;  4RLF A;  4MLO A;  3ZQG A;  3H9Q A;  3CCS I;  4XLN F;  1XGS A;  1FEX A;  1JHH A;  3H5N A;  3M1C A;  1FX7 A;  2O9L A;  2LNB A;  4QPO A;  5D6E A;  5GAE J;  5D8K B;  2DFF A;  1R6R A;  3RIR A;  4CXF A;  4B43 A;  4XRM A;  4E7L A;  4HZF A;  1YX5 A;  3CUQ B;  2M4K A;  1VF9 A;  2ESN A;  3CDL A;  5E3N A;  2HZD A;  5HS7 A;  2M7A A;  4LB6 B;  3GTG J;  3H5A A;  1XG1 A;  3MAJ A;  4M9X A;  5EYR A;  3H9J A;  2V1U A;  2XGX A;  1LB2 A;  2KIQ A;  5LFA A;  2K5C A;  2NS0 A;  3LFK A;  2JVG A;  2OZ6 A;  2PLY A;  4EQQ A;  3RPU A;  3QPS A;  2P5K A;  5C3E J;  1Y8Q B;  3F3X A;  1ZHF A;  3LA7 A;  1T56 A;  3I55 I;  4BL0 B;  3CCV I;  1ZRE A;  1E17 A;  1I3Q J;  4JQF A;  4KIC A;  3VEP A;  4IEJ A;  2PX9 A;  2KT0 A;  4ZSI A;  3G1O A;  1ETO A;  3RPQ A;  3J81 Z;  2AS5 F;  2EFP A;  2HVR A;  1Z1D A;  1XDU A;  1K78 B;  1G3T A;  1SFE A;  2P7C B;  3WTW C;  2XF7 A;  2V6C A;  5JLW A;  1K4T A;  2PJP A;  2COB A;  3M3Y J;  1Z91 A;  3BWG A;  3LSP A;  1BIB A;  1G3Y A;  3KYC B;  1IDZ A;  1TW3 A;  4RGR A;  4FCY A;  1VQ4 I;  4HST A;  2FSW A;  5J1R A;  3J7Y J;  3E5Q A;  4IF4 A;  4HBL A;  3FK7 A;  3GYH X;  1FOY A;  2KHM A;  1REP C;  1LFP A;  2PBI A;  1MBH A;  1PJR A;  2O8X A;  1T38 A;  4RDU A;  1R5H A;  4EJV A;  2D5V A;  3DXJ F;  2VT2 A;  3Q9V A;  2HI3 A;  1T39 A;  2IRF G;  4M3F A;  3CCQ I;  1V5G A;  3FWE A;  2O8K A;  3PUF A;  3PIP F;  4PDK A;  2L5Q A;  2Q0O A;  1H9G A;  3FKI J;  3IP4 B;  2DMQ A;  2JRT A;  3E6C C;  2EWN A;  2YPR A;  2CQK A;  3S2H J;  3BY6 A;  4M3E A;  3JSP A;  4I02 A;  4CCL A;  4BQA A;  5FLV A;  4AD9 A;  2R7Z J;  1LDK B;  1UFM A;  1ETV A;  3ISP A;  4GYG A;  2H6C A;  4W97 A;  1FLI A;  2OCE A;  1BOB A;  4LIV A;  5ICF A;  1IJW C;  1X1B A;  2JA6 J;  3HRS A;  1WVR A;  2J5O A;  2B7E A;  2Y9Y A;  1WH5 A;  2CUE A;  4ZZD A;  3BR2 A;  2X6Y A;  2A5W A;  3AKZ A;  3JCU C;  1IRX A;  2X1C A;  1HSJ A;  4UB8 C;  2BW3 B;  3IRQ A;  2R7O A;  2DA2 A;  4IRH A;  1XS9 A;  1OLT A;  5DUI A;  2OQG A;  3F9K A;  2W24 A;  5FFZ A;  1UHS A;  4HYE A;  4RB2 C;  3LHE A;  2B9S A;  2CGP A;  1V54 H;  2LC2 A;  2K9M A;  2VE9 A;  3DV8 A;  2FBH A;  4G6Q A;  3HOY J;  2DT7 B;  3D5R C;  1O3T A;  1ZG3 A;  2EJR A;  2MGQ A;  3JW4 A;  1V5F A;  3ESW B;  3OIQ A;  2ZJQ F;  4U7B A;  5HOD A;  1FNN A;  3LSR A;  4BE0 A;  5L3B A;  3IKV A;  3RSN A;  3J80 K;  4OIP F;  4L9J A;  2CS3 A;  1AWC A;  3Q5F A;  1F36 A;  2KKO A;  4F92 B;  1SFK A;  3S17 J;  4HG2 A;  1BR1 A;  3VSL A;  2V6E A;  4E6K G;  1OCZ H;  5ICC A;  4U88 A;  4PJ0 C;  1FTT A;  3ZQF A;  1XN7 A;  3OYK A;  2OZU A;  2K9N A;  3BQZ A;  3NWT A;  3OYE A;  2HQA A;  1ONV A;  4OWR B;  3BJO A;  1Q1V A;  5JI6 A;  4NC6 A;  2IGO A;  2JRM A;  5LRS A;  3WOD F;  3KX2 A;  1OYW A;  5FB2 A;  2VUM J;  