3BWGA

The crystal structure of possible transcriptional regulator yydk from bacillus subtilis subsp. subtilis str. 168
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
229
structure length
223
Chain Sequence
QQIATEIETYIEEHQLQQGDKLPVLETLMAQFEVSKSTITKSLELLEQKGAIFQVRGSGIFVRKHKRKGYISLLSNQGDFNVTSKVIELDVRKPTPEAAENLNIGMDEDIYYVKRVRYINGQTLCYEESYYTKSIVTYLNNEIVSHSIFHYIREGLGLKIGFSDLFLHVGQLNEEEAEYLGLEAGLPKLYIESIFHLTNGQPFDYSKISYNYEQSQFVVQANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized HTH-type transcriptional regulator yydK
publication title The crystal structure of possible transcriptional regulator YydK from Bacillus subtilis subsp. subtilis str. 168.
rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transcription regulator
total genus 58
structure length 223
sequence length 229
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
A PF07702 UTRA UTRA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bwgA01
3.40.1410.10 Alpha Beta 3-Layer(aba) Sandwich Chorismate lyase Chorismate lyase-like 3bwgA02
4UXNA 4HAMA 4R79A 2P5LC 2GA2A 3ULQB 3KZZA 1JGSA 1FC3A 4HQEA 3CUQC 3L09A 4RGRA 2XAFA 5JHUA 1DUXC 1FYMA 2OGGA 3CUQA 4HDVA 2L01A 2RDPA 4A6EA 2V1XA 4P5OA 4B8XA 3D0SA 2V6CA 3CO6C 2EFOA 2RNJA 4KIGA 3F21A 1MJBA 1AWCA 1JHHA 2A69F 2M1BA 5BQTA 4L5IA 2P19A 3T8RA 3MCZA 3WTXC 4Z2YA 5HLHA 3H3ZA 3OV8A 1B9NA 4IRHA 3TOBA 2V9VA 2HTSA 1SD7A 2Z5UA 1T39A 2TDXA 3GFJA 4PCQA 1HXDA 3BJ6A 2IA2A 2OQGA 1D3YA 1W7PD 4EQQA 2VXZA 2QQBA 3KZYA 2ZO4A 3F8BA 1P92A 5IT3A 4OIRF 1SFXA 3FMRA 2ZXJA 3LHEA 4U0VA 4B09A 3ECHA 5CLSA 2XGXA 3F8NA 1QNTA 2DQRA 1XSDA 2NRAC 3RKWA 3GX4X 1G3YA 2EFPA 1Z9CA 1R23A 1ODDA 2Z3YA 2PFBA 1XCBA 5LRRA 4IPAA 2CFXA 3WU0A 3G3ZA 1MDMB 4OIQF 2VOOA 1XGMA 5EEHA 1O7FA 4I7HA 3SHFA 3E5UA 3IRRA 3M7GA 4I0BA 2KRFA 5H6QA 3FXUA 4N0BA 1HQCA 1L0OC 2KJCA 4R8HA 2IP2A 4GO1A 4U0WA 2XAHA 1K79A 4GYIA 4ZYHA 4JBAA 2YX4A 2HQNA 3R0JA 3N4MA 2NS0A 3I0TA 1FW9A 5FD5A 3F22A 1R5GA 2FBKA 1XSXA 2JPCA 4LK1F 3TO7A 3GLXA 1HW1A 2Q8KA 3K69A 2AXLA 4G7OF 5D5WB 3GFMA 3J80Z 3EDPA 2W57A 3ISPA 3ZPLA 3M8FA 2GXBA 3E6CC 3HTSB 1EH7A 4BYYA 4L9VA 1RIOH 1S7AA 1P4WA 3SXYA 4EJWA 2DW4A 3LQQA 1U8RA 2FA1A 2ESNA 2F5FA 1QZYA 3TO6A 4KN7X 3WTTC 3DFGA 6PAXA 1FNNA 5JR3A 2EJRA 1IW7F 5ICFA 3MZYA 1AOYA 5LGTA 2L4MA 5HS7A 2COMA 1LDKB 5BOXA 5ERIA 4ON0A 5E18F 1YO5C 4I01A 2HFHA 2XRNA 2HQRA 2FQ3A 5DEQA 2OZ6A 2VC1A 3KCCA 3K0LA 3REOA 1IXCA 1H0MA 3C3WA 3GUDA 4ZZLA 3BPVA 3WE3A 5BMZA 1FPQA 4HZFA 2XKOA 1FZPB 2VBZA 4N9HA 4OOIA 1P2FA 1FOKA 2CQKA 2JTVA 3ECOA 2OQRA 3ZN0A 2P7CB 2ZKZA 4HQMA 1K78A 1Z6TA 1XN7A 1RUNA 1YQAA 1U5TB 1FYKA 4ZZDA 1ZYRF 2RQPA 3CNVA 1ZREA 3HSFA 3QAHA 1SMTA 4M6YA 4ESFA 3HRUA 5LRSA 2ESHA 2FNPA 3TDUC 3LQRA 1P6RA 3HRSA 2V1DA 2OU2A 5LBQA 3RI4A 4EJVA 1Y0UA 2M8EA 2A6HF 1CF7A 1WSUA 1Z05A 1GXQA 4AWXB 3O2PE 1SMYF 2H6BA 2F2EA 5LHIA 5JFRA 1HKQA 3BY6A 3SFZA 1XSVA 4MHGA 2UXXA 1BN5A 2NNYA 2GIVA 2A61A 4HW0A 2DFIA 4HLXA 2Y75A 2ZMEA 5D6EA 4RB2C 2JSCA 5AONA 4KDPA 2MBFA 1Q1HA 4CDGA 5CJ9A 3RDIA 1D5VA 3R60A 1KQ8A 4QWQA 2D45A 1ULYA 4D0PA 1QZZA 4Y17A 3ABUA 2E1CA 4O5VA 2MD5A 5D4SA 1YTYA 2QQ9A 4H0EA 4UV8A 4GYGA 4EJUA 2P7VB 2EWNA 1OKRA 4KMFA 2FOKA 3RIRA 1XMKA 3GF2A 1IAWA 4XLNF 4LLNA 1Z6RA 3RKXA 5E20A 1BM9A 2HEOA 1IXSB 3VOEA 4PGGA 3J7AO 4EM1A 3ZMTA 1HKTA 3HOTA 3JSOA 4KYWA 2X4HA 4XSZF 4UNOA 2MC3A 5J6XA 4NB5A 4WXCA 3TOAA 3FF5A 1W4MA 1XGSA 4OMZA 4PDKA 5LHHA 2RVCA 3MQ0A 4IVNA 1JD3A 3K1MA 3GFLA 1IRGA 3EQLF 4A5NA 2MLKA 2FE3A 1S29A 2ZFWA 3GO5A 2A68F 2ETHA 1O3RA 3LA3A 2D2WA 1TQIA 3MWMA 2VC0A 1E2XA 4MTDA 5BPDA 4JK1X 4P9FA 5D8LB 4ENKA 1EV7A 1JHFA 1U3EM 1ZGAA 1BJAA 3ML6A 1MDMA 1FLIA 4YIFA 1WRJA 2O0YA 4OIPF 1G6NA 1J75A 3WGIA 1LQ1A 3HIFA 1LNWA 5HS8A 2IA0A 4HYEA 4NQWA 4CHUA 3PQKA 5L3GA 2P6SA 3W6KB 3EYIA 2XUBA 5HDNA 3GVAA 4HBLA 2QLZA 2DK8A 2IVMA 2J5OA 2OD5A 3TO9A 3U2RA 2GQQA 1KQ0A 2JT1A 2OA4A 3FM5A 1MJ9A 3COAC 3BZ6A 5F1RA 3FX3A 2BYVE 3VODA 3L00A 2VE8A 2PQ8A 2HWVA 3PFIA 4A2UA 2FSWA 4ZSIA 1PP8F 2DBBA 2DK5A 1G4DA 4XBFA 3M9AA 1IN8A 2CYYA 1JE8A 2VE9A 2L4AA 2KIFA 1KU7A 2CW0F 5FFXA 4MEYF 4WXDA 2H27A 1R00A 4RAYA 3MFKA 3LA7A 4RGUA 3V4GA 3ZQ7A 3I5UA 1Z7UA 1OMIA 4YG2F 1GVJA 3ZP5A 4K2EA 1PDNC 2MH9A 4LLGF 1OR7A 3IKVA 4L0ZB 1YW8A 1LJ9A 1MKMA 4IRGA 1FBSA 1DP7P 5HVQC 2FEZA 2O03A 5E8GA 1BIBA 1J5YA 5FLXZ 4UV9A 2CGPA 4MQ9F 2IKKA 5CVRA 4F7ZA 5DD8A 4EVIA 4EJOA 2VOPA 1QQIA 1STZA 4LGWA 2K02A 1F9NA 4CZZA 2GXGA 2DU9A 2YR2A 1XD7A 5AIQA 1U5TA 1IN7A 3J81K 4KFCA 4TV7A 4LG0B 5CVJA 1OPCA 1YFHA 2FA5A 1RZ4A 3QRFF 2IPQX 4EV0A 1XDUA 4Y15A 3KP5A 4G6QA 4P96A 2RC4A 2HGCA 1T38A 1SAXA 1USSA 1R1VA 2EV0A 2L3DA 3QP5A 3KE2A 2LNBA 4MGRA 3F8LA 1E17A 1FP1D 1OYIA 5ILSA 4RS8A 4G8XA 1J59A 3BOQA 5L3BA 3GYHX 5KVRA 2HS5A 3DEUA 5IT9Z 3I59B 3TKYA 3K2ZA 2M87A 2H94A 3D5LA 1XCVA 2IJLA 2R7FA 1I1GA 1P4AA 4BHPA 4IJAA 3JAMZ 1KU9A 1F5TA 1ZRFA 2CWEA 1KGSA 2PN6A 2KIMA 5L3EA 4ZSKA 3KP2A 1MZBA 4GGGA 4P9UA 3KLOA 4I0AA 2NWIA 1VTNC 3BJOA 5K1YA 2RN7A 4AD9A 3N97A 1I27A 3WE2A 2PKHA 3U1DA 4PZJA 3FXQA 4RB1A 3FZVA 2W84A 4G9YA 2RGVA 3GW2A 3F8MA 1ZGJA 4A5MA 1IN4A 3R6SA 1WI9A 3E5QA 1UCRA 4KIBA 3C7JA 3I54A 5D5VB 4G6DA 3SQNA 1XGNA 3LWFA 3V8JA 1TNSA 5ED4A 2Z9OA 2PBIA 3BDDA 2BGCA 3DQVC 4A0XA 2STTA 3I64A 3CO7C 4ASNA 1G3WA 3KETA 4EGZA 3V8KA 3JTHA 3GWZA 4G7HF 4A6DA 1FWZA 1O7LA 1YG2A 3ABTA 1ZHFA 5DYMA 3V7RA 3RJPA 3F3XA 5ICCA 5FO5A 4IRIA 4GCVA 1HW2A 4LK0F 1FY7A 2E7WA 2UZKA 4L0YB 2LKPA 2HKOA 1TTYA 2M30A 3O3KA 5FFZA 3WGHA 2JPBA 2L02A 4L18B 4RGXA 1O3TA 3HHGA 3G73A 1TT8A 4U7DA 1S7OA 1J9IA 3ZMVA 1FBQA 5FB2A 1TQPA 2PMUA 2UXNA 4R1HA 3ZN1A 3W6JB 3TDZC 3F6OA 4S04A 2WV0A 1R7JA 3IWFA 1PUEE 2XVCA 2BE5F 2YX7A 2XROA 4BHBA 2MLGA 3Q5FA 1H9GA 3CUOA 4MQVA 2O6GE 3F8FA 2FMLA 3IRQA 2H09A 5J8FA 3F6VA 4RAZA 5ILVA 1BI0A 4XLPF 2PJPA 4BHCA 3O6BB 3S2WA 1U78A 4UHTA 1ON2A 1YW7A 3VFZA 2K4BA 2KKOA 5D5UB 2YSRA 4Q47A 3OOPA 2VBWA 1JXSA 2DT5A 2VODA 1YLFA 1UHMA 1V4RA 2FXAA 3DKWA 1BOAA 1QGPA 1O57A 1QBJA 2EA2A 3FHZA 4QLCU 1HKSA 2QM3A 4LLLA 2A6EF 2YPRA 2NNNA 5E8IA 4I2OA 3RKYA 2DAOA 2DO7A 3BJAA 5CYVA 1BI2A 2ISZA 3L5ZA 4ZH4F 2V79A 2DTRA 4M74A 3IWZA 1KU2A 3MZHA 3V7CA 4EJTA 2QVOA 1FP2A 4HX4A 4FHTA 4CGZA 3QU3A 5H20A 5DUIA 1ZLKA 4HX8A 3WTSC 2QUFA 3FXRA 2F5DA 2PG4A 4LG0A 5L3CA 4ENMA 1KYZA 4CICA 3R61A 3DXJF 3PQJA 5D6FA 1PP7U 3NEUA 1UHWA 2E1NA 1OYYA 4DNCA 5LGUA 4WXHA 3E6BA 4BXUA 5LEJA 1G81A 4G7ZF 2PLYA 4WK8F 1J0RA 2MA3A 2Y48A 4KA4A 5H6RA 3I4PA 5L3FA 1I5ZA 1R1UA 1GXPA 3DDVA 3GFIA 4HOBA 4LJZF 3LSTA 2QBYB 4KMUX 4IHSA 4CYDA 4HDUA 3I59A 5JVTA 3P9CA 3DF8A 5JI6A 3LAPA 4A12A 3IC7A 4Q5SF 2ZBKA 3P9IA 3C1DA 5CVUA 5CVIA 1FT9A 1WWXA 3WGGA 2RA5A 1IN6A 1XLRA 3DPTA 2KJBA 1U6GA 4UVBA 2CO5A 4M72A 2OAZA 5DUKA 4HF0A 5DCMB 1S8NA 3FMQA 2ZNZA 3Q9VA 3RYRA 2EV6A 2FMYA 3WU1B 3RPUA 4EMSA 1ZAOA 3E6DA 5E1WA 3K1PA 4LB5A 2W24A 1EH8A 4L5JA 1LVAA 5FGMA 2GWRA 2VBYA 3R4KA 1HSJA 1UFMA 1DPRA 5DV5A 2G7UA 2HR3A 3IKTA 1USTA 5F6FA 5HDGA 3BWGA 3ELKA 5E1ZB 2HDCA 3HSEA 1QO0D 1SD5A 4GXOA 3JW4A 1LEBA 3T0YA 4WF2A 3H92A 2ADUA 4FX4A 4YFNF 5HS9A 4OU0A 1MJAA 1A04A 2VT3A 2OZUA 1R1TA 2QYOA 4IXAA 1ZARA 1KA8A 3HRTA 5LGNA 4ZYGA 4LD5A 1ZLJA 1OYWA 3T1BA 4G94A 5HOOA 4WWCA 4S05A 5EEGA 1DPUA 4OMYA 4EGYA 5BPIA 1D8KA 1R36A 1U5TC 2Y0MA 4UUVA 1ON1A 3WTWC 3Q9SA 4HA8A 2JRTA 1ZH5A 4YFXF 4WX9A 4LB6B 1W5TA 3R0AA 2F5EA 4U88A 5TJJA 3SZTA 2K86A 5A2QK 3V8LA 2Z33A 4IHTA 2XHKA 3FM3A 2QWWA 2BBYA 1TBXA 2XKPA 3KEOA 1KYWA 2M5WA 2FBIA 4BQAA 2R7DA 3GZ6A 1L3LA 2F5CA 1B6AA 2EK5A 2C6YA 1V3FA 2VONA 2DPUA 2B0LA 3JTGA 1K7AA 3KP3A 3NRVA 4EM2A 4NHJA 1FSEA 1SD6A 4AIHA 2DLLA 4LFUA 3ZMDA 2D1VA 4ENNA 1ZRCA 3M8EA 4IF4A 2STWA 1G3SA 1RUOA 5E1XA 4MTEA 1T2KA 3RTRA 3H3UA 4ETSA 2P5KA 2G7HA 1ONVA 1HW5A 5J8CA 2K4JA 2K7LA 1EH6A 2XV4S 1LB2A 1HBXG 2A07F 3KP6A 3TGNA 4CO8A 2EFQA 3P9KA 4EM0B 2O61A 2NYXA 4M9ZA 2GZWA 2VBXA 2EA4A 3AAFA 4I02A 4OINF 5LHGA 4HLYA 2VN2A 3WTYC 1G1BA 1W7PB 1BC7C 2BV6A 2DI3A 3L2CA 1H9TA 1R22A 3F23A 4KUMA 1HSTA 3WG9A 2JZYA 4O3MA 2CSOA 2YU3A 1J2XA 2AS5F 1TQMA 5HLGA 2J5PA 3NQOA 2P8TA 4RB0A 2X0LA 2XIGA 1XDSA 3U9GA 4KIFA 1G3TA 3MAJA 3MEXA 3DPLC 3BPXA 2WC2A 2HYFA 1W5SA 1B4AA 1D8JA 3WTUC 3QP6A 3DV8A 4LMYA 2O8XA 2PMHA 1LDJA 1YS6A 3F72A 3KLNA 2P4WA 4OIOF 1IRFA 3E5XA 5D5XB 1O3QA 3BP8A 1ZRDA 4I09A 4HF1A 2HZTA 1GHCA 2GA1A 3QU6A 4A0ZA 1BI1A 5CVVA 3B02A 5DCFA 3FWEA 4ZYEA 3CTAA 3SZPA 3I53A 4KICA 1FX7A 4RGSA 3CJNA 2XAQA 3T5XA 4YFKF 3CUQB 1B59A 1YW9A 3J81Z 3RPQA 2FRHA 1P4XA 4HF2A 3HHHA 4ENJA 2Z99A 1S6LA 2VT2A 5A2QZ 2UWMA 3LA2A 1R58A 2DQLA 4M73A 1IXRC 1T0FA 3GEZA 2MH2A 4L9TA 2QBYA 3CLOA 4ESJA 1MD0A 2LF8A 3EYYA 1RI7A 1ZN2A 5ICGA 4KN4X 4KNYA 3GZ5A 3HRMA 1QPMA 2BEOA 4BH9A 4MEXF 2HOEA 5ILUA 3GXOA 1FBUA 2OBPA 1ZG1A 4XRFA 3HUGA 1RNLA 3HSRA 1YS7A 1WKMA 2QQAA 5DCMA 4DQ2A 4P55A 2PEXA 1I1SA 2D1HA 2LDUA 2ACJA 4L9JA 2IW5A 4FX0A 2ZJ2A 5DD4A 5HLIA 4KT5C 3K9TA 1O3SA 1T6SA 2ISYA 1YYVA 2XAJA 4MNUA 3ROUA 2WWYA 4HV5A 1T98A 2M45A 1KQ9A 1SFUA 4ZSBA 1X3UA 1Z1DA 4PGHA 4Y13A 2EV5A 1XB4A 3BROA 3HOSA 2PI0A 2HYGD 5FD6A 3KFWX 4HV6A 2FF4A 4RB3C 1DDNA 3VB2A 1KU3A 5ICEA 2W25A 2IA1A 4Q4ZF 2A3SA 1IZ1A 3B73A 2ELHA 2HTJA 3M1EA 3VEPA 3ZMUA 1B1BA 3WTVC 3KP4A 5F64A 2R3SA 1IUYA 4U7BA 1U2WA 2LF7A 4N9IA 4M6XA 3L9FA 2RV8A 1MGTA 2Q0OA 1FSHA 3E97A 3P7NA 5KK1A 1ZG5A 3HFIA 3LAJA 5HDKA 4Q48A 4ESBA 1BC8C 2QZ8A 4HX7A 3HTUA 4M9XA 5LLQA 3FMSA 2QENA 2AHCA 2CG4A 2EB7A 5K5OA 1K6OA 2OOIA 5FLXK 2FNAA 5DDGA 1BIAA 4A0YA 2HKXA 2P6TA 5D8KB 1R5HA 3JSPA 1C0WA 2XAGA 1FYLA 1REPC 1F4KA 5TRDA 1TW3A 2P5VA 3QPHA 5K5QA 3K1NA 5E17F 1TNTA 3KP7A 1BBYA 1LEAA 2KIUA 3TQNA 2IT0A 1CGPA 5K5RA 4UVAA 2H6CA 2ZNYA 3LFKA 3IHUA 2ZCWA 1TLHB 3I71A 4E70A 5BS6A 2FBHA 1TW2A 2V1UA 3CDHA 3QPTA 3V7SA 2LSOA 2IRFG 1K78B 4UVCA 1S3JA 5L3DA 2G9WA 3WTZA 4CXFA 4BNCA 2Q2EA 5AIPA 3EETA 4XSXF 2FU4A 2A5YB 2NAZA 3EUHA 2L54A 4JQFA 4BAYA 1IF1A 4WCGA 5IT9K 3E3VA 2DPDA 3KEQA 1W7PA 2WTEA 1CF7B 1XMAA 4AVPA 2O3FA 3F8CA 3QOPA 1UB9A 1YIOA 3C18A 3E6MA 1BI3A 4O6JA 1SFEA 4AIJA 2W85A 3JAMK 5LEKA 4YIIA 3RYPA 2RKHA 5D4RA 3WODF 1ZG3A 1I6XA 1B9MA 1IN5A 3ZMZA 1F1ZA 2XASA 1LDDA 2ZMEB 3IL2A 3ZMSA 1J7KA 1WQ2A 4I98B 4M9SA 1NHAA 3ERED 2GAUA 4M71A 4FT8A 3L7WA 1XGOA 3J80K 2EFNA 4ZYDA 4U0YA 1Z91A 3T8TA 3DP7A 2E7XA 4L9NA 2K27A 1SD4A 4AIKA 2EFWA 3HYIA 3I58A
chains in the Genus database with same CATH superfamily
4UXNA 4HAMA 4R79A 1Q1VA 2HQ5A 2P5LC 2GA2A 2EH3A 2L7MP 2QA4I 3ULQB 3TP3A 4BDZA 3KZZA 4AM3A 1VFCA 1JGSA 1FC3A 4HQEA 3A01A 2O5RA 3BR0A 3GTLJ 3OYMA 3CUQC 3L09A 4RGRA 3G1MA 1N75A 2XAFA 2LBFA 5JHUA 1DUXC 1FYMA 3H9GA 2OGGA 1YE9A 4YELA 2X1CA 3CUQA 4HDVA 2L01A 5FRNA 2RDPA 4A6EA 2V1XA 4P5OA 2B7EA 4B8XA 3GTMJ 3HJEA 3BG3A 2V6CA 3D0SA 3CO6C 2R7VA 2Z2SB 2EFOA 2RNJA 4KIGA 3F21A 1MJBA 2YUSA 1AWCA 2KISA 3S1NJ 1JHHA 2Y69H 2HZDA 3C2BA 1T8IA 2A69F 2M1BA 1ETVA 5BQTA 4L5IA 3VWBA 2P19A 3T8RA 3MCZA 3WTXC 4Z2YA 2FX0A 3BZKA 1U9NA 2W00A 5HLHA 1VI0A 3H3ZA 3OV8A 1RRJA 5EYRA 1B9NA 4IRHA 4ZDOA 2BY3A 3AL0B 4XOTA 3TOBA 2V9VA 3KPHA 2K9SA 1ETYA 2X85A 3ZQLA 4BE0A 2OCEA 1S72I 2HTSA 2FD5A 2OPTA 2QSFX 2LVSA 1XTAA 1SD7A 2Z5UA 1T39A 1Y56A 2TDXA 3GFJA 4PCQA 3W3CA 4CCMA 4XLCA 1HXDA 3BJ6A 2IA2A 3K7AJ 3LFUA 2BW3A 1Z3XA 2OQGA 3DPUA 1D3YA 1W7PD 4EQQA 1MMGA 2VXZA 4PFPA 2QQBA 3KZYA 2ZJQF 2ZO4A 1UG2A 1SANA 3F8BA 3FBNB 1P92A 3OYAA 4CCKA 4BACA 5IT3A 4OIRF 1SFXA 2CUEA 2ZXJA 3FMRA 5DTDA 4U0VA 3LHEA 1BJZA 4FQGA 4B09A 3ECHA 2LRDA 5CLSA 2XGXA 3F8NA 9ANTA 1QNTA 2DQRA 1UG0A 1XSDA 2NRAC 3OIQA 3RKWA 2ZB9A 3OYNA 2XC7A 2H8RA 3GX4X 1G3YA 2EFPA 1Z9CA 2KMUA 2D5VA 1ITYA 1R23A 3K70D 1OFCX 1ODDA 2Z3YA 2PFBA 1XCBA 5LRRA 1VQPI 4IPAA 3A1YA 4UB6C 2CFXA 3X2QH 3WU0A 4G6TB 3G3ZA 3H5AA 3PIOF 1MDMB 4OIQF 1IO2A 2VOOA 1JUSA 1AKHA 3RCOA 1XGMA 3CP8A 5EEHA 1O7FA 1S5LC 2GLOA 2X9DA 4I7HA 3SHFA 5B5EC 4NQWB 2DFFA 3E5UA 3IRRA 3S93A 1B8IB 3M7GA 4I0BA 3K4NA 1JTYA 2KRFA 3OYCA 3DTEA 5H6QA 1MMSA 2E19A 2HYJA 2Z16A 1K4SA 3FXUA 3FK6A 4N0BA 1HQCA 1L0OC 2KJCA 3H0DA 2LLKA 3M3YJ 4F52A 2OUMA 4R8HA 1YRNA 3ZQFA 2IP2A 4RDUA 4AU7A 4GO1A 4U0WA 5EG0B 2XAHA 1K79A 4GYIA 3CESA 4DIQA 3W2AA 4ZYHA 1BR4A 2YX4A 2BY2A 2HQNA 3R0JA 4JBAA 4B48A 3N4MA 3ZCOA 2NS0A 3I0TA 1FW9A 5GTHC 5JHFA 5FD5A 3F22A 1R5GA 2FBKA 1XSXA 3BLYA 2JPCA 2KZVA 4LK1F 1X1DA 3K4MA 3GLXA 4IEJA 3TO7A 4D5CA 1HW1A 2Q8KA 3BG7A 3K69A 2AXLA 3SDBA 3CC7I 4G7OF 5D5WB 3GFMA 3J80Z 1MNMC 3EDPA 1X58A 5M3FJ 2W57A 3GTJJ 3ISPA 3ZPLA 3M8FA 2GXBA 3E6CC 2XF7A 1W0UA 1OJLA 3HTSB 1EH7A 1ETWA 1OCOH 1E3HA 1I3QJ 4BYYA 4L9VA 1RIOH 1S7AA 3ABLH 2L9NA 1P4WA 4BS9A 4CYCB 1TP4A 3SXYA 4EJWA 2DW4A 3LQQA 1U8RA 1JKRC 2CQNA 1YX3A 3ONQA 3JREA 2XRLA 2ESNA 3OS2A 1D0XA 2FA1A 2F5FA 1QZYA 3TO6A 4KN7X 3WTTC 3QODA 3CJTB 5KNLA 3DFGA 1Y39A 2L7FP 2VKHA 6PAXA 1VZ0A 1FNNA 3IAM2 5JR3A 1Y1VJ 2EJRA 1IW7F 5ICFA 3MZYA 1AOYA 5LGTA 1PVEA 2L4MA 5HS7A 4XIDA 2COMA 1LDKB 3L2WA 4J01A 5BOXA 5ERIA 4XLHA 4ON0A 5E18F 2V26A 4BDYA 1YO5C 2DMNA 1D5YA 2KRCA 3VDXA 5DS9A 5IP6A 4I01A 4XKWA 2HFHA 2QKMB 2XRNA 5GPCA 2HQRA 2FQ3A 1R9TJ 5DEQA 2OZ6A 4XKVA 2L7ZA 1WPKA 2VC1A 3KCCA 2LP0A 2M34A 3L2UA 3K0LA 2FUG2 3REOA 1WFXA 1IXCA 2Y0SA 1H0MA 1ETKA 3GTPJ 2K3FA 2VASA 3A2KA 3C3WA 3GUDA 3CDLA 3KYLA 4ZZLA 4LITA 3BPVA 3FXOA 3PSFA 1X1BA 3WE3A 1FPQA 4HZFA 1POGA 4F3QA 3OS0A 5BMZA 1A5JA 2XKOA 1FZPB 3KEYA 1IRXA 2VBZA 1KZHA 2ZC2A 2KDZA 4N9HA 4OOIA 1P2FA 1GLNA 1FOKA 1OCRH 4XONA 1WJCA 5B66C 2CQKA 2JTVA 4IX7A 1TL8A 3ECOA 2OQRA 4PFOA 3ZN0A 2P7CB 2ZKZA 4W97A 4CCNA 2AQEA 3ASOH 4HQMA 2E71A 1K78A 1Z6TA 1XN7A 1RUNA 1YQAA 2R7OA 5IPAA 1WZ2A 4F91B 1U5TB 2XGCA 1FYKA 4ZZDA 4XM3A 1MSFC 1ZYRF 2RQPA 4IO9F 3CNVA 4ABZA 1ZREA 1WH7A 4NBQA 3H36A 3HSFA 4C2UA 3QAHA 2JRMA 2M4GA 1ZQ3P 1U0JA 1SMTA 4A3LJ 1Z0XA 4M6YA 4ESFA 3HRUA 5LRSA 1QA6A 3D5RC 2ESHA 2FNPA 3JCUC 3TDUC 2CMPA 2Y2ZA 3LQRA 2LH9A 2DDBA 2OF7A 1P6RA 4BUPA 3HRSA 2V1DA 2PMZN 2CS3A 2L9VA 3HC7A 2OU2A 4S0HB 5LBQA 3RI4A 1T56A 4EJVA 3H0GJ 5DM7F 1Y0UA 2B9SA 2M8EA 4XOPA 1APLC 4W1UA 2FOWA 2R5ZB 2A6HF 2M3AA 1CF7A 1WSUA 1Z05A 1GXQA 2MG4A 3IH3A 4AWXB 4HSTA 3O2PE 3LOCA 1SMYF 2H6BA 2F2EA 2EIJH 5LHIA 1W36C 5JFRA 1HKQA 