3GTM J;  2TCT A;  2DA1 A;  3KIO A;  4AYB A;  4H0E A;  4Q5S F;  5FLX K;  1ERD A;  2X51 A;  1B9M A;  4OIN F;  2EV5 A;  5F6F A;  4ENM A;  5J3L A;  1HQC A;  1X2M A;  2QF7 A;  2JMW A;  3VOE A;  2DW4 A;  3DBL B;  4EEF G;  4F52 A;  1GXQ A;  2DTR A;  3F8L A;  2VPL A;  5B1B H;  2Y75 A;  3IUO A;  4BDY A;  1OMI A;  2LLK A;  1MBJ A;  3HIF A;  1KU3 A;  2P6T A;  1YW8 A;  2FOK A;  3A01 B;  1W36 D;  3T5X A;  4BHB A;  1R1V A;  2C6Y A;  1FT9 A;  1O3S A;  1IV8 A;  3C3W A;  4A5N A;  2PJR A;  2ISY A;  2ZXW H;  2OPT A;  1XDS A;  1UHW A;  3EPZ A;  2EZK A;  3PFI A;  3OYH A;  3L2R A;  2ZXH A;  4OMY A;  5D4R A;  1MH3 A;  4DYC A;  2IW5 A;  4B3X A;  2DT5 A;  4J19 A;  1A31 A;  1X3U A;  2G7U A;  1SFX A;  4AYB N;  1YW7 A;  4L18 B;  4BHC A;  2X48 A;  1RKW A;  3MZH A;  2VLA A;  2EB7 A;  1T2K A;  1ZN2 A;  2KRC A;  4QSH A;  2UWM A;  5HVQ C;  5ICG A;  4IKF A;  2M2E A;  4BH9 A;  3M8E A;  2HQN A;  1FTZ A;  4FE4 A;  2EIM H;  2FRH A;  3F72 A;  3TP0 A;  3FHZ A;  1ETW A;  5EJC A;  2KLO A;  1XC5 A;  2IP2 A;  2P19 A;  3HBL A;  1W1W E;  1FIP A;  4N0B A;  2V9P A;  2OTJ I;  1LDJ A;  1VI0 A;  3D1N I;  4B8X A;  3V42 A;  2KJC A;  4LJZ F;  2K27 A;  3DTI A;  2R4G A;  3WTS C;  1B8I A;  2WA0 A;  4HF1 A;  2XAQ A;  3T8R A;  3CDI A;  2XSD C;  2DQL A;  5CQE A;  3F8B A;  2V9V A;  5DYM A;  2P5L C;  4G7Z F;  1FMV A;  3F21 A;  1O7L A;  4R79 A;  3GXO A;  2ME0 A;  1JE8 A;  2E2J J;  1POG A;  2NVX J;  1UCR A;  2LOO A;  2FNA A;  4N9I A;  1B59 A;  2A05 A;  3V8K A;  5LHH A;  3WTX C;  5IPA A;  1J2X A;  3SQN A;  1U9O A;  1Y39 A;  3QPL A;  2VQG A;  4XLH A;  3CMA I;  5E79 C;  2FML A;  2Y30 A;  1IXS B;  1JT6 A;  2Q1Z B;  2DA7 A;  2PN6 A;  3ZMD A;  4M9S A;  3IHU A;  2VOP A;  3FXL A;  4EM0 B;  3UKG A;  2UXX A;  1S72 I;  3R4K A;  4YIF A;  3AFH A;  2EFN A;  2BHZ A;  2VBW A;  2CW7 A;  4AIH A;  4UUS B;  2ZJ2 A;  4A3F J;  1K6O A;  2HTJ A;  2RVC A;  1PUF B;  3F8F A;  1MMD A;  1U8R A;  4QTR A;  1ZTR A;  1R5G A;  2HTS A;  1GV2 A;  2Y48 A;  3BP8 A;  1QU3 A;  1FC3 A;  4XLP F;  4WXH A;  2LKS A;  5KAF C;  2IA0 A;  2QZ8 A;  1BR2 A;  3NRV A;  3HKZ N;  5GTI C;  4I6Z A;  2W7N A;  2STT A;  2M0M A;  3LSH A;  3WGI A;  4EGY A;  3OYI A;  4IO9 F;  3QOE A;  4A3L J;  3BG3 A;  3JRE A;  5L3D A;  1X4O A;  3QPT A;  2DA6 A;  4KT5 C;  5HNF A;  4BXX J;  2K3P A;  1FOX A;  5A2Q K;  4B47 A;  1RRJ A;  5AIQ A;  2K9Q A;  2BXY A;  2DA3 A;  2VPR A;  4G6D A;  3CP8 A;  3RTR A;  1MDM B;  3QP6 A;  1KYZ A;  2NOG A;  3JTH A;  1IO2 A;  3KZI C;  5EG0 A;  4JBA A;  4EV0 A;  1E3H A;  2PFB A;  4JX4 A;  4PZJ A;  3SJM A;  3I0T A;  3CNV A;  4A3B J;  1R1U A;  4UVC A;  1BR4 A;  3D0S A;  2LVS A;  3F6O A;  2QBY A;  3U9G A;  1VQM I;  1Y1V J;  2FBK A;  4XSZ F;  4BJT A;  4PSW A;  5F1R A;  2IXS A;  5M3M J;  2X1D A;  2R5Z B;  2L0K A;  1MDM A;  2BXZ A;  3SXY A;  2GIZ A;  2DPU A;  4Z6Y A;  3I9V 2;  3PQJ A;  4XID A;  2ACJ A;  3SFZ A;  2FF4 A;  4AID A;  2ELJ A;  2BEO A;  3CC7 I;  5HLH A;  1Z0X A;  3VPR A;  4ZYG A;  2XIG A;  3Q0U A;  3F8M A;  1EH7 A;  3GW2 A;  1W0U A;  2HDD A;  2FEZ A;  2XV4 S;  2QBY B;  4YFK F;  4CCM A;  2QKM B;  5FJ8 J;  4I2O A;  1SVL A;  5M5W J;  3TMO A;  3E5X A;  3CCM I;  2E7X A;  3OS0 A;  2QSH X;  4A3M J;  4DBQ A;  5BNG A;  4M72 A;  2L2O A;  3OR1 C;  2MYS A;  4S04 A;  3SDB A;  2CFO A;  3EQL F;  1YS6 A;  4YII A;  3HDD A;  3KEY A;  4P9U A;  4A69 C;  4EM1 A;  3DKW A;  2ESH A;  1IN6 A;  4XM3 A;  2VON A;  3A02 A;  4D5F A;  1ZG5 A;  1QBJ A;  3A03 A;  5ERI A;  4DYQ A;  3AG3 H;  3AG2 H;  4YFX F;  1SAU A;  2BZT A;  5F27 A;  1ZK8 A;  5JR3 A;  3S93 A;  5DTD A;  1FP2 A;  1WI3 A;  1XMA A;  2E34 A;  3I4P A;  4KA4 A;  3FHN A;  4A3C J;  1Y56 A;  3OS2 A;  1H89 C;  2NNN A;  3FBI B;  2DTZ A;  3HKZ A;  3BCA A;  2XB5 A;  3SZP A;  1U5T A;  3KLN A;  2VKH A;  1YTY A;  1VZ0 A;  4FAS D;  4GCV A;  5EF6 A;  3FX3 A;  4G94 A;  4FTH A;  1OJL A;  4LB5 A;  2ELH A;  4KIT B;  3ZMU A;  4C2U A;  1TW2 A;  4II2 A;  3N4M A;  1ZAO A;  1HKT A;  1IXC A;  4ESF A;  2IJL A;  1JKP C;  1WCM J;  2DMP A;  1W4M A;  2JA2 A;  1Y6I A;  1YRN A;  4KFC A;  2EA4 A;  1LNW A;  4EMS A;  1E2X A;  5FKL A;  5CVI A;  4EVI A;  2E35 A;  3O3K A;  1IDY A;  4DZP A;  1JKO C;  2ELK A;  4ZYA A;  1RC9 A;  2ZCW A;  3WHB A;  2J5P A;  4WWC A;  3CC2 I;  2M3A A;  3HSR A;  1RI7 A;  5L3E A;  3GME A;  5CQG A;  1IN8 A;  4HPQ A;  3AG4 H;  4M9Z A;  2Y9Z A;  4PCQ A;  4LFU A;  4D1Q A;  2K40 A;  3KP5 A;  2QCO A;  3I3L A;  1NG7 A;  5FKK A;  3QOD A;  3BG7 A;  1X19 A;  3OYA A;  5J4Y A;  2V1D A;  3G6E I;  1NK2 P;  2HQR A;  3O6B B;  2FJ1 A;  3CMM A;  2O03 A;  4RGX A;  1HBX G;  2UV1 A;  3GVA A;  3M8F A;  3AAF A;  3DLA A;  4O5V A;  2KIS A;  3U1K A;  5GAG J;  1TQP A;  4EGZ A;  1RES A;  2DMN A;  3J7A Y;  2LG4 A;  3ABU A;  3I71 A;  3KEO A;  1PP8 F;  2LTP A;  3I64 A;  3ZRG A;  1MJ9 A;  5JHU A;  2DCE A;  2F6C A;  4XLF A;  2LBF B;  1C0W A;  4XRF A;  1X3W B;  2LSO A;  4BYY A;  2LFB A;  3W6V A;  3KZZ A;  5FLX Z;  3LSG A;  3O8H A;  4ESB A;  1L0O C;  3GTQ J;  1M1E B;  3CME I;  4XNF A;  1RZ4 A;  1TL8 A;  1EA3 A;  5E20 A;  4L5E A;  4BS9 A;  3E3V A;  1XB4 A;  2DFI A;  3S2W A;  3ERE D;  3CCJ I;  2IS1 A;  2VB6 A;  1KQ8 A;  4U0W A;  4DNC A;  4Y3O A;  2CU7 A;  4H4K C;  2WAQ A;  4D7N A;  2WV1 A;  3S3O A;  2PMZ A;  1IV6 A;  4B44 A;  1VQ6 I;  2M4G A;  1ZRC A;  2WBM A;  5E1X A;  2MA3 A;  2GXA A;  2BVL A;  2BBY A;  3JR9 A;  3FXK A;  2JK3 A;  4L9T A;  3HSF A;  5FD6 A;  2OTL I;  1R4N B;  4XKB A;  2JTV A;  1MMA A;  2DJI A;  3VWB A;  2K4B A;  1FBU A;  4ENK A;  4XR6 A;  3COA C;  2I10 A;  4XLC A; 