4UUSB 3BY6A 2KIQA 2E2HJ 1JUMA 3SFZA 1EJ9A 1VQNI 2ZMEC 1XSVA 2M0CA 2UXXA 4MHGA 1BN5A 2JN6A 2R7WA 2NNYA 3IH4A 2GIVA 3O8GA 4IQJA 3FDYA 2A61A 4HW0A 2DFIA 4HLXA 2CQXA 1VQ5I 2Y75A 5E3MA 2ZMEA 1XS9A 5D6EA 2EIKH 3S32A 4RB2C 3OYIA 2JSCA 5AONA 4HPQA 2R5YA 4KDPA 2MBFA 1Q1HA 3BQZA 4CDGA 5CJ9A 5C4XJ 2RREA 3FXKA 3RDIA 3CCSI 2WV1A 1D5VA 3BCAA 3R60A 1I3AA 1QHHD 3SDGA 3CMYA 2DXIA 2E5ZA 5IYBJ 5J1RA 4M3FA 1KQ8A 4QWQA 2D45A 1ULYA 4RA2A 3S1QJ 4D0PA 3LSRA 1QZZA 2W82A 4OWRB 4Y17A 3RQIA 3ABUA 2E1CA 2L9SA 4O5VA 4Z6YA 2XF5A 4JOMA 5EZHA 2LK2A 2MD5A 5D4SA 2R7SA 4JX5A 1YTYA 1TT0A 2QQ9A 1YITI 4H0EA 2MABA 4UV8A 1TT5B 4GYGA 1O4XA 4EJUA 5EGOB 2P7VB 2EWNA 1OKRA 2IAIA 1XG1A 2FOKA 4KMFA 4ZC3A 3F9KA 4OAZA 3RIRA 4A3FJ 1XMKA 3GF2A 2QSHX 5J47A 1A36A 1IAWA 4XLNF 3FKJA 4E7ZA 4LLNA 1Z6RA 3RKXA 1OCPA 5E20A 1V54H 1BM9A 2BY1A 2BY0A 2HEOA 1IXSB 3VOEA 2BXYA 3QYFA 2K3PA 5CKTA 1A31A 4PGGA 2IGKA 4BJ6C 3J7AO 4EM1A 3ZMTA 2ZXWH 4DGWB 1HKTA 2NXNB 4F92B 3HOTA 2KRHA 4XQFA 1H88C 3AL0C 3PNVA 3JSOA 3OR1C 3ZOBA 2LG4A 2X4HA 4KYWA 4XSZF 2WY7Q 2CU7A 4UNOA 3K10A 2MC3A 1WJEA 4NB5A 1AA7A 4PUSA 4WXCA 3TOAA 4Y3OA 5J6XA 3FF5A 1W4MA 3CDIA 4E7IA 3HOYJ 3D1NI 3J7AY 1XGSA 4OMZA 4PDKA 4BEHB 3JRIA 2JQ7A 5LHHA 2RVCA 3MQ0A 3S3OA 1WHUA 1Z7LA 4IVNA 1JD3A 3K1MA 3GFLA 1IRGA 3GTOJ 3IAS2 4II2A 3EQLF 4CA0A 4A5NA 2BVLA 2JUGA 2MLKA 4M3EA 4I6ZA 2FE3A 1BA5A 5F0FA 1A6QA 1S29A 2AXTC 2ZFWA 1E3OC 5HODA 3GO5A 1N25A 2W4SA 1NG6A 2ME6A 2A68F 2ETHA 2F4MB 1O3RA 2DJNA 4XORA 2LY2A 2LKXA 3LA3A 2D2WA 3QYBA 3JRDA 1TQIA 2AO9A 3MWMA 5J1YA 2VC0A 1E2XA 4MTDA 3CCVI 5BPDA 1W36D 2VKEA 4ZYAA 4JK1X 4IL6C 4P9FA 2L5QA 3EUHC 5HLTA 3S1MJ 5D8LB 4ENKA 1EV7A 1JHFA 3IP4B 1U3EM 1ZGAA 1BJAA 3A02A 3ML6A 1MDMA 1FLIA 2HNHA 4RMNA 4Y33A 1WRJA 4YIFA 2O0YA 2NVXJ 4OIPF 2ZSIB 1G6NA 1J75A 2R7ZJ 3WGIA 1LQ1A 1MBJA 3HIFA 1LNWA 4FE7A 4FASD 5HS8A 2IA0A 2TCTA 4HYEA 4NQWA 4CHUA 1JGGA 2K5CA 4OAYA 2LFBA 3PQKA 4GRIA 1B8IA 5L3GA 4D1QA 2P6SA 3W6KB 3E7LA 3EYIA 3DTKA 3QYEA 4M3DA 5CQGA 2XUBA 2MYSA 5HDNA 2JMWA 3GVAA 3H5NA 4M3GA 3K4BA 4HBLA 2QLZA 2ZXIA 2DK8A 5EG0A 2IVMA 2J5OA 5JVGF 4QPQA 2OD5A 1T95A 3TO9A 4HRIA 3U2RA 2GQQA 1KQ0A 3DLAA 3LSJA 3I3LA 4Y52J 2JT1A 2OA4A 3FM5A 1MJ9A 3COAC 4MLOA 1UJ8A 3DLLF 3ZRGA 3BZ6A 5BNGA 5F1RA 4E7JA 3FX3A 2BYVE 3CZ6A 2ID6A 3VODA 3L00A 2VE8A 2PQ8A 5KCMA 5EF6A 3D5SC 2HWVA 3PFIA 4A2UA 2FSWA 2W1OA 4ZSIA 1PP8F 2DBBA 2DK5A 3QOEA 1G4DA 1E3PA 3FISA 5KHDA 4XBFA 3M9AA 1IN8A 1WCMJ 2CYYA 1JE8A 2EINH 2VE9A 3CCRI 2L4AA 2KIFA 1KU7A 3ZQQA 2CW0F 2DOAA 1ETQA 5JLWA 5FFXA 4CYCA 4BKXA 3OL4A 4MEYF 4WXDA 2NS8A 3ESWB 1RETA 2H27A 1R00A 4RAYA 3MFKA 2DMTA 2LR8A 3LA7A 4RGUA 3V4GA 2XPVA 1Z3YA 5M5WJ 2LTPA 3I5UA 3P5JA 3ZQ7A 1Z7UA 1OMIA 2BHZA 2MC4A 2DMPA 4DBQA 4YG2F 1GVJA 3ZP5A 1SVMA 2VQHA 4XNFA 2CRGA 4K2EA 3DBHB 2L7KA 1PDNC 1SFOJ 5F1JA 3UNGC 1LFPA 2MH9A 4LLGF 1OR7A 3IKVA 4L0ZB 1YW8A 5GAHJ 1LJ9A 1Z67A 4IOAF 5FKNA 2QKLB 1WGXA 3DU6A 1MKMA 1Y8RB 3KZIC 4IRGA 1FBSA 2PMZA 1DP7P 5HVQC 2FEZA 2O03A 5E8GA 1BIBA 1J5YA 4IQ4A 5FLXZ 3FBIB 4UV9A 3OYGA 2CGPA 1MW7A 4M3BA 4C3JJ 3GCMA 4MQ9F 3BTJA 2IKKA 1JKOC 5CVRA 3OSFA 4F7ZA 1JI8A 5DD8A 3BG9A 2HXIA 2NOGA 2V7FA 2LOOA 4EVIA 4EJOA 1W0TA 2VOPA 2NVYJ 2UUZA 2QEXI 1JJ8C 1X3WB 4ZTFA 1QVUA 1QQIA 1STZA 3CCMI 2BVMA 4LGWA 2K02A 3HL2A 4L5EA 4ANJA 1JTXA 1F9NA 5GADJ 4CZZA 2BHYA 2GXGA 3A4CA 1K83J 2DU9A 4BGDA 2YR2A 4YEJA 1XD7A 5AIQA 4LIUA 1U5TA 2LYCA 1IN7A 3J81K 4KFCA 5IY5H 1G2HA 4E7SA 4TV7A 4LG0B 4XL9A 5CVJA 2XB5A 2H1KA 1OPCA 4P1WA 1YFHA 2FA5A 4UUTA 1R6RA 2ID3A 1RZ4A 3QRFF 3NAUA 2IPQX 1RPWA 2JUCA 4CZCA 2H8WA 2ZFUA 4EV0A 3JRHA 3HG9A 1XDUA 3VSLA 4Y15A 3KP5A 4G6QA 4P96A 3NARA 2EILH 2RC4A 2VJ5A 2GM4A 4PJJA 3WU2C 2HGCA 4DYQA 3LSGA 1BW5A 1LVKA 4IZZA 1T38A 1SAXA 2R5ZA 1USSA 2WADA 1EF4A 5F27A 1X1CA 1R1VA 2EV0A 5GTIC 2L3DA 3QP5A 3KE2A 2LNBA 5K7ZA 4MGRA 3F8LA 1E17A 1FP1D 2DOEA 3PM1A 1U9OA 1OYIA 1IGNA 5ILSA 4FISA 4G8XA 4RS8A 1J59A 3BOQA 3BG6A 5GPAA 2EZLA 5L3BA 2VJIA 4IHWA 3GYHX 5KVRA 1YHQI 3ZQCA 1MBEA 1FEXA 2HS5A 3DEUA 4UUSA 1LE8B 4A3BJ 5IT9Z 3I59B 3TKYA 1WH5A 2WAFA 4XKCA 1VQMI 2HXOA 3K2ZA 2M87A 2H94A 1X1AA 3D5LA 2WB1N 3BTCA 5M3MJ 5FROA 4XRSA 1XCVA 1RKTA 2IJLA 2OTLI 4D7NA 2R7FA 1I1GA 2DYSH 1P4AA 4MFEA 3MKWB 1HLVA 2F5VA 3S2DJ 4H4KC 4BHPA 3QQAA 4A3KJ 3SFIA 3M4OJ 4IJAA 3JAMZ 2VKVA 1KU9A 1F5TA 3CJRB 1ZRFA 3H3VK 4JYKA 2CWEA 2E5NA 4X6AJ 1KGSA 2PN6A 3ZQHA 2KP6A 2KIMA 5L3EA 4ZSKA 1WJFA 3DWLE 3KP2A 1MZBA 1TC3C 2WAEA 4GGGA 4A3GJ 3H5RA 1V5EA 3KLOA 3MD2A 1BR2A 4I0AA 5B1BH 4P9UA 4ZTJA 5FRMA 2NWIA 2VXDA 3HOWJ 3PFYA 2ZJRF 1VTNC 3BJOA 4NC8A 2V9PA 2RN7A 5K1YA 4ITVA 4AD9A 5EGOA 3N97A 4Y4RA 4XLFA 1I27A 1IV8A 3VYTB 3WE2A 3CC4I 3HDDA 1Y1WJ 2PKHA 3U1DA 4G12A 1D1CA 1MMDA 1QZEA 4PZJA 2M7BA 3FXQA 3FXMA 4RB1A 4F55A 2M2EA 3CMMA 2K85A 4BBSJ 3FZVA 3JRFA 2W84A 4BY7J 3A0BC 4G9YA 1H89C 2GXAA 1MBGA 2L9RA 4PJMA 3PO2J 2RGVA 3GW2A 2KLOA 3F8MA 1ZGJA 4A5MA 1IN4A 3R6SA 1MH3A 1WI9A 3SJMA 4RAGA 3E5QA 4DW6A 1UCRA 2IGOA 4BJ5C 4BE1A 2E1MB 4KIBA 3C7JA 3I54A 3E1SA 2VPLA 5D5VB 4G6DA 3SQNA 1XGNA 1MMNA 1U8BA 4RM3A 3LWFA 3V8JA 1TNSA 2A5WA 5ED4A 2Z9OA 3HOUJ 3M07A 2PBIA 2K9LA 3DBLB 3BDDA 4NUBA 2BGCA 5C4JJ 3DQVC 3UR3C 3HEFA 1NTCA 2ICWG 4A0XA 1TWAJ 3K4CA 2JA7J 2STTA 3I64A 2KT0A 3CO7C 4ASNA 2E34A 2ELKA 1G3WA 3BCBA 3U21A 3M8JA 3KETA 4EGZA 3V8KA 3JTHA 2NVUB 3GWZA 4B3AA 4A6DA 2VJJA 4G7HF 1FWZA 4LG3A 1O7LA 2CW7A 2VLAA 1YG2A 2A05A 4XN0A 3ABTA 1ZHFA 5DYMA 2VQCA 1T08B 3V7RA 3RJPA 2P81A 1FOWA 2AHQA 1Y8QB 1OCCH 3F3XA 5B3SH 4A3MJ 2HDWA 1D0YA 5ICCA 5FO5A 2NVTJ 2LMDA 4A69C 1ZR2A 4IRIA 4GCVA 2K40A 3TBIA 2CFOA 1HW2A 3OMYA 2DMUA 4LK0F 1FY7A 3A0HC 2E7WA 4RAFA 2UZKA 4L0YB 2XSJC 2LKPA 5FKKA 1YX5A 2XF6A 2HKOA 1TTYA 2M30A 3O3KA 5FFZA 3ASNH 1YOVB 3EPZA 3WGHA 2JPBA 2L02A 2DODA 2QGUA 4II3A 4RGXA 4L18B 3BR1A 1O3TA 1QVTA 3HHGA 1S9HA 4B47A 3G73A 1XPXA 2O9LA 4U7DA 3PJRA 1S7OA 2RAEA 1ACIA 2VPRA 1J9IA 1TT8A 2XGDA 4E6KG 3ZMVA 1FBQA 5FB2A 1D0ZA 2E60A 1T33A 1TQPA 3Q0VA 2PMUA 5C3EJ 2UXNA 4R1HA 3ZN1A 3W6JB 2VJ4A 2LREA 3S2HJ 3TDZC 3GTKJ 3L2RA 1AHDP 2HPMA 3I55I 3F6OA 2XGEA 4S04A 5GAGJ 1VNDA 5KAIC 2WV0A 1IUFA 1NH3A 1R7JA 4JX6A 3IWFA 5IP7J 1G8XA 3HGGA 1PUEE 2XVCA 2BE5F 2YX7A 3CMAI 2IS2A 4LIVA 4BHBA 2XROA 2MLGA 3Q5FA 1H9GA 5J4YA 2DCEA 2NS7A 4HNTA 3CUOA 3J7YJ 2PX9A 2HVRA 4MQVA 2O6GE 1JUPA 1ZELA 2ECCA 3F8FA 2FMLA 4NC7A 3IRQA 1ERDA 1TZLA 2H09A 5J8FA 4E4HA 3F6VA 4RAZA 3N05A 5ILVA 1BI0A 4XLPF 2PJPA 2DT7B 2R4GA 4BHCA 4C3HJ 3C2GA 1UAAA 3O6BB 4A3CJ 3S2WA 3BTIA 1U78A 5IOZA 4UHTA 1ON2A 3PUFA 1YW7A 3VFZA 2K4BA 2EPFA 2KKOA 1NG7A 2KDOA 5D5UB 2YSRA 2MD0A 3TL4X 1F36A 4Q47A 4N4OB 2V9KA 1HF0A 3OOPA 2VBWA 4BQOA 4CSWA 1JXSA 2DT5A 2M0MA 2VODA 1YLFA 4PSWA 1UHMA 5TISC 3RKQA 2ZSHB 2IXSA 1RC9A 1V4RA 2FXAA 3DKWA 2DN0A 2RQQA 2B63J 4CCJA 1BOAA 1EA3A 1QGPA 3UKGA 1O57A 1X4PA 1QBJA 3KYCB 2EA2A 2P0WA 2IBDA 3FHZA 4QLCU 1HKSA 2HOAA 2M9HA 2QM3A 4LLLA 2A6EF 3VSKA 1ZK8A 2YPRA 3W6VA 2CJJA 2NNNA 5CQEA 4C2MJ 3RZOJ 3NWSA 5E8IA 4MFDA 3LSIA 4I2OA 3RKYA 1UMQA 4IHXA 5TGTA 2DAOA 2DO7A 3BJAA 5CYVA 