#chains in the Genus database with same CATH homology
 1IAW A;  1TTY A;  2ZFW A;  4L5I A;  2Y0M A;  2CFX A;  4NQW A;  2K86 A;  3KEQ A;  3KP2 A;  1IN5 A;  2OGG A;  3DQV C;  4IHS A;  1QQI A;  2D1V A;  3RKX A;  2ZNY A;  4CIC A;  1FBS A;  1P2F A;  2M30 A;  4WXC A;  2GAU A;  3F8N A;  1Z6R A;  2D2W A;  1TQM A;  3F23 A;  3WE2 A;  4RB0 A;  2IA2 A;  1EH8 A;  2H09 A;  3H3U A;  2OU2 A;  3GWZ A;  3VB2 A;  5KK1 A;  5DD8 A;  1FWZ A;  5AIP A;  4G7H F;  3LAP A;  5L3C A;  3LWF A;  3ZMS A;  4LK0 F;  3KET A;  5BS6 A;  4I98 B;  4GYI A;  1B1B A;  2FQ3 A;  1QGP A;  1XGN A;  4WXD A;  1FW9 A;  2LF7 A;  2VT3 A;  2A3S A;  2RN7 A;  3VFZ A;  1Z6T A;  3IC7 A;  4P9F A;  2A6E F;  2E1N A;  2QQ9 A;  4CDG A;  1PDN C;  2Q8K A;  2P6S A;  2RV8 A;  4HA8 A;  2F5F A;  5BOX A;  5IT9 Z;  1DP7 P;  5BMZ A;  4RGU A;  3WU1 B;  2GA2 A;  3DP7 A;  5ILS A;  1I1S A;  2FA1 A;  3I53 A;  2WTE A;  4LD5 A;  6PAX A;  4AIJ A;  3TO6 A;  2AXL A;  5CVJ A;  1G1B A;  2FU4 A;  4HF0 A;  4EJU A;  4HOB A;  1EV7 A;  3I58 A;  2MD5 A;  1S3J A;  3JAM Z;  2BYV E;  1W5T A;  1MJB A;  4ESJ A;  2HKX A;  2H27 A;  3K9T A;  4HX4 A;  2TDX A;  3LQR A;  3QRF F;  1IN7 A;  5FFX A;  3RYP A;  1HST A;  2YX7 A;  3K1M A;  2XUB A;  3T0Y A;  1YS7 A;  1OYY A;  2MLG A;  4ENJ A;  1ZGJ A;  3CUO A;  3FF5 A;  3CUQ C;  3FXU A;  5HOO A;  4FHT A;  1U5T B;  1K78 A;  4ON0 A;  4LK1 F;  2EV0 A;  3WG9 A;  1YG2 A;  3M7G A;  1U78 A;  5IT3 A;  2A68 F;  5HDK A;  1TNT A;  2A61 A;  2DI3 A;  1BC8 C;  4CZZ A;  2HFH A;  3EDP A;  2ZBK A;  4MNU A;  1PUE E;  1ZRF A;  5K5R A;  2IPQ X;  4IJA A;  2DAO A;  2DK8 A;  2P7V B;  4M6X A;  4HX7 A;  5J8C A;  1FPQ A;  5D4S A;  1G3S A;  2Z3Y A;  3HSE A;  4MEY F;  2LF8 A;  1U2W A;  3VOD A;  4LMY A;  2VBZ A;  5CVU A;  4K2E A;  1LEB A;  3CLO A;  1ON1 A;  2A69 F;  1LQ1 A;  3GEZ A;  2VE8 A;  3EET A;  3WU0 A;  1D8K A;  1NHA A;  2NNY A;  1H9T A;  1WQ2 A;  3HYI A;  1STZ A;  3M1E A;  1TT8 A;  1DPR A;  2K02 A;  4FX0 A;  1SD6 A;  2KIM A;  1HW5 A;  1ZRD A;  1KU2 A;  3OV8 A;  1XSX A;  1OR7 A;  2MH2 A;  4OIQ F;  5LEJ A;  3T8T A;  3JAM K;  4I09 A;  1IXR C;  2VOO A;  1K7A A;  1ZLJ A;  2ETH A;  1FYK A;  1B6A A;  3GFI A;  3J7A O;  3L7W A;  2XRN A;  4Z2Y A;  3QPH A;  2XRO A;  3ZQ7 A;  3K2Z A;  1T98 A;  2XAS A;  2GXG A;  2L4A A;  3K1P A;  3F6V A;  2YX4 A;  2K7L A;  2GQQ A;  3TDU C;  3RYR A;  5E1Z B;  1KQ9 A;  1ZGA A;  4I7H A;  1W5S A;  2RA5 A;  2FBI A;  2PKH A;  5BQT A;  5ILU A;  4HX8 A;  2AHC A;  4Y13 A;  1DDN A;  3LAJ A;  3GO5 A;  4LGW A;  4AVP A;  4E70 A;  1F5T A;  4G8X A;  2JT1 A;  2DLL A;  1BJA A;  4A2U A;  1U3E M;  5DUK A;  2O0Y A;  2P5V A;  3WTT C;  3P9C A;  4UV9 A;  2IVM A;  