3AG4H 4ZDPA 1YJWI 1DQUA 1BI2A 5CPRB 2VIXA 1MBHA 2ISZA 1X19A 3CMEI 3L5ZA 4ZH4F 3HZJA 2V79A 2DTRA 2X6XA 4M74A 3IWZA 3MKYB 2BXZA 2RNGA 3FXLA 1NK3P 1KU2A 3CF5F 3B6AA 3CP2A 3MZHA 4EATA 1WJBA 1SEUA 3OOUA 3V7CA 4EJTA 2QVOA 3LMMA 2VI6A 1FP2A 4HX4A 2F48A 4FHTA 1ZR4A 4CGZA 3QU3A 2WB1A 4EEFG 4B3XA 5H20A 5DUIA 5J4VA 1SAUA 1ZLKA 4HX8A 1RKWA 3WTSC 2QUFA 3MKLA 3FXRA 4D9JA 2F5DA 2PG4A 3G6EI 3GLLA 5HNHA 4LG0A 5L3CA 2HU9A 2XSDC 4ENMA 3SEZA 4GDFA 1DP3A 1KYZA 4CICA 3R61A 1NK2P 2G0EA 3DXJF 3PQJA 5D6FA 1FOYA 3K4LA 4PJNA 1IC8A 3JRGA 1PP7U 1BW6A 2HVQA 3CCQI 3NEUA 1UHWA 1DU0A 1MNEA 2YS9A 1OYYA 2E1NA 4V19K 4CCLA 4DNCA 5LGUA 2DA2A 3DEWA 1D1AA 3E6BA 4WXHA 4BXUA 2DA1A 5LEJA 1WJ5A 1G81A 2A6TA 4G7ZF 2PLYA 4WK8F 3S3MA 3AKZA 1J0RA 2MA3A 2LY9A 2Y48A 3FKIJ 4KA4A 5H6RA 4XLEA 1YI2I 3NWTA 2GIZA 3I4PA 4BBRJ 3BR2A 5L3FA 1I5ZA 1R1UA 1GXPA 3DDVA 4QSHA 5M5XJ 3CJQB 1S7EA 3HPHA 3GFIA 4HOBA 4LJZF 3LSTA 5HNFA 1GV2A 2QBYB 3QWLA 4KMUX 2CUJA 2Q1ZB 4IHSA 2HI3A 4CYDA 4HDUA 1LE8A 1QU3A 3VYRB 3I59A 5JVTA 3DKYA 4QIWN 3P9CA 2VUMJ 2QQ8A 2CUFA 3DF8A 2R7TA 5F0CA 4CCOA 4I99C 5JI6A 3LAPA 1W1WE 2XB0X 3H9QA 3KIOA 4A12A 3IC7A 3BC8A 2CQQA 4MIMA 2I10A 2ZBKA 4Q5SF 1OISA 3P9IA 3C1DA 2DT6A 2CH0A 1VQ7I 2E2IJ 2E36A 1Z21A 3GTGJ 2X1EA 5CVUA 5CVIA 1FT9A 1WWXA 3I9V2 4FE4A 3WGGA 1IN6A 3H1CA 1XLRA 2RA5A 2EZIA 3DPTA 2KJBA 3HPGA 1DU6A 1U6GA 4UVBA 3HUGB 2CO5A 3ERMA 2LD5A 3OYBA 2X48A 1WJAA 1FMVA 4M72A 3M1CA 2OAZA 5DUKA 4HF0A 1PYVA 1S8NA 5DCMB 3FMQA 4FTHA 2F4OB 2ZNZA 3Q9VA 2X6WA 1VQOI 3RYRA 3OR2C 2EV6A 2FMYA 2HPIA 3LNQA 2VQLA 2Y31A 1JJ6C 5F0HA 3WU1B 3RPUA 4EMSA 1ZAOA 3E6DA 1VF9A 4A3JJ 5E1WA 3K1PA 5K7HA 4LB5A 2W24A 1OCTC 1EH8A 4L5JA 4BL0B 3BQYA 3E0JB 1LVAA 1IV6A 4BU2A 2O8KA 2BOLA 5FGMA 2GWRA 2VBYA 3R4KA 1HSJA 1UFMA 2XAUA 1DPRA 4QPOA 3IUOA 5DV5A 3OYJA 2G7UA 2HR3A 3IKTA 1GT0C 1IG7A 1USTA 3RZDJ 5F6FA 5HDGA 3CQZJ 2W48A 3AFHA 4D7MA 1VQ4I 3VPRA 3BWGA 5FJ8J 3JR9A 4AC0A 3ELKA 2DA7A 3I56I 5E1ZB 2HDCA 1XC5A 3GMEA 4DBRA 3HSEA 2X6OA 4DZJA 2E1MC 1QO0D 1SD5A 3QPLA 4GXOA 3JW4A 1LEBA 3T0YA 4NC6A 2N8GA 4IOCF 3S3NA 4PK4A 4WF2A 2HOSA 3VYSB 1XX5A 3WG7H 3H92A 1MBFA 1OR7C 1X2MA 2ADUA 4AIDA 4YFNF 4FX4A 2IS6A 5HS9A 4OU0A 5C44J 2GOMA 3WHCA 1MJAA 1A04A 5LD2C 2R7XA 2VT3A 2OZUA 1R1TA 4DYRA 2QYOA 2L0KA 4IXAA 1ZTRA 1ZARA 3S14J 1KA8A 3HRTA 5E3NA 5LGNA 4ZYGA 4LD5A 1ZLJA 1OYWA 5J3LA 4G94A 3T1BA 2VB6A 5HOOA 4WWCA 1HDPA 4A3EJ 4S05A 4PJLA 3LL7A 5EEGA 3ZQGA 1DPUA 4OMYA 4YIRX 4EGYA 5BPIA 1D8KA 1FIPA 5LFAA 1LUJB 1HA8A 2WAQA 1R36A 2GBYA 3K4KA 1VQKI 4M6VA 1RESA 1U5TC 2JVGA 3CF2A 2Y0MA 4UUVA 5F08A 1ON1A 4C3IJ 4YRVA 3WTWC 2PJRB 3Q9SA 4HA8A 2JRTA 3BZCA 4GFBA 2IEKA 3TW7A 1ZH5A 4BY1J 4KISA 2DA5A 4YFXF 4WX9A 1HCRA 4LB6B 1W5TA 1K61A 1SVOA 3R0AA 2F5EA 4U88A 5TJJA 1V55H 3OIOA 3SZTA 2K86A 3K2AA 5A2QK 3V8LA 2R7QA 2R92J 2Z33A 4IHTA 2XHKA 3FM3A 3CLQA 2QWWA 2KZGA 2BBYA 1TBXA 2XKPA 3KEOA 1KYWA 5E79C 4PJ0C 2M5WA 3HKZA 2FBIA 3BR6A 2DA4A 4BQAA 1I50J 2R7DA 4XLAA 4HSRA 1LFUP 3GZ6A 3RSNA 1L3LA 4RLQA 2F5CA 4AYBA 1B6AA 1FMWA 2EK5A 2KL4A 3RPUD 3HOZJ 4AVZA 2C6YA 1V3FA 4B44A 2VONA 2OCCH 3PNTA 2DPUA 3L2QA 1YIJI 1K4TA 2B0LA 3JTGA 1K7AA 2DJIA 2WY8Q 3G2BA 3KP3A 4ZJZA 3QPSA 3OYDA 3NRVA 4BXFA 3ABMH 3H35A 5F04A 4E7KA 3OY9A 4EM2A 4NHJA 3KX2A 2V6EA 1FSEA 2HVSA 1SD6A 4AIHA 2DLLA 4LFUA 3ZMDA 3F0CA 2V1NA 2D1VA 4ENNA 1ZRCA 3M8EA 4IF4A 2STWA 5IOYA 3MVPA 4NDLA 1G3SA 1RUOA 5E1XA 1ZKGA 4CH7A 3PO3J 1I39A 4MTEA 1T2KA 1K6YA 3H3UA 3RTRA 3BR3A 2H1LA 4ETSA 2P5KA 4XICA 2G7HA 1ONVA 1VQLI 1HW5A 2Q2EB 5J8CA 2K4JA 2K7LA 1EH6A 2XV4S 4A3IJ 1AU7A 1WI3A 4X0GA 1LB2A 2Y30A 2K9QA 1HBXG 2A07F 3KP6A 3TGNA 2NOJB 4CO8A 2EFQA 3P9KA 4EM0B 2O61A 2NYXA 1Y6IA 2OC6A 1RR7A 4M9ZA 4HNUA 2GZWA 1V5FA 2VBXA 2EA4A 5K7FA 1LFBA 3AAFA 4I02A 2Y9ZA 4OINF 5LHGA 4HLYA 2VN2A 2Y9YA 3WTYC 1G1BA 3OIPA 4DOZA 1W7PB 1BC7C 2E2JJ 3L1PA 4BQQA 1XMXA 2WBMA 2BV6A 2DI3A 3L2CA 5H2FC 1R22A 1H9TA 1VQ8I 4PSXA 3F23A 1VQ6I 4KT6A 3KYDB 4KUMA 1HSTA 3WG9A 2JZYA 4O3MA 2CSOA 3S16J 1LKXA 2TRTA 2LKSA 4XK4A 2YU3A 1J2XA 2AS5F 1TQMA 3SYTA 5HLGA 2J5PA 3NQOA 3V42A 2P8TA 4RB0A 2X0LA 2XIGA 1XDSA 3U9GA 4KIFA 1G3TA 3HBLA 3MAJA 3MEXA 5IP9J 3G4SI 3DPLC 1BL0A 3BPXA 1PUFB 2WC2A 3I4MJ 3TW6A 2HYFA 1OLTA 1W5SA 1B4AA 1D8JA 2KQRA 3WTUC 3QP6A 3OYFA 3TEDA 4CUGA 1PJRA 3DV8A 1MSEC 4LMYA 1VQ9I 3BG5A 3TMOA 5EZGA 4UY8I 2O8XA 2PMHA 1LDJA 1YS6A 2DA3A 3F72A 3KLNA 4KJZA 2P4WA 4OIOF 1IRFA 3DTIA 3TP0A 3LSHA 3E5XA 5GAEJ 3PUBA 1F43A 1MBKA 4HEA2 3CCJI 1I6HJ 1TWHJ 5D5XB 1O3QA 1B72B 4BEHA 3BP8A 1ZRDA 4FETA 4FCYA 2MW8A 2CV2A 4I09A 3G71I 2COBA 4HF1A 2HZTA 1X1PA 1GHCA 2GA1A 2XPUA 5KAFC 3QU6A 4A0ZA 3BR5A 3GZNB 3A01B 1BI1A 5CVVA 1WJDA 3B02A 2QSGX 1EKEA 2KHMA 5DCFA 3FWEA 3AG3H 2K9NA 2LBFB 4ZYEA 3CTAA 3SZPA 3I53A 4KICA 1FX7A 4RGSA 3CJNA 2XAQA 3T5XA 1WVRA 4YFKF 3CUQB 1B59A 1YW9A 2EZHA 3J81Z 3RPQA 4RLFA 1FJLA 3PIPF 1QHGA 2FRHA 1P4XA 2GOXB 2WA0A 2R93J 4HF2A 3HHHA 5EEAA 1G59A 2EQRA 1Y0NA 4ENJA 2Z1DA 2Z99A 1OQYA 1TWCJ 1T0FC 1S6LA 3BTLA 2VT2A 3S8PA 3C2HA 5A2QZ 2UWMA 3LA2A 1R58A 2DQLA 3K6GA 2R7RA 2DOFA 4M73A 3JRAA 1IXRC 1T0FA 2M7AA 3GEZA 2MH2A 4L9TA 1JKPC 2QBYA 4NNJA 1IDZA 3CLOA 2XDVA 4ESJA 3O8HA 1MD0A 1FIAA 4ZDLA 2LF8A 2OV7A 1GVDA 3EYYA 2M8GX 3GBGA 1RI7A 2JA8J 2MGQA 1ZN2A 5ICGA 4KN4X 4KNYA 3GZ5A 4BE2A 3HRMA 3S1RJ 3HM5A 3PL8A 1GV5A 1QPMA 2BEOA 2HQAA 3G1LA 4BH9A 4E7HA 3OSGA 4MEXF 2HOEA 3OS1A 1P9QC 2CV0A 5ILUA 3GXOA 1FBUA 2OBPA 3DEEA 1X3ZB 1ENHA 3HB9A 3DBRB 1JKQC 1ZG1A 4XRFA 3HUGA 1RNLA 4MO7A 4XRMA 3IV5A 2NVQJ 2AQFA 2DMQA 3HSRA 2R0QC 1YS7A 1WKMA 2QQAA 3DCFA 5DCMA 4C30A 2BW3B 1UZCA 4I76A 4DQ2A 4P55A 2ME0A 4IHVA 3OYEA 2LC2A 2VKDA 1QPIA 1W5CC 2PEXA 1MNDA 4JP0A 4E7LA 3CCUI 1I1SA 2WAQN 2VQGA 2D1HA 1UELB 2LDUA 2ACJA 4L9JA 1A35A 3FIWA 2IW5A 2BZTA 3RQ4A 4LOCA 3G1OA 3BT9A 5GP9A 4FX0A 3SEQA 2ZJ2A 2XPWA 4IKFA 5DD4A 5HLIA 4KT5C 1R71A 1SVLA 3K9TA 2L2OA 1O3SA 3S15J 3ZGKA 1T6SA 3Q0UA 2ISYA 1YYVA 2XAJA 4MNUA 3JRCA 3ROUA 4XKBA 1OCZH 5B1AH 2WWYA 1JT0A 2X1DA 5J40A 3A03A 1DGRM 2O7OA 2M4KA 2CUZA 4HV5A 4J19A 1T98A 2M45A 1R49A 1KQ9A 3HGYA 1R4MB 3ABKH 1SFUA 1AKHB 4ZSBA 1X3UA 1Z1DA 1JT6A 1HDDC 4PGHA 4Y13A 2EV5A 1XB4A 1V5GA 3BROA 3HKZN 2KFDA 3HOSA 4V2FA 1M1EB 2PI0A 2HYGD 5FD6A 3KFWX 4AYBN 4HV6A 2IGMA 3SZGA 1IJWC 1GUUA 2FF4A 2X51A 4V2GA 4RB3C 3ZQIA 1DDNA 1FOXA 3VB2A 1H8AC 1KU3A 5ICEA 2W25A 1YRNB 2DFEA 3AG2H 5FLMJ 2IA1A 5E3OA 4Q4ZF 3CD6I 2A3SA 5FKLA 3B6CA 1IZ1A 2DFHA 2IS4A 1YJNI 3B73A 2ELHA 2HTJA 5DM6F 4HNVA 3M1EA 3VEPA 2JA6J 2F6CA 4XR6A 3ZMUA 3I4NJ 4X1EA 1B1BA 2CQ7A 2FQ4A 4RBOA 3WTVC 3KP4A 4QTRA 5F64A 2R3SA 1IUYA 1FTZA 4U7BA 1U2WA 2LF7A 4N9IA 3K4JA 1DGWY 1R5ID 4M6XA 3L9FA 5EDNA 1D1BA 2RV8A 1MGTA 2Q0OA 1FSHA 3E97A 3P7NA 5KK1A 1ZG5A 5FKOA 3LAJA 3HFIA 5HDKA 2JSPA 4Q48A 1BR1A 3MKZA 3Q3SA 4ESBA 2FJ1A 2I5UA 4RM2A 3PSIA 1BC8C 2QZ8A 4HX7A 3HTUA 4M9XA 5LLQA 2F4IA 2JA2A 1IDYA 4DYCA 3FMSA 3GTQJ 2QENA 2AHCA 2CG4A 2ECBA 2EB7A 5K5OA 1K6OA 2PJRA 3MMYB 2OOIA 2JWTA 2FNAA 5FLXK 3FHNA 3IH2A 5DDGA 3FK7A 2CV1A 4U87A 4D5FA 1BIAA 3LSMA 4A0YA 2HKXA 2P6TA 5D8KB 1R5HA 1X4OA 3JSPA 1C0WA 2XAGA 2JJ7A 1FYLA 2OTJI 1REPC 3PNYA 1F4KA 3LSPA 2JVHA 3DU5A 4BXXJ 5TRDA 2QCOA 1P7JA 1TW3A 4BQNA 2LY1A 2P5VA 3QPHA 4KITB 5K5QA 3OYHA 1SC7A 3W2VA 1MMAA 2X6YA 1R4NB 3K1NA 2V4JC 5E17F 1TNTA 3KP7A 1BBYA 4XN3A 1GDTA 1LEAA 3DKXA 2KIUA 3TQNA 3JRBA 2MSYA 2UV1A 2IT0A 1CGPA 5K5RA 4UVAA 4XMYA 4IHYA 2H6CA 2ZNYA 3LFKA 1J09A 3IHUA 2DDAA 5J1UA 2ZCWA 1TWGJ 2E1OA 2E35A 1ETXA 3EUAA 2YU9J 1TLHB 3I71A 4E70A 5BS6A 2R7UA 2FBHA 5FKMA 1TW2A 2V1UA 4N4NB 1N78A 4DJAA 3CDHA 3QPTA 3V7SA 2LSOA 3VYUB 2IRFG 1K78B 4UVCA 1S3JA 5L3DA 3L2VA 2G9WA 1FTTA 3WTZA 1RR8C 2EBIA 1N77A 4CXFA 2EIMH 3HXLA 2DA6A 4BNCA 2Q2EA 5AIPA 3WHBA 1UHSA 5IYCJ 2HOTA 5EJCA 4JX4A 3HOXJ 4A3DJ 1IRZA 3U1KA 3EETA 4XSXF 2FU4A 3ZR8X 2A5YB 2NAZA 3EUHA 4UB8C 2DTZA 2L54A 4JQFA 3MN2A 2ELJA 3ZXSA 4BAYA 5FLVA 1IF1A 3HOVJ 4WCGA 1E0EA 5IT9K 3Q0WA 4A93J 3E3VA 4F93B 4J00A 1TWFJ 3OL3A 3J7ZI 2W7NA 1CQTA 3KEQA 3W2WA 2DPDA 2MFZA 1W7PA 2OJED 2WTEA 2JA5J 3CCEI 3MZ8A 3CCLI 5IYDJ 2Y0SN 1CF7B 1YJ9I 1XMAA 4AVPA 2O3FA 3F8CA 1ORKA 1LPQA 3QOPA 1UB9A 4Y7NJ 4B1RA 1YIOA 2KPMA 2IGNA 1MH4A 2K9MA 4XRSG 2HDDA 3C18A 3E6MA 5E3LA 1BI3A 4O6JA 5JLXA 3K70C 1SFEA 4AIJA 1Z77A 2W85A 5M5YJ 3JAMK 3CC2I 5LEKA 4B4CA 4HG2A 4YIIA 2CW8A 3RYPA 1QRYA 2RKHA 3LSKA 5D4RA 3WODF 1ZG3A 1HC8A 1PUFA 1BOBA 1I6XA 1SFKA 1B9MA 1IN5A 3ZMZA 1F1ZA 2XASA 2ZXHA 4B43A 1LDDA 2ZMEB 3IL2A 2ZJPF 3ZMSA 2EZKA 1ZGWA 3H9JA 1J7KA 2DYRH 2R5YB 1WQ2A 4I98B 4M9SA 3OYLA 1NHAA 1ETOA 2I8DA 3OYKA 3ERED 2GAUA 4M71A 4FT8A 4C2TA 3L7WA 1XGOA 1X2NA 3J80K 2EFNA 2QF7A 4ZYDA 1KONA 1A6IA 4C9YA 1HOMA 3CCYA 4U0YA 1Z91A 3T8TA 3DP7A 2E7XA 1P7IA 4L9NA 2IS1A 2K27A 1SD4A 3EUKL 1MIJA 4AIKA 1B72A 2JK3A 4AUXA 3OWTA 4DZPA 2EFWA 3AG1H 3HYIA 3FXJA 2VL8A 3S17J 4BJTA 3I58A
chains in the Genus database with same CATH topology
4UXNA 4HAMA 4R79A 2P5LC 2GA2A 3ULQB 3KZZA 1JGSA 1FC3A 4HQEA 3CUQC 3L09A 4RGRA 2XAFA 5JHUA 1DUXC 1FYMA 2OGGA 3CUQA 4HDVA 2L01A 2RDPA 4A6EA 2V1XA 4P5OA 4B8XA 3D0SA 2V6CA 3CO6C 2EFOA 2RNJA 4KIGA 3F21A 1MJBA 1AWCA 1JHHA 2A69F 2M1BA 5BQTA 4L5IA 2P19A 3T8RA 3MCZA 3WTXC 4Z2YA 5HLHA 3H3ZA 3OV8A 1B9NA 4IRHA 3TOBA 2V9VA 2HTSA 1SD7A 2Z5UA 1T39A 2TDXA 3GFJA 4PCQA 1HXDA 3BJ6A 2IA2A 2OQGA 1D3YA 1W7PD 4EQQA 2VXZA 2QQBA 3KZYA 2ZO4A 3F8BA 1P92A 5IT3A 4OIRF 1SFXA 3FMRA 2ZXJA 3LHEA 4U0VA 4B09A 3ECHA 5CLSA 2XGXA 3F8NA 1QNTA 2DQRA 1XSDA 2NRAC 3RKWA 3GX4X 1G3YA 2EFPA 1Z9CA 1R23A 1ODDA 2Z3YA 2PFBA 1XCBA 5LRRA 4IPAA 2CFXA 3WU0A 3G3ZA 1MDMB 4OIQF 2VOOA 1XGMA 5EEHA 1O7FA 4I7HA 3SHFA 3E5UA 3IRRA 3M7GA 4I0BA 2KRFA 5H6QA 3FXUA 4N0BA 1HQCA 1L0OC 2KJCA 4R8HA 2IP2A 4GO1A 4U0WA 2XAHA 1K79A 4GYIA 4ZYHA 4JBAA 2YX4A 2HQNA 3R0JA 3N4MA 2NS0A 3I0TA 1FW9A 5FD5A 3F22A 1R5GA 2FBKA 1XSXA 2JPCA 4LK1F 3TO7A 3GLXA 1HW1A 2Q8KA 3K69A 2AXLA 4G7OF 5D5WB 3GFMA 3J80Z 3EDPA 2W57A 3ISPA 3ZPLA 3M8FA 2GXBA 3E6CC 3HTSB 1EH7A 4BYYA 4L9VA 1RIOH 1S7AA 1P4WA 3SXYA 4EJWA 2DW4A 3LQQA 1U8RA 2FA1A 2ESNA 2F5FA 1QZYA 3TO6A 4KN7X 3WTTC 3DFGA 6PAXA 1FNNA 5JR3A 2EJRA 1IW7F 5ICFA 3MZYA 1AOYA 5LGTA 2L4MA 5HS7A 2COMA 1LDKB 5BOXA 5ERIA 4ON0A 5E18F 1YO5C 4I01A 2HFHA 2XRNA 2HQRA 2FQ3A 5DEQA 2OZ6A 2VC1A 3KCCA 3K0LA 3REOA 1IXCA 1H0MA 3C3WA 3GUDA 4ZZLA 3BPVA 3WE3A 5BMZA 1FPQA 4HZFA 2XKOA 1FZPB 2VBZA 4N9HA 4OOIA 1P2FA 1FOKA 2CQKA 2JTVA 3ECOA 2OQRA 3ZN0A 2P7CB 2ZKZA 4HQMA 1K78A 1Z6TA 1XN7A 1RUNA 1YQAA 1U5TB 1FYKA 4ZZDA 1ZYRF 2RQPA 3CNVA 1ZREA 3HSFA 3QAHA 1SMTA 4M6YA 4ESFA 3HRUA 5LRSA 2ESHA 2FNPA 3TDUC 3LQRA 1P6RA 3HRSA 2V1DA 2OU2A 5LBQA 3RI4A 4EJVA 1Y0UA 2M8EA 2A6HF 1CF7A 1WSUA 1Z05A 1GXQA 4AWXB 3O2PE 1SMYF 2H6BA 2F2EA 5LHIA 5JFRA 1HKQA 3BY6A 3SFZA 1XSVA 4MHGA 2UXXA 1BN5A 2NNYA 2GIVA 2A61A 4HW0A 2DFIA 4HLXA 2Y75A 2ZMEA 5D6EA 4RB2C 2JSCA 5AONA 4KDPA 2MBFA 1Q1HA 4CDGA 5CJ9A 3RDIA 1D5VA 3R60A 1KQ8A 4QWQA 2D45A 1ULYA 4D0PA 1QZZA 4Y17A 3ABUA 2E1CA 4O5VA 2MD5A 5D4SA 1YTYA 2QQ9A 4H0EA 4UV8A 4GYGA 4EJUA 2P7VB 2EWNA 1OKRA 4KMFA 2FOKA 3RIRA 1XMKA 3GF2A 1IAWA 4XLNF 4LLNA 1Z6RA 3RKXA 5E20A 1BM9A 2HEOA 1IXSB 3VOEA 4PGGA 3J7AO 4EM1A 3ZMTA 1HKTA 3HOTA 3JSOA 4KYWA 2X4HA 4XSZF 4UNOA 2MC3A 5J6XA 4NB5A 4WXCA 3TOAA 3FF5A 1W4MA 1XGSA 4OMZA 4PDKA 5LHHA 2RVCA 3MQ0A 4IVNA 1JD3A 3K1MA 3GFLA 1IRGA 3EQLF 4A5NA 2MLKA 2FE3A 1S29A 2ZFWA 3GO5A 2A68F 2ETHA 1O3RA 3LA3A 2D2WA 1TQIA 3MWMA 2VC0A 1E2XA 4MTDA 5BPDA 4JK1X 4P9FA 5D8LB 4ENKA 1EV7A 1JHFA 1U3EM 1ZGAA 1BJAA 3ML6A 1MDMA 1FLIA 4YIFA 1WRJA 2O0YA 4OIPF 1G6NA 1J75A 3WGIA 1LQ1A 3HIFA 1LNWA 5HS8A 2IA0A 4HYEA 4NQWA 4CHUA 3PQKA 5L3GA 2P6SA 3W6KB 3EYIA 2XUBA 5HDNA 3GVAA 4HBLA 2QLZA 2DK8A 2IVMA 2J5OA 2OD5A 3TO9A 3U2RA 2GQQA 1KQ0A 2JT1A 2OA4A 3FM5A 1MJ9A 3COAC 3BZ6A 5F1RA 3FX3A 2BYVE 3VODA 3L00A 2VE8A 2PQ8A 2HWVA 3PFIA 4A2UA 2FSWA 4ZSIA 1PP8F 2DBBA 2DK5A 1G4DA 4XBFA 3M9AA 1IN8A 2CYYA 1JE8A 2VE9A 2L4AA 2KIFA 1KU7A 2CW0F 5FFXA 4MEYF 4WXDA 2H27A 1R00A 4RAYA 3MFKA 3LA7A 4RGUA 3V4GA 3ZQ7A 3I5UA 1Z7UA 1OMIA 4YG2F 1GVJA 3ZP5A 4K2EA 1PDNC 2MH9A 4LLGF 1OR7A 3IKVA 4L0ZB 1YW8A 1LJ9A 1MKMA 4IRGA 1FBSA 1DP7P 5HVQC 2FEZA 2O03A 5E8GA 1BIBA 1J5YA 5FLXZ 4UV9A 2CGPA 4MQ9F 2IKKA 5CVRA 4F7ZA 5DD8A 4EVIA 4EJOA 2VOPA 1QQIA 1STZA 4LGWA 2K02A 1F9NA 4CZZA 2GXGA 2DU9A 2YR2A 1XD7A 5AIQA 1U5TA 1IN7A 3J81K 4KFCA 4TV7A 4LG0B 5CVJA 1OPCA 1YFHA 2FA5A 1RZ4A 3QRFF 2IPQX 4EV0A 1XDUA 4Y15A 3KP5A 4G6QA 4P96A 2RC4A 2HGCA 1T38A 1SAXA 1USSA 1R1VA 2EV0A 2L3DA 3QP5A 3KE2A 2LNBA 4MGRA 3F8LA 1E17A 1FP1D 1OYIA 5ILSA 4RS8A 4G8XA 1J59A 3BOQA 5L3BA 3GYHX 5KVRA 2HS5A 3DEUA 5IT9Z 3I59B 3TKYA 3K2ZA 2M87A 2H94A 3D5LA 1XCVA 2IJLA 2R7FA 1I1GA 1P4AA 4BHPA 4IJAA 3JAMZ 1KU9A 1F5TA 1ZRFA 2CWEA 1KGSA 2PN6A 2KIMA 5L3EA 4ZSKA 3KP2A 1MZBA 4GGGA 4P9UA 3KLOA 4I0AA 2NWIA 1VTNC 3BJOA 5K1YA 2RN7A 4AD9A 3N97A 1I27A 3WE2A 2PKHA 3U1DA 4PZJA 3FXQA 4RB1A 3FZVA 2W84A 4G9YA 2RGVA 3GW2A 3F8MA 1ZGJA 4A5MA 1IN4A 3R6SA 1WI9A 3E5QA 1UCRA 4KIBA 3C7JA 3I54A 5D5VB 4G6DA 3SQNA 1XGNA 3LWFA 3V8JA 1TNSA 5ED4A 2Z9OA 2PBIA 3BDDA 2BGCA 3DQVC 4A0XA 2STTA 3I64A 3CO7C 4ASNA 1G3WA 3KETA 4EGZA 3V8KA 3JTHA 3GWZA 4G7HF 4A6DA 1FWZA 1O7LA 1YG2A 3ABTA 1ZHFA 5DYMA 3V7RA 3RJPA 3F3XA 5ICCA 5FO5A 4IRIA 4GCVA 1HW2A 4LK0F 1FY7A 2E7WA 2UZKA 4L0YB 2LKPA 2HKOA 1TTYA 2M30A 3O3KA 5FFZA 3WGHA 2JPBA 2L02A 4L18B 4RGXA 1O3TA 3HHGA 3G73A 1TT8A 4U7DA 1S7OA 1J9IA 3ZMVA 1FBQA 5FB2A 1TQPA 2PMUA 2UXNA 4R1HA 3ZN1A 3W6JB 3TDZC 3F6OA 4S04A 2WV0A 1R7JA 3IWFA 1PUEE 2XVCA 2BE5F 2YX7A 2XROA 4BHBA 2MLGA 3Q5FA 1H9GA 3CUOA 4MQVA 2O6GE 3F8FA 2FMLA 3IRQA 2H09A 5J8FA 3F6VA 4RAZA 5ILVA 1BI0A 4XLPF 2PJPA 4BHCA 3O6BB 3S2WA 1U78A 4UHTA 1ON2A 1YW7A 3VFZA 2K4BA 2KKOA 5D5UB 2YSRA 4Q47A 3OOPA 2VBWA 1JXSA 2DT5A 2VODA 1YLFA 1UHMA 1V4RA 2FXAA 3DKWA 1BOAA 1QGPA 1O57A 1QBJA 2EA2A 3FHZA 4QLCU 1HKSA 2QM3A 4LLLA 2A6EF 2YPRA 2NNNA 5E8IA 4I2OA 3RKYA 2DAOA 2DO7A 3BJAA 5CYVA 1BI2A 2ISZA 3L5ZA 4ZH4F 2V79A 2DTRA 4M74A 3IWZA 1KU2A 3MZHA 3V7CA 4EJTA 2QVOA 1FP2A 4HX4A 4FHTA 4CGZA 3QU3A 5H20A 5DUIA 1ZLKA 4HX8A 3WTSC 2QUFA 3FXRA 2F5DA 2PG4A 4LG0A 5L3CA 