1FYL A;  1TLH B;  5HDG A;  2EFO A;  2EA2 A;  3O2P E;  2R7F A;  1YQA A;  4LLN A;  2ADU A;  3CJN A;  2KIU A;  3I59 A;  2P8T A;  5J8F A;  2A6H F;  1BI2 A;  5A2Q Z;  5H6Q A;  3H3Z A;  1HW2 A;  2ZME B;  2DK5 A;  3DPT A;  3TDZ C;  4ASN A;  2VOD A;  2GZW A;  1KGS A;  2VC0 A;  3TO7 A;  1V3F A;  4ZH4 F;  3C18 A;  3ECH A;  4L9N A;  1ZG1 A;  1DPU A;  2RQP A;  1FSE A;  3RI4 A;  3J80 Z;  2B0L A;  1IN4 A;  5DEQ A;  3KE2 A;  3TGN A;  3HRT A;  1LEA A;  2E7W A;  2HGC A;  5JVT A;  3GZ5 A;  3CO7 C;  1DUX C;  4ETS A;  4F7Z A;  1J75 A;  3WTU C;  4P96 A;  2BGC A;  1H0M A;  2XKP A;  1ON2 A;  3NQO A;  2UXN A;  3B02 A;  4IXA A;  2X0L A;  1A04 A;  1GVJ A;  3V7S A;  4ENN A;  3E6M A;  1WSU A;  2UZK A;  3HFI A;  1AOY A;  2M5W A;  5EEG A;  4MQV A;  3WTZ A;  5K5O A;  4KN7 X;  1FZP B;  3MEX A;  2JPB A;  1XCV A;  2H94 A;  4G9Y A;  3WTY C;  1CF7 B;  1YFH A;  4CYD A;  3ZN1 A;  1YIO A;  1TQI A;  1R36 A;  2ZNZ A;  3KZY A;  2QM3 A;  4U0Y A;  1BI3 A;  1P92 A;  2QYO A;  2F2E A;  4OMZ A;  1OYI A;  2V79 A;  3ABT A;  2M8E A;  3BRO A;  2QUF A;  4P55 A;  4ZSK A;  1J5Y A;  2KRF A;  1F9N A;  3GFM A;  5AON A;  4UHT A;  4A6E A;  5LHG A;  2ZME A;  1MKM A;  4O3M A;  4A0Z A;  4AIK A;  5ED4 A;  2G9W A;  5E8I A;  5FD5 A;  5CLS A;  5LBQ A;  4B09 A;  3WGH A;  2QQB A;  3TO9 A;  1MGT A;  3MQ0 A;  1TNS A;  3TOA A;  5DV5 A;  4TV7 A;  1O3R A;  1F1Z A;  3NEU A;  1IRF A;  1FY7 A;  2HOE A;  5J6X A;  3V8J A;  1BN5 A;  2COM A;  5E8G A;  3P9I A;  3E5U A;  5HS9 A;  4A12 A;  2L02 A;  1RNL A;  2EFW A;  2HR3 A;  3V7R A;  4D0P A;  4IRI A;  5DD4 A;  1G4D A;  3HTU A;  1Z05 A;  2Z5U A;  4M6Y A;  4WX9 A;  3U2R A;  5F64 A;  2F5E A;  1I1G A;  3MCZ A;  1XGO A;  2YSR A;  2HYG D;  3K1N A;  4BAY A;  4AWX B;  1XLR A;  2VBX A;  3E6D A;  5FO5 A;  2ZKZ A;  3M9A A;  4ZSB A;  4KYW A;  3FZV A;  4CGZ A;  1Y0U A;  4RB1 A;  4U0V A;  2O6G E;  3L2C A;  4ZZL A;  3HHH A;  2E1C A;  3ROU A;  1KQ0 A;  4EJW A;  3ELK A;  2W57 A;  2X4H A;  3W6K B;  4LLG F;  2HEO A;  1RUN A;  2XVC A;  3FXQ A;  4MGR A;  1HXD A;  5LLQ A;  2CO5 A;  2PEX A;  1USS A;  4ZYH A;  2QVO A;  1UST A;  3H92 A;  4KDP A;  1MJA A;  4NB5 A;  2OQR A;  3EYY A;  4S05 A;  2YU3 A;  1U6G A;  3QAH A;  1YLF A;  5IT9 K;  4ZYE A;  2L54 A;  3GLX A;  3KP4 A;  3I59 B;  2DQR A;  2YR2 A;  3GFL A;  2Z33 A;  1WWX A;  4UVB A;  4EM2 A;  4Y15 A;  5DDG A;  4Q47 A;  1QZZ A;  3CDH A;  4Q48 A;  4R1H A;  5HLI A;  2DPD A;  4XBF A;  1KU9 A;  4L0Y B;  4MEX F;  2W85 A;  4FT8 A;  2GIV A;  3TOB A;  2D45 A;  2RDP A;  3K69 A;  2WC2 A;  1S7O A;  5LRR A;  1TBX A;  4G7O F;  4P5O A;  3BOQ A;  3HHG A;  4HLY A;  4HDV A;  1L3L A;  3RDI A;  1FYM A;  1SAX A;  2OOI A;  1JD3 A;  1BC7 C;  1RIO H;  2JPC A;  1JGS A;  4IPA A;  3IKT A;  5L3F A;  2EFQ A;  3GUD A;  4RAZ A;  2H6B A;  4UNO A;  2L01 A;  2RKH A;  3C1D A;  4RS8 A;  2OBP A;  3KP7 A;  1BOA A;  3OOP A;  3P9K A;  3LA2 A;  5EEH A;  2PI0 A;  1R1T A;  2HS5 A;  1LVA A;  2DBB A;  5KVR A;  2XAF A;  4HV6 A;  2GXB A;  2ZXJ A;  1IRG A;  5H20 A;  5HS8 A;  3HOS A;  4QWQ A;  2O61 A;  4M73 A;  4HDU A;  4A0X A;  3ZMZ A;  5LHI A;  2V1X A;  2MBF A;  4OIO F;  2PG4 A;  2MC3 A;  4KUM A;  1XSV A;  5DCM B;  5HLG A;  1Z7U A;  5FGM A;  1BI1 A;  4RGS A;  3V8L A;  3HUG A;  1XD7 A;  1SFU A;  4HLX A;  3Q9S A;  1OPC A;  2QLZ A;  3GFJ A;  1KA8 A;  1S29 A;  3BZ6 A;  1O7F A;  2XAG A;  3GX4 X;  4M71 A;  4L9V A;  3SHF A;  1Q1H A;  5D8L B;  1YO5 C;  1Z9C A;  5H6R A;  4ZYD A;  5D5X B;  3DPL C;  2EV6 A;  1U5T C;  1MZB A;  3HRU A;  3E6B A;  4RB3 C;  2HDC A;  3MWM A;  1ODD A;  1LDD A;  1S8N A;  1XGM A;  4GXO A;  5CYV A;  2DU9 A;  1D5V A;  5CVR A;  1W7P B;  1B4A A;  4BXU A;  3CTA A;  2EK5 A;  3LQQ A;  4I0A A;  2DO7 A;  2PMH A;  5K1Y A;  1IZ1 A;  3ZMV A;  3WTV C;  1P4W A;  1WRJ A;  4KMU X;  3C7J A;  4I01 A;  4KIF A;  2VXZ A;  1HKS A;  2RGV A;  1QO0 D;  1FBQ A;  4KIG A;  2W84 A;  1R7J A;  2XAH A;  4EJO A;  2ISZ A;  5CJ9 A;  2K4J A;  2PQ8 A;  4UV8 A;  4GO1 A;  1T6S A;  2IA1 A;  3U1D A;  4EJT A;  2OD5 A;  3W6J B;  2LKP A;  1J9I A;  5JFR A;  4IRG A;  3RKW A;  3KLO A;  4MTE A;  4BHP A;  4KNY A;  4WF2 A;  2IT0 A;  2GWR A;  1UHM A;  5D5U B;  1D3Y A;  1S6L A;  1QZY A;  4PGH A;  2IKK A;  2A5Y B;  3L00 A;  2RNJ A;  3L5Z A;  3FM5 A;  1SMY F;  4L5J A;  2HWV A;  2OAZ A;  1K79 A;  4KIB A;  2A07 F;  4YFN F;  1ZYR F;  2NWI A;  4OU0 A;  4R8H A;  4DQ2 A;  4LLL A;  3ULQ B;  4YG2 F;  4M74 A;  2F5C A;  4IHT A;  2KJB A;  1R22 A;  3LA3 A;  5D6F A;  3EYI A;  3CUQ A;  3WE3 A;  1ZAR A;  4WCG A;  2O3F A;  3RJP A;  3QU6 A;  2FNP A;  3RKY A;  2VBY A;  1XSD A;  3BPV A;  2FA5 A;  1VTN C;  2JZY A;  1QPM A;  1BBY A;  1IUY A;  1YW9 A;  4A6D A;  3ZPL A;  3G73 A;  3IRR A;  2WWY A;  1BIA A;  5D5V B;  2M87 A;  1F4K A;  2FMY A;  3MZY A;  2KIF A;  4HAM A;  1R58 A;  3GZ6 A;  3B73 A;  3G3Z A;  3FMS A;  3R0A A;  4QLC U;  3CO6 C;  2Q2E A;  3BJA A;  4I0B A;  4HW0 A;  1W7P D;  1UB9 A;  2WV0 A;  5BPD A;  1CF7 A;  1FOK A;  1MD0 A;  3ZN0 A;  2FE3 A;  2NRA C;  3R6S A;  2QQA A;  3P7N A;  3I54 A;  5D5W B;  5DCF A;  3JSO A;  3F22 A;  1JHF A;  2NAZ A;  3ECO A;  1V4R A;  3ML6 A;  3KP3 A;  3HRM A;  4HV5 A;  1WI9 A;  3IL2 A;  2VC1 A;  2CG4 A;  2P4W A;  5TRD A;  2M45 A;  1W7P A;  3FXR A;  1LJ9 A;  1P4A A;  3J81 K;  3GF2 A;  1J0R A;  4CHU A;  5E17 F;  3KFW X;  3BPX A;  3QOP A;  1BI0 A;  3R61 A;  1GHC A;  2CW0 F;  1GXP A;  1SD7 A;  2CWE A;  5E18 F;  5CVV A;  2QEN A;  3SZT A;  1XCB A;  1D8J A;  2F5D A;  4BNC A;  4HF2 A;  