4ENMA 1KYZA 4CICA 3R61A 3DXJF 3PQJA 5D6FA 1PP7U 3NEUA 1UHWA 2E1NA 1OYYA 4DNCA 5LGUA 4WXHA 3E6BA 4BXUA 5LEJA 1G81A 4G7ZF 2PLYA 4WK8F 1J0RA 2MA3A 2Y48A 4KA4A 5H6RA 3I4PA 5L3FA 1I5ZA 1R1UA 1GXPA 3DDVA 3GFIA 4HOBA 4LJZF 3LSTA 2QBYB 4KMUX 4IHSA 4CYDA 4HDUA 3I59A 5JVTA 3P9CA 3DF8A 5JI6A 3LAPA 4A12A 3IC7A 4Q5SF 2ZBKA 3P9IA 3C1DA 5CVUA 5CVIA 1FT9A 1WWXA 3WGGA 2RA5A 1IN6A 1XLRA 3DPTA 2KJBA 1U6GA 4UVBA 2CO5A 4M72A 2OAZA 5DUKA 4HF0A 5DCMB 1S8NA 3FMQA 2ZNZA 3Q9VA 3RYRA 2EV6A 2FMYA 3WU1B 3RPUA 4EMSA 1ZAOA 3E6DA 5E1WA 3K1PA 4LB5A 2W24A 1EH8A 4L5JA 1LVAA 5FGMA 2GWRA 2VBYA 3R4KA 1HSJA 1UFMA 1DPRA 5DV5A 2G7UA 2HR3A 3IKTA 1USTA 5F6FA 5HDGA 3BWGA 3ELKA 5E1ZB 2HDCA 3HSEA 1QO0D 1SD5A 4GXOA 3JW4A 1LEBA 3T0YA 4WF2A 3H92A 2ADUA 4FX4A 4YFNF 5HS9A 4OU0A 1MJAA 1A04A 2VT3A 2OZUA 1R1TA 2QYOA 4IXAA 1ZARA 1KA8A 3HRTA 5LGNA 4ZYGA 4LD5A 1ZLJA 1OYWA 3T1BA 4G94A 5HOOA 4WWCA 4S05A 5EEGA 1DPUA 4OMYA 4EGYA 5BPIA 1D8KA 1R36A 1U5TC 2Y0MA 4UUVA 1ON1A 3WTWC 3Q9SA 4HA8A 2JRTA 1ZH5A 4YFXF 4WX9A 4LB6B 1W5TA 3R0AA 2F5EA 4U88A 5TJJA 3SZTA 2K86A 5A2QK 3V8LA 2Z33A 4IHTA 2XHKA 3FM3A 2QWWA 2BBYA 1TBXA 2XKPA 3KEOA 1KYWA 2M5WA 2FBIA 4BQAA 2R7DA 3GZ6A 1L3LA 2F5CA 1B6AA 2EK5A 2C6YA 1V3FA 2VONA 2DPUA 2B0LA 3JTGA 1K7AA 3KP3A 3NRVA 4EM2A 4NHJA 1FSEA 1SD6A 4AIHA 2DLLA 4LFUA 3ZMDA 2D1VA 4ENNA 1ZRCA 3M8EA 4IF4A 2STWA 1G3SA 1RUOA 5E1XA 4MTEA 1T2KA 3RTRA 3H3UA 4ETSA 2P5KA 2G7HA 1ONVA 1HW5A 5J8CA 2K4JA 2K7LA 1EH6A 2XV4S 1LB2A 1HBXG 2A07F 3KP6A 3TGNA 4CO8A 2EFQA 3P9KA 4EM0B 2O61A 2NYXA 4M9ZA 2GZWA 2VBXA 2EA4A 3AAFA 4I02A 4OINF 5LHGA 4HLYA 2VN2A 3WTYC 1G1BA 1W7PB 1BC7C 2BV6A 2DI3A 3L2CA 1H9TA 1R22A 3F23A 4KUMA 1HSTA 3WG9A 2JZYA 4O3MA 2CSOA 2YU3A 1J2XA 2AS5F 1TQMA 5HLGA 2J5PA 3NQOA 2P8TA 4RB0A 2X0LA 2XIGA 1XDSA 3U9GA 4KIFA 1G3TA 3MAJA 3MEXA 3DPLC 3BPXA 2WC2A 2HYFA 1W5SA 1B4AA 1D8JA 3WTUC 3QP6A 3DV8A 4LMYA 2O8XA 2PMHA 1LDJA 1YS6A 3F72A 3KLNA 2P4WA 4OIOF 1IRFA 3E5XA 5D5XB 1O3QA 3BP8A 1ZRDA 4I09A 4HF1A 2HZTA 1GHCA 2GA1A 3QU6A 4A0ZA 1BI1A 5CVVA 3B02A 5DCFA 3FWEA 4ZYEA 3CTAA 3SZPA 3I53A 4KICA 1FX7A 4RGSA 3CJNA 2XAQA 3T5XA 4YFKF 3CUQB 1B59A 1YW9A 3J81Z 3RPQA 2FRHA 1P4XA 4HF2A 3HHHA 4ENJA 2Z99A 1S6LA 2VT2A 5A2QZ 2UWMA 3LA2A 1R58A 2DQLA 4M73A 1IXRC 1T0FA 3GEZA 2MH2A 4L9TA 2QBYA 3CLOA 4ESJA 1MD0A 2LF8A 3EYYA 1RI7A 1ZN2A 5ICGA 4KN4X 4KNYA 3GZ5A 3HRMA 1QPMA 2BEOA 4BH9A 4MEXF 2HOEA 5ILUA 3GXOA 1FBUA 2OBPA 1ZG1A 4XRFA 3HUGA 1RNLA 3HSRA 1YS7A 1WKMA 2QQAA 5DCMA 4DQ2A 4P55A 2PEXA 1I1SA 2D1HA 2LDUA 2ACJA 4L9JA 2IW5A 4FX0A 2ZJ2A 5DD4A 5HLIA 4KT5C 3K9TA 1O3SA 1T6SA 2ISYA 1YYVA 2XAJA 4MNUA 3ROUA 2WWYA 4HV5A 1T98A 2M45A 1KQ9A 1SFUA 4ZSBA 1X3UA 1Z1DA 4PGHA 4Y13A 2EV5A 1XB4A 3BROA 3HOSA 2PI0A 2HYGD 5FD6A 3KFWX 4HV6A 2FF4A 4RB3C 1DDNA 3VB2A 1KU3A 5ICEA 2W25A 2IA1A 4Q4ZF 2A3SA 1IZ1A 3B73A 2ELHA 2HTJA 3M1EA 3VEPA 3ZMUA 1B1BA 3WTVC 3KP4A 5F64A 2R3SA 1IUYA 4U7BA 1U2WA 2LF7A 4N9IA 4M6XA 3L9FA 2RV8A 1MGTA 2Q0OA 1FSHA 3E97A 3P7NA 5KK1A 1ZG5A 3HFIA 3LAJA 5HDKA 4Q48A 4ESBA 1BC8C 2QZ8A 4HX7A 3HTUA 4M9XA 5LLQA 3FMSA 2QENA 2AHCA 2CG4A 2EB7A 5K5OA 1K6OA 2OOIA 5FLXK 2FNAA 5DDGA 1BIAA 4A0YA 2HKXA 2P6TA 5D8KB 1R5HA 3JSPA 1C0WA 2XAGA 1FYLA 1REPC 1F4KA 5TRDA 1TW3A 2P5VA 3QPHA 5K5QA 3K1NA 5E17F 1TNTA 3KP7A 1BBYA 1LEAA 2KIUA 3TQNA 2IT0A 1CGPA 5K5RA 4UVAA 2H6CA 2ZNYA 3LFKA 3IHUA 2ZCWA 1TLHB 3I71A 4E70A 5BS6A 2FBHA 1TW2A 2V1UA 3CDHA 3QPTA 3V7SA 2LSOA 2IRFG 1K78B 4UVCA 1S3JA 5L3DA 2G9WA 3WTZA 4CXFA 4BNCA 2Q2EA 5AIPA 3EETA 4XSXF 2FU4A 2A5YB 2NAZA 3EUHA 2L54A 4JQFA 4BAYA 1IF1A 4WCGA 5IT9K 3E3VA 2DPDA 3KEQA 1W7PA 2WTEA 1CF7B 1XMAA 4AVPA 2O3FA 3F8CA 3QOPA 1UB9A 1YIOA 3C18A 3E6MA 1BI3A 4O6JA 1SFEA 4AIJA 2W85A 3JAMK 5LEKA 4YIIA 3RYPA 2RKHA 5D4RA 3WODF 1ZG3A 1I6XA 1B9MA 1IN5A 3ZMZA 1F1ZA 2XASA 1LDDA 2ZMEB 3IL2A 3ZMSA 1J7KA 1WQ2A 4I98B 4M9SA 1NHAA 3ERED 2GAUA 4M71A 4FT8A 3L7WA 1XGOA 3J80K 2EFNA 4ZYDA 4U0YA 1Z91A 3T8TA 3DP7A 2E7XA 4L9NA 2K27A 1SD4A 4AIKA 2EFWA 3HYIA 3I58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UXN A;  4HAM A;  4R79 A;  2P5L C;  2GA2 A;  3ULQ B;  3KZZ A;  1JGS A;  1FC3 A;  4HQE A;  3CUQ C;  3L09 A;  4RGR A;  2XAF A;  5JHU A;  1DUX C;  1FYM A;  2OGG A;  3CUQ A;  4HDV A;  2L01 A;  2RDP A;  4A6E A;  2V1X A;  4P5O A;  4B8X A;  3D0S A;  2V6C A;  3CO6 C;  2EFO A;  2RNJ A;  4KIG A;  3F21 A;  1MJB A;  1AWC A;  1JHH A;  2A69 F;  2M1B A;  5BQT A;  4L5I A;  2P19 A;  3T8R A;  3MCZ A;  3WTX C;  4Z2Y A;  5HLH A;  3H3Z A;  3OV8 A;  1B9N A;  4IRH A;  3TOB A;  2V9V A;  2HTS A;  1SD7 A;  2Z5U A;  1T39 A;  2TDX A;  3GFJ A;  4PCQ A;  1HXD A;  3BJ6 A;  2IA2 A;  2OQG A;  1D3Y A;  1W7P D;  4EQQ A;  2VXZ A;  2QQB A;  3KZY A;  2ZO4 A;  3F8B A;  1P92 A;  5IT3 A;  4OIR F;  1SFX A;  3FMR A;  2ZXJ A;  3LHE A;  4U0V A;  4B09 A;  3ECH A;  5CLS A;  2XGX A;  3F8N A;  1QNT A;  2DQR A;  1XSD A;  2NRA C;  3RKW A;  3GX4 X;  1G3Y A;  2EFP A;  1Z9C A;  1R23 A;  1ODD A;  2Z3Y A;  2PFB A;  1XCB A;  5LRR A;  4IPA A;  2CFX A;  3WU0 A;  3G3Z A;  1MDM B;  4OIQ F;  2VOO A;  1XGM A;  5EEH A;  1O7F A;  4I7H A;  3SHF A;  3E5U A;  3IRR A;  3M7G A;  4I0B A;  2KRF A;  5H6Q A;  3FXU A;  4N0B A;  1HQC A;  1L0O C;  2KJC A;  4R8H A;  2IP2 A;  4GO1 A;  4U0W A;  2XAH A;  1K79 A;  4GYI A;  4ZYH A;  4JBA A;  2YX4 A;  2HQN A;  3R0J A;  3N4M A;  2NS0 A;  3I0T A;  1FW9 A;  5FD5 A;  3F22 A;  1R5G A;  2FBK A;  1XSX A;  2JPC A;  4LK1 F;  3TO7 A;  3GLX A;  1HW1 A;  2Q8K A;  3K69 A;  2AXL A;  4G7O F;  5D5W B;  3GFM A;  3J80 Z;  3EDP A;  2W57 A;  3ISP A;  3ZPL A;  3M8F A;  2GXB A;  3E6C C;  3HTS B;  1EH7 A;  4BYY A;  4L9V A;  1RIO H;  1S7A A;  1P4W A;  3SXY A;  4EJW A;  2DW4 A;  3LQQ A;  1U8R A;  2FA1 A;  2ESN A;  2F5F A;  1QZY A;  3TO6 A;  4KN7 X;  3WTT C;  3DFG A;  6PAX A;  1FNN A;  5JR3 A;  2EJR A;  1IW7 F;  5ICF A;  3MZY A;  1AOY A;  5LGT A;  2L4M A;  5HS7 A;  2COM A;  1LDK B;  5BOX A;  5ERI A;  4ON0 A;  5E18 F;  1YO5 C;  4I01 A;  2HFH A;  2XRN A;  2HQR A;  2FQ3 A;  5DEQ A;  2OZ6 A;  2VC1 A;  3KCC A;  3K0L A;  3REO A;  1IXC A;  1H0M A;  3C3W A;  3GUD A;  4ZZL A;  3BPV A;  3WE3 A;  5BMZ A;  1FPQ A;  4HZF A;  2XKO A;  1FZP B;  2VBZ A;  4N9H A;  4OOI A;  1P2F A;  1FOK A;  2CQK A;  2JTV A;  3ECO A;  2OQR A;  3ZN0 A;  2P7C B;  2ZKZ A;  4HQM A;  1K78 A;  1Z6T A;  1XN7 A;  1RUN A;  1YQA A;  1U5T B;  1FYK A;  4ZZD A;  1ZYR F;  2RQP A;  3CNV A;  1ZRE A;  3HSF A;  3QAH A;  1SMT A;  4M6Y A;  4ESF A;  3HRU A;  5LRS A;  2ESH A;  2FNP A;  3TDU C;  3LQR A;  1P6R A;  3HRS A;  2V1D A;  2OU2 A;  5LBQ A;  3RI4 A;  4EJV A;  1Y0U A;  2M8E A;  2A6H F;  1CF7 A;  1WSU A;  1Z05 A;  1GXQ A;  4AWX B;  3O2P E;  1SMY F;  2H6B A;  2F2E A;  5LHI A;  5JFR A;  1HKQ A;  3BY6 A;  3SFZ A;  1XSV A;  4MHG A;  2UXX A;  1BN5 A;  2NNY A;  2GIV A;  2A61 A;  4HW0 A;  2DFI A;  4HLX A;  2Y75 A;  2ZME A;  5D6E A;  4RB2 C;  2JSC A;  5AON A;  4KDP A;  2MBF A;  1Q1H A;  4CDG A;  5CJ9 A;  3RDI A;  1D5V A;  3R60 A;  1KQ8 A;  