1XMK A;  1PP7 U;  1B9N A;  2JSC A;  4UXN A;  2CYY A;  2FXA A;  1S7A A;  2R7D A;  1FP1 D;  1P4X A;  1I5Z A;  4KMF A;  4O6J A;  1KU7 A;  4LG0 A;  3KP6 A;  2LDU A;  1O57 A;  5TJJ A;  4N9H A;  4IVN A;  4MQ9 F;  5K5Q A;  4PGG A;  2RC4 A;  5ICE A;  1FSH A;  3D5L A;  5LEK A;  2M1B A;  3FM3 A;  1G6N A;  3DEU A;  1G81 A;  4LG0 B;  4OIR F;  1R23 A;  4CO8 A;  4Y17 A;  2STW A;  2BV6 A;  5E1W A;  2ZO4 A;  3E97 A;  1SMT A;  2HKO A;  3MFK A;  3T1B A;  5LGN A;  4Q4Z F;  5DCM A;  4UVA A;  2QWW A;  5L3G A;  1R00 A;  2HYF A;  4L0Z B;  5HDN A;  3WGG A;  1J7K A;  3BJ6 A;  3R60 A;  2W25 A;  4KN4 X;  3N97 A;  2L4M A;  4JK1 X;  1J59 A;  2BE5 F;  2XHK A;  1ULY A;  1SD5 A;  4MHG A;  2MLK A;  2L3D A;  1HW1 A;  2VN2 A;  3LST A;  3TKY A;  4HQE A;  2PMU A;  1SD4 A;  2CSO A;  3I5U A;  1WKM A;  3L9F A;  1KYW A;  3TQN A;  1RUO A;  2OA4 A;  1HKQ A;  4MTD A;  4RAY A;  3BDD A;  1JXS A;  2HZT A;  1QNT A;  1P6R A;  2GA1 A;  5LGT A;  3KCC A;  3DDV A;  5ILV A;  1CGP A;  2NYX A;  4HQM A;  3DFG A;  3IWZ A;  3QU3 A;  3F8C A;  2Z9O A;  3FMR A;  1T0F A;  3HTS B;  1G3W A;  2Z99 A;  4GGG A;  1BM9 A;  4A0Y A;  1OKR A;  1YYV A;  5BPI A;  3V7C A;  4U7D A;  1I6X A;  4XSX F;  1IF1 A;  2MH9 A;  3R0J A;  4OOI A;  4NHJ A;  4WK8 F;  3ZMT A;  2R3S A;  3FMQ A;  3REO A;  3HOT A;  3PQK A;  3K0L A;  1IW7 F;  3JTG A;  1O3Q A;  3DF8 A;  4UUV A;  3ZP5 A;  2XKO A;  2D1H A;  3V4G A;  3IWF A;  1ZH5 A;  4FX4 A;  5LGU A;  2G7H A;  3EUH A;  1EH6 A;  3L09 A;  2XAJ A;  4A5M A;  3QP5 A;  1ZLK A;  1I27 A;  4XLN F;  1XGS A;  1JHH A;  1FX7 A;  2LNB A;  5D6E A;  5D8K B;  3RIR A;  4CXF A;  4HZF A;  3CUQ B;  2ESN A;  5HS7 A;  4LB6 B;  3MAJ A;  4M9X A;  2V1U A;  2XGX A;  1LB2 A;  2NS0 A;  3LFK A;  2PLY A;  2OZ6 A;  4EQQ A;  3RPU A;  2P5K A;  3F3X A;  1ZHF A;  3LA7 A;  1ZRE A;  1E17 A;  4JQF A;  4KIC A;  3VEP A;  4ZSI A;  3RPQ A;  3J81 Z;  2AS5 F;  2EFP A;  1Z1D A;  1XDU A;  1K78 B;  1G3T A;  1SFE A;  2P7C B;  3WTW C;  2V6C A;  2PJP A;  1Z91 A;  3BWG A;  1BIB A;  1G3Y A;  1TW3 A;  4RGR A;  2FSW A;  3E5Q A;  4IF4 A;  4HBL A;  3GYH X;  1REP C;  2PBI A;  2O8X A;  1T38 A;  1R5H A;  4EJV A;  3DXJ F;  2VT2 A;  3Q9V A;  1T39 A;  2IRF G;  3FWE A;  4PDK A;  2Q0O A;  1H9G A;  2JRT A;  3E6C C;  2EWN A;  2YPR A;  2CQK A;  3BY6 A;  3JSP A;  4I02 A;  4BQA A;  4AD9 A;  1LDK B;  1UFM A;  3ISP A;  4GYG A;  2H6C A;  1FLI A;  5ICF A;  3HRS A;  2J5O A;  4ZZD A;  1HSJ A;  3IRQ A;  4IRH A;  5DUI A;  2OQG A;  2W24 A;  5FFZ A;  4HYE A;  4RB2 C;  3LHE A;  2CGP A;  2VE9 A;  3DV8 A;  2FBH A;  4G6Q A;  1O3T A;  1ZG3 A;  2EJR A;  3JW4 A;  4U7B A;  1FNN A;  5L3B A;  3IKV A;  3J80 K;  4OIP F;  4L9J A;  1AWC A;  3Q5F A;  2KKO A;  5ICC A;  4U88 A;  1XN7 A;  