4QWQ A;  2D45 A;  1ULY A;  4D0P A;  1QZZ A;  4Y17 A;  3ABU A;  2E1C A;  4O5V A;  2MD5 A;  5D4S A;  1YTY A;  2QQ9 A;  4H0E A;  4UV8 A;  4GYG A;  4EJU A;  2P7V B;  2EWN A;  1OKR A;  4KMF A;  2FOK A;  3RIR A;  1XMK A;  3GF2 A;  1IAW A;  4XLN F;  4LLN A;  1Z6R A;  3RKX A;  5E20 A;  1BM9 A;  2HEO A;  1IXS B;  3VOE A;  4PGG A;  3J7A O;  4EM1 A;  3ZMT A;  1HKT A;  3HOT A;  3JSO A;  4KYW A;  2X4H A;  4XSZ F;  4UNO A;  2MC3 A;  5J6X A;  4NB5 A;  4WXC A;  3TOA A;  3FF5 A;  1W4M A;  1XGS A;  4OMZ A;  4PDK A;  5LHH A;  2RVC A;  3MQ0 A;  4IVN A;  1JD3 A;  3K1M A;  3GFL A;  1IRG A;  3EQL F;  4A5N A;  2MLK A;  2FE3 A;  1S29 A;  2ZFW A;  3GO5 A;  2A68 F;  2ETH A;  1O3R A;  3LA3 A;  2D2W A;  1TQI A;  3MWM A;  2VC0 A;  1E2X A;  4MTD A;  5BPD A;  4JK1 X;  4P9F A;  5D8L B;  4ENK A;  1EV7 A;  1JHF A;  1U3E M;  1ZGA A;  1BJA A;  3ML6 A;  1MDM A;  1FLI A;  4YIF A;  1WRJ A;  2O0Y A;  4OIP F;  1G6N A;  1J75 A;  3WGI A;  1LQ1 A;  3HIF A;  1LNW A;  5HS8 A;  2IA0 A;  4HYE A;  4NQW A;  4CHU A;  3PQK A;  5L3G A;  2P6S A;  3W6K B;  3EYI A;  2XUB A;  5HDN A;  3GVA A;  4HBL A;  2QLZ A;  2DK8 A;  2IVM A;  2J5O A;  2OD5 A;  3TO9 A;  3U2R A;  2GQQ A;  1KQ0 A;  2JT1 A;  2OA4 A;  3FM5 A;  1MJ9 A;  3COA C;  3BZ6 A;  5F1R A;  3FX3 A;  2BYV E;  3VOD A;  3L00 A;  2VE8 A;  2PQ8 A;  2HWV A;  3PFI A;  4A2U A;  2FSW A;  4ZSI A;  1PP8 F;  2DBB A;  2DK5 A;  1G4D A;  4XBF A;  3M9A A;  1IN8 A;  2CYY A;  1JE8 A;  2VE9 A;  2L4A A;  2KIF A;  1KU7 A;  2CW0 F;  5FFX A;  4MEY F;  4WXD A;  2H27 A;  1R00 A;  4RAY A;  3MFK A;  3LA7 A;  4RGU A;  3V4G A;  3ZQ7 A;  3I5U A;  1Z7U A;  1OMI A;  4YG2 F;  1GVJ A;  3ZP5 A;  4K2E A;  1PDN C;  2MH9 A;  4LLG F;  1OR7 A;  3IKV A;  4L0Z B;  1YW8 A;  1LJ9 A;  1MKM A;  4IRG A;  1FBS A;  1DP7 P;  5HVQ C;  2FEZ A;  2O03 A;  5E8G A;  1BIB A;  1J5Y A;  5FLX Z;  4UV9 A;  2CGP A;  4MQ9 F;  2IKK A;  5CVR A;  4F7Z A;  5DD8 A;  4EVI A;  4EJO A;  2VOP A;  1QQI A;  1STZ A;  4LGW A;  2K02 A;  1F9N A;  4CZZ A;  2GXG A;  2DU9 A;  2YR2 A;  1XD7 A;  5AIQ A;  1U5T A;  1IN7 A;  3J81 K;  4KFC A;  4TV7 A;  4LG0 B;  5CVJ A;  1OPC A;  1YFH A;  2FA5 A;  1RZ4 A;  3QRF F;  2IPQ X;  4EV0 A;  1XDU A;  4Y15 A;  3KP5 A;  4G6Q A;  4P96 A;  2RC4 A;  2HGC A;  1T38 A;  1SAX A;  1USS A;  1R1V A;  2EV0 A;  2L3D A;  3QP5 A;  3KE2 A;  2LNB A;  4MGR A;  3F8L A;  1E17 A;  1FP1 D;  1OYI A;  5ILS A;  4RS8 A;  4G8X A;  1J59 A;  3BOQ A;  5L3B A;  3GYH X;  5KVR A;  2HS5 A;  3DEU A;  5IT9 Z;  3I59 B;  3TKY A;  3K2Z A;  2M87 A;  2H94 A;  3D5L A;  1XCV A;  2IJL A;  2R7F A;  1I1G A;  1P4A A;  4BHP A;  4IJA A;  3JAM Z;  1KU9 A;  1F5T A;  1ZRF A;  2CWE A;  1KGS A;  2PN6 A;  2KIM A;  5L3E A;  4ZSK A;  3KP2 A;  1MZB A;  4GGG A;  4P9U A;  3KLO A;  4I0A A;  2NWI A;  1VTN C;  3BJO A;  5K1Y A;  2RN7 A;  4AD9 A;  3N97 A;  1I27 A;  3WE2 A;  2PKH A;  3U1D A;  4PZJ A;  3FXQ A;  4RB1 A;  3FZV A;  2W84 A;  4G9Y A;  2RGV A;  3GW2 A;  3F8M A;  1ZGJ A;  4A5M A;  1IN4 A;  3R6S A;  1WI9 A;  3E5Q A;  1UCR A;  4KIB A;  3C7J A;  3I54 A;  5D5V B;  4G6D A;  3SQN A;  1XGN A;  3LWF A;  3V8J A;  1TNS A;  5ED4 A;  2Z9O A;  2PBI A;  3BDD A;  2BGC A;  3DQV C;  4A0X A;  2STT A;  3I64 A;  3CO7 C;  4ASN A;  1G3W A;  3KET A;  4EGZ A;  3V8K A;  3JTH A;  3GWZ A;  4G7H F;  4A6D A;  1FWZ A;  1O7L A;  1YG2 A;  3ABT A;  1ZHF A;  5DYM A;  3V7R A;  3RJP A;  3F3X A;  5ICC A;  5FO5 A;  4IRI A;  4GCV A;  1HW2 A;  4LK0 F;  1FY7 A;  2E7W A;  2UZK A;  4L0Y B;  2LKP A;  2HKO A;  1TTY A;  2M30 A;  3O3K A;  5FFZ A;  3WGH A;  2JPB A;  2L02 A;  4L18 B;  4RGX A;  1O3T A;  3HHG A;  3G73 A;  1TT8 A;  4U7D A;  1S7O A;  1J9I A;  3ZMV A;  1FBQ A;  5FB2 A;  1TQP A;  2PMU A;  2UXN A;  4R1H A;  3ZN1 A;  3W6J B;  3TDZ C;  3F6O A;  4S04 A;  2WV0 A;  1R7J A;  3IWF A;  1PUE E;  2XVC A;  2BE5 F;  2YX7 A;  2XRO A;  4BHB A;  2MLG A;  3Q5F A;  1H9G A;  3CUO A;  4MQV A;  2O6G E;  3F8F A;  2FML A;  3IRQ A;  2H09 A;  5J8F A;  3F6V A;  4RAZ A;  5ILV A;  1BI0 A;  4XLP F;  2PJP A;  4BHC A;  3O6B B;  3S2W A;  1U78 A;  4UHT A;  1ON2 A;  1YW7 A;  3VFZ A;  2K4B A;  2KKO A;  5D5U B;  2YSR A;  4Q47 A;  3OOP A;  2VBW A;  1JXS A;  2DT5 A;  2VOD A;  1YLF A;  1UHM A;  1V4R A;  2FXA A;  3DKW A;  1BOA A;  1QGP A;  1O57 A;  1QBJ A;  2EA2 A;  3FHZ A;  4QLC U;  1HKS A;  2QM3 A;  4LLL A;  2A6E F;  2YPR A;  2NNN A;  5E8I A;  4I2O A;  3RKY A;  2DAO A;  2DO7 A;  3BJA A;  5CYV A;  1BI2 A;  2ISZ A;  3L5Z A;  4ZH4 F;  2V79 A;  2DTR A;  4M74 A;  3IWZ A;  1KU2 A;  3MZH A;  3V7C A;  4EJT A;  2QVO A;  1FP2 A;  4HX4 A;  4FHT A;  4CGZ A;  3QU3 A;  5H20 A;  5DUI A;  1ZLK A;  4HX8 A;  3WTS C;  2QUF A;  3FXR A;  2F5D A;  2PG4 A;  4LG0 A;  5L3C A;  4ENM A;  1KYZ A;  4CIC A;  3R61 A;  3DXJ F;  3PQJ A;  5D6F A;  1PP7 U;  3NEU A;  1UHW A;  2E1N A;  1OYY A;  4DNC A;  5LGU A;  4WXH A;  3E6B A;  4BXU A;  5LEJ A;  1G81 A;  4G7Z F;  2PLY A;  4WK8 F;  1J0R A;  2MA3 A;  2Y48 A;  4KA4 A;  5H6R A;  3I4P A;  5L3F A;  1I5Z A;  1R1U A;  1GXP A;  3DDV A;  3GFI A;  4HOB A;  4LJZ F;  3LST A;  2QBY B;  4KMU X;  4IHS A;  4CYD A;  4HDU A;  3I59 A;  5JVT A;  3P9C A;  3DF8 A;  5JI6 A;  3LAP A;  4A12 A;  3IC7 A;  4Q5S F;  2ZBK A;  3P9I A;  3C1D A;  5CVU A;  5CVI A;  1FT9 A;  1WWX A;  3WGG A;  2RA5 A;  1IN6 A;  1XLR A;  3DPT A;  2KJB A;  1U6G A;  4UVB A;  2CO5 A;  4M72 A;  2OAZ A;  5DUK A;  4HF0 A;  5DCM B;  1S8N A;  3FMQ A;  2ZNZ A;  3Q9V A;  3RYR A;  2EV6 A;  2FMY A;  3WU1 B;  3RPU A;  4EMS A;  1ZAO A;  3E6D A;  5E1W A;  3K1P A;  4LB5 A;  2W24 A;  1EH8 A;  4L5J A;  1LVA A;  5FGM A;  2GWR A;  2VBY A;  3R4K A;  1HSJ A;  1UFM A;  1DPR A;  5DV5 A;  2G7U A;  2HR3 A;  3IKT A;  1UST A;  5F6F A;  5HDG A;  3BWG A;  3ELK A;  5E1Z B;  2HDC A;  3HSE A;  1QO0 D;  1SD5 A;  4GXO A;  3JW4 A;  1LEB A;  3T0Y A;  4WF2 A;  3H92 A;  2ADU A;  4FX4 A;  4YFN F;  5HS9 A;  4OU0 A;  1MJA A;  1A04 A;  2VT3 A;  2OZU A;  1R1T A;  2QYO A;  4IXA A;  1ZAR A;  1KA8 A;  3HRT A;  5LGN A;  4ZYG A;  4LD5 A;  1ZLJ A;  1OYW A;  3T1B A;  4G94 A;  5HOO A;  4WWC A;  4S05 A;  5EEG A;  1DPU A;  4OMY A;  4EGY A;  5BPI A;  1D8K A;  1R36 A;  1U5T C;  2Y0M A;  4UUV A;  1ON1 A;  3WTW C;  3Q9S A;  4HA8 A;  2JRT A;  1ZH5 A;  4YFX F;  4WX9 A;  4LB6 B;  1W5T A;  3R0A A;  2F5E A;  4U88 A;  5TJJ A;  3SZT A;  2K86 A;  5A2Q K;  3V8L A;  2Z33 A;  4IHT A;  2XHK A;  3FM3 A;  2QWW A;  2BBY A;  1TBX A;  2XKP A;  3KEO A;  1KYW A;  2M5W A;  2FBI A;  4BQA A;  2R7D A;  3GZ6 A;  1L3L A;  2F5C A;  1B6A A;  2EK5 A;  2C6Y A;  1V3F A;  2VON A;  2DPU A;  2B0L A;  3JTG A;  1K7A A;  3KP3 A;  3NRV A;  4EM2 A;  4NHJ A;  1FSE A;  1SD6 A;  4AIH A;  2DLL A;  4LFU A;  3ZMD A;  2D1V A;  4ENN A;  1ZRC A;  3M8E A;  4IF4 A;  2STW A;  1G3S A;  1RUO A;  5E1X A;  4MTE A;  1T2K A;  3RTR A;  3H3U A;  4ETS A;  2P5K A;  2G7H A;  1ONV A;  1HW5 A;  5J8C A;  2K4J A;  2K7L A;  1EH6 A;  2XV4 S;  1LB2 A;  1HBX