2OZU A;  1ONV A;  3BJO A;  5JI6 A;  5LRS A;  3WOD F;  5FB2 A;  1OYW A;  4H0E A;  4Q5S F;  5FLX K;  1B9M A;  4OIN F;  2EV5 A;  5F6F A;  4ENM A;  1HQC A;  3VOE A;  2DW4 A;  3F8L A;  1GXQ A;  2DTR A;  2Y75 A;  1OMI A;  3HIF A;  1KU3 A;  2P6T A;  1YW8 A;  2FOK A;  3T5X A;  4BHB A;  1R1V A;  2C6Y A;  1FT9 A;  1O3S A;  3C3W A;  4A5N A;  2ISY A;  1XDS A;  1UHW A;  3PFI A;  4OMY A;  5D4R A;  2IW5 A;  2DT5 A;  1X3U A;  2G7U A;  1SFX A;  1YW7 A;  4L18 B;  4BHC A;  3MZH A;  2EB7 A;  1T2K A;  1ZN2 A;  2UWM A;  5HVQ C;  5ICG A;  4BH9 A;  3M8E A;  2HQN A;  2FRH A;  3F72 A;  3FHZ A;  2IP2 A;  2P19 A;  4N0B A;  1LDJ A;  4B8X A;  2KJC A;  4LJZ F;  2K27 A;  3WTS C;  4HF1 A;  2XAQ A;  3T8R A;  2DQL A;  3F8B A;  2V9V A;  5DYM A;  2P5L C;  4G7Z F;  3F21 A;  1O7L A;  4R79 A;  3GXO A;  1JE8 A;  1UCR A;  2FNA A;  4N9I A;  1B59 A;  3V8K A;  5LHH A;  3WTX C;  1J2X A;  3SQN A;  2FML A;  1IXS B;  2PN6 A;  3ZMD A;  4M9S A;  3IHU A;  2VOP A;  4EM0 B;  2UXX A;  3R4K A;  4YIF A;  2EFN A;  2VBW A;  4AIH A;  1K6O A;  2ZJ2 A;  2HTJ A;  2RVC A;  3F8F A;  1U8R A;  1R5G A;  2HTS A;  3BP8 A;  2Y48 A;  1FC3 A;  4XLP F;  4WXH A;  2IA0 A;  2QZ8 A;  3NRV A;  2STT A;  3WGI A;  4EGY A;  5L3D A;  3QPT A;  4KT5 C;  5A2Q K;  5AIQ A;  4G6D A;  1MDM B;  3RTR A;  3QP6 A;  1KYZ A;  3JTH A;  4JBA A;  4EV0 A;  2PFB A;  4PZJ A;  3I0T A;  3CNV A;  1R1U A;  4UVC A;  3D0S A;  3F6O A;  2QBY A;  3U9G A;  5F1R A;  2FBK A;  4XSZ F;  1MDM A;  3SXY A;  2DPU A;  3PQJ A;  2ACJ A;  3SFZ A;  2FF4 A;  2BEO A;  5HLH A;  4ZYG A;  2XIG A;  3F8M A;  1EH7 A;  3GW2 A;  2FEZ A;  2XV4 S;  2QBY B;  4YFK F;  4I2O A;  3E5X A;  2E7X A;  4M72 A;  4S04 A;  3EQL F;  1YS6 A;  4YII A;  4P9U A;  4EM1 A;  3DKW A;  2ESH A;  1IN6 A;  2VON A;  1ZG5 A;  1QBJ A;  5ERI A;  4YFX F;  5JR3 A;  1FP2 A;  4KA4 A;  1XMA A;  3I4P A;  2NNN A;  3SZP A;  1U5T A;  3KLN A;  1YTY A;  4GCV A;  3FX3 A;  4G94 A;  4LB5 A;  2ELH A;  3ZMU A;  1TW2 A;  3N4M A;  1HKT A;  1ZAO A;  1IXC A;  4ESF A;  2IJL A;  1W4M A;  4KFC A;  2EA4 A;  1LNW A;  4EMS A;  1E2X A;  5CVI A;  4EVI A;  3O3K A;  2ZCW A;  2J5P A;  4WWC A;  5L3E A;  3HSR A;  1RI7 A;  1IN8 A;  4M9Z A;  4PCQ A;  4LFU A;  3KP5 A;  2V1D A;  2HQR A;  3O6B B;  2O03 A;  4RGX A;  1HBX G;  3M8F A;  3GVA A;  3AAF A;  4O5V A;  1TQP A;  4EGZ A;  3ABU A;  3I71 A;  3KEO A;  1PP8 F;  3I64 A;  5JHU A;  1MJ9 A;  1C0W A;  4XRF A;  2LSO A;  4BYY A;  3KZZ A;  5FLX Z;  4ESB A;  1L0O C;  1RZ4 A;  5E20 A;  3E3V A;  1XB4 A;  2DFI A;  3ERE D;  3S2W A;  1KQ8 A;  4U0W A;  4DNC A;  1ZRC A;  5E1X A;  2MA3 A;  2BBY A;  4L9T A;  3HSF A;  5FD6 A;  2JTV A;  2K4B A;  1FBU A;  4ENK A;  3COA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...