G;  2A07 F;  3KP6 A;  3TGN A;  4CO8 A;  2EFQ A;  3P9K A;  4EM0 B;  2O61 A;  2NYX A;  4M9Z A;  2GZW A;  2VBX A;  2EA4 A;  3AAF A;  4I02 A;  4OIN F;  5LHG A;  4HLY A;  2VN2 A;  3WTY C;  1G1B A;  1W7P B;  1BC7 C;  2BV6 A;  2DI3 A;  3L2C A;  1H9T A;  1R22 A;  3F23 A;  4KUM A;  1HST A;  3WG9 A;  2JZY A;  4O3M A;  2CSO A;  2YU3 A;  1J2X A;  2AS5 F;  1TQM A;  5HLG A;  2J5P A;  3NQO A;  2P8T A;  4RB0 A;  2X0L A;  2XIG A;  1XDS A;  3U9G A;  4KIF A;  1G3T A;  3MAJ A;  3MEX A;  3DPL C;  3BPX A;  2WC2 A;  2HYF A;  1W5S A;  1B4A A;  1D8J A;  3WTU C;  3QP6 A;  3DV8 A;  4LMY A;  2O8X A;  2PMH A;  1LDJ A;  1YS6 A;  3F72 A;  3KLN A;  2P4W A;  4OIO F;  1IRF A;  3E5X A;  5D5X B;  1O3Q A;  3BP8 A;  1ZRD A;  4I09 A;  4HF1 A;  2HZT A;  1GHC A;  2GA1 A;  3QU6 A;  4A0Z A;  1BI1 A;  5CVV A;  3B02 A;  5DCF A;  3FWE A;  4ZYE A;  3CTA A;  3SZP A;  3I53 A;  4KIC A;  1FX7 A;  4RGS A;  3CJN A;  2XAQ A;  3T5X A;  4YFK F;  3CUQ B;  1B59 A;  1YW9 A;  3J81 Z;  3RPQ A;  2FRH A;  1P4X A;  4HF2 A;  3HHH A;  4ENJ A;  2Z99 A;  1S6L A;  2VT2 A;  5A2Q Z;  2UWM A;  3LA2 A;  1R58 A;  2DQL A;  4M73 A;  1IXR C;  1T0F A;  3GEZ A;  2MH2 A;  4L9T A;  2QBY A;  3CLO A;  4ESJ A;  1MD0 A;  2LF8 A;  3EYY A;  1RI7 A;  1ZN2 A;  5ICG A;  4KN4 X;  4KNY A;  3GZ5 A;  3HRM A;  1QPM A;  2BEO A;  4BH9 A;  4MEX F;  2HOE A;  5ILU A;  3GXO A;  1FBU A;  2OBP A;  1ZG1 A;  4XRF A;  3HUG A;  1RNL A;  3HSR A;  1YS7 A;  1WKM A;  2QQA A;  5DCM A;  4DQ2 A;  4P55 A;  2PEX A;  1I1S A;  2D1H A;  2LDU A;  2ACJ A;  4L9J A;  2IW5 A;  4FX0 A;  2ZJ2 A;  5DD4 A;  5HLI A;  4KT5 C;  3K9T A;  1O3S A;  1T6S A;  2ISY A;  1YYV A;  2XAJ A;  4MNU A;  3ROU A;  2WWY A;  4HV5 A;  1T98 A;  2M45 A;  1KQ9 A;  1SFU A;  4ZSB A;  1X3U A;  1Z1D A;  4PGH A;  4Y13 A;  2EV5 A;  1XB4 A;  3BRO A;  3HOS A;  2PI0 A;  2HYG D;  5FD6 A;  3KFW X;  4HV6 A;  2FF4 A;  4RB3 C;  1DDN A;  3VB2 A;  1KU3 A;  5ICE A;  2W25 A;  2IA1 A;  4Q4Z F;  2A3S A;  1IZ1 A;  3B73 A;  2ELH A;  2HTJ A;  3M1E A;  3VEP A;  3ZMU A;  1B1B A;  3WTV C;  3KP4 A;  5F64 A;  2R3S A;  1IUY A;  4U7B A;  1U2W A;  2LF7 A;  4N9I A;  4M6X A;  3L9F A;  2RV8 A;  1MGT A;  2Q0O A;  1FSH A;  3E97 A;  3P7N A;  5KK1 A;  1ZG5 A;  3HFI A;  3LAJ A;  5HDK A;  4Q48 A;  4ESB A;  1BC8 C;  2QZ8 A;  4HX7 A;  3HTU A;  4M9X A;  5LLQ A;  3FMS A;  2QEN A;  2AHC A;  2CG4 A;  2EB7 A;  5K5O A;  1K6O A;  2OOI A;  5FLX K;  2FNA A;  5DDG A;  1BIA A;  4A0Y A;  2HKX A;  2P6T A;  5D8K B;  1R5H A;  3JSP A;  1C0W A;  2XAG A;  1FYL A;  1REP C;  1F4K A;  5TRD A;  1TW3 A;  2P5V A;  3QPH A;  5K5Q A;  3K1N A;  5E17 F;  1TNT A;  3KP7 A;  1BBY A;  1LEA A;  2KIU A;  3TQN A;  2IT0 A;  1CGP A;  5K5R A;  4UVA A;  2H6C A;  2ZNY A;  3LFK A;  3IHU A;  2ZCW A;  1TLH B;  3I71 A;  4E70 A;  5BS6 A;  2FBH A;  1TW2 A;  2V1U A;  3CDH A;  3QPT A;  3V7S A;  2LSO A;  2IRF G;  1K78 B;  4UVC A;  1S3J A;  5L3D A;  2G9W A;  3WTZ A;  4CXF A;  4BNC A;  2Q2E A;  5AIP A;  3EET A;  4XSX F;  2FU4 A;  2A5Y B;  2NAZ A;  3EUH A;  2L54 A;  4JQF A;  4BAY A;  1IF1 A;  4WCG A;  5IT9 K;  3E3V A;  2DPD A;  3KEQ A;  1W7P A;  2WTE A;  1CF7 B;  1XMA A;  4AVP A;  2O3F A;  3F8C A;  3QOP A;  1UB9 A;  1YIO A;  3C18 A;  3E6M A;  1BI3 A;  4O6J A;  1SFE A;  4AIJ A;  2W85 A;  3JAM K;  5LEK A;  4YII A;  3RYP A;  2RKH A;  5D4R A;  3WOD F;  1ZG3 A;  1I6X A;  1B9M A;  1IN5 A;  3ZMZ A;  1F1Z A;  2XAS A;  1LDD A;  2ZME B;  3IL2 A;  3ZMS A;  1J7K A;  1WQ2 A;  4I98 B;  4M9S A;  1NHA A;  3ERE D;  2GAU A;  4M71 A;  4FT8 A;  3L7W A;  1XGO A;  3J80 K;  2EFN A;  4ZYD A;  4U0Y A;  1Z91 A;  3T8T A;  3DP7 A;  2E7X A;  4L9N A;  2K27 A;  1SD4 A;  4AIK A;  2EFW A;  3HYI A;  3I58 A; 
#chains in the Genus database with same CATH topology
 4UXN A;  4HAM A;  4R79 A;  1Q1V A;  2HQ5 A;  2P5L C;  2GA2 A;  2EH3 A;  2L7M P;  2QA4 I;  3ULQ B;  3TP3 A;  4BDZ A;  3KZZ A;  4AM3 A;  1VFC A;  1JGS A;  1FC3 A;  4HQE A;  3A01 A;  2O5R A;  3BR0 A;  3GTL J;  3OYM A;  3CUQ C;  3L09 A;  4RGR A;  3G1M A;  1N75 A;  2XAF A;  2LBF A;  5JHU A;  1DUX C;  1FYM A;  3H9G A;  2OGG A;  1YE9 A;  4YEL A;  2X1C A;  3CUQ A;  4HDV A;  2L01 A;  5FRN A;  2RDP A;  4A6E A;  2V1X A;  4P5O A;  2B7E A;  4B8X A;  3GTM J;  3HJE A;  3BG3 A;  2V6C A;  3D0S A;  3CO6 C;  2R7V A;  2Z2S B;  2EFO A;  2RNJ A;  4KIG A;  3F21 A;  1MJB A;  2YUS A;  1AWC A;  2KIS A;  3S1N J;  1JHH A;  2Y69 H;  2HZD A;  3C2B A;  1T8I A;  2A69 F;  2M1B A;  1ETV A;  5BQT A;  4L5I A;  3VWB A;  2P19 A;  3T8R A;  3MCZ A;  3WTX C;  4Z2Y A;  2FX0 A;  3BZK A;  1U9N A;  2W00 A;  5HLH A;  1VI0 A;  3H3Z A;  3OV8 A;  1RRJ A;  5EYR A;  1B9N A;  4IRH A;  4ZDO A;  2BY3 A;  3AL0 B;  4XOT A;  3TOB A;  2V9V A;  3KPH A;  2K9S A;  1ETY A;  2X85 A;  3ZQL A;  4BE0 A;  2OCE A;  1S72 I;  2HTS A;  2FD5 A;  2OPT A;  2QSF X;  2LVS A;  1XTA A;  1SD7 A;  2Z5U A;  1T39 A;  1Y56 A;  2TDX A;  3GFJ A;  4PCQ A;  3W3C A;  4CCM A;  4XLC A;  1HXD A;  3BJ6 A;  2IA2 A;  3K7A J;  3LFU A;  2BW3 A;  1Z3X A;  2OQG A;  3DPU A;  1D3Y A;  1W7P D;  4EQQ A;  1MMG A;  2VXZ A;  4PFP A;  2QQB A;  3KZY A;  2ZJQ F;  2ZO4 A;  1UG2 A;  1SAN A;  3F8B A;  3FBN B;  1P92 A;  3OYA A;  4CCK A;  4BAC A;  5IT3 A;  4OIR F;  1SFX A;  2CUE A;  2ZXJ A;  3FMR A;  5DTD A;  4U0V A;  3LHE A;  1BJZ A;  4FQG A;  4B09 A;  3ECH A;  2LRD A;  5CLS A;  2XGX A;  3F8N A;  9ANT A;  1QNT A;  2DQR A;  1UG0 A;  1XSD A;  2NRA C;  3OIQ A;  3RKW A;  2ZB9 A;  3OYN A;  2XC7 A;  2H8R A;  3GX4 X;  1G3Y A;  2EFP A;  1Z9C A;  2KMU A;  2D5V A;  1ITY A;  1R23 A;  3K70 D;  1OFC X;  1ODD A;  2Z3Y A;  2PFB A;  1XCB A;  5LRR A;  1VQP I;  4IPA A;  3A1Y A;  4UB6 C;  2CFX A;  3X2Q H;  3WU0 A;  4G6T B;  3G3Z A;  3H5A A;  3PIO F;  1MDM B;  4OIQ F;  1IO2 A;  2VOO A;  1JUS A;  1AKH A;  3RCO A;  1XGM A;  3CP8 A;  5EEH A;  1O7F A;  1S5L C;  2GLO A;  2X9D A;  4I7H A;  3SHF A;  5B5E C;  4NQW B;  2DFF A;  3E5U A;  3IRR A;  3S93 A;  1B8I B;  3M7G A;  4I0B A;  3K4N A;  1JTY A;  2KRF A;  3OYC A;  3DTE A;  5H6Q A;  1MMS A;  2E19 A;  2HYJ A;  2Z16 A;  1K4S A;  3FXU A;  3FK6 A;  4N0B A;  1HQC A;  1L0O C;  2KJC A;  3H0D A;  2LLK A;  3M3Y J;  4F52 A;  2OUM A;  4R8H A;  1YRN A;  3ZQF A;  2IP2 A;  4RDU A;  4AU7 A;  4GO1 A;  4U0W A;  5EG0 B;  2XAH A;  1K79 A;  4GYI A;  3CES A;  4DIQ A;  3W2A A;  4ZYH A;  1BR4 A;  2YX4 A;  2BY2 A;  2HQN A;  3R0J A;  4JBA A;  4B48 A;  3N4M A;  3ZCO A;  2NS0 A;  3I0T A;  1FW9 A;  5GTH C;  5JHF A;  5FD5 A;  3F22 A;  1R5G A;  2FBK A;  1XSX A;  3BLY A;  2JPC A;  2KZV A;  4LK1 F;  1X1D A;  3K4M A;  3GLX A;  4IEJ A;  3TO7 A;  4D5C A;  1HW1 A;  2Q8K A;  3BG7 A;  3K69 A;  2AXL A;  3SDB A;  3CC7 I;  4G7O F;  5D5W B;  3GFM A;  3J80 Z;  1MNM C;  3EDP A;  1X58 A;  5M3F J;  2W57 A;  3GTJ J;  3ISP A;  3ZPL A;  3M8F A;  2GXB A;  3E6C C;  2XF7 A;  1W0U A;  1OJL A;  3HTS B;  1EH7 A;  1ETW A;  1OCO H;  1E3H A;  1I3Q J;  4BYY A;  4L9V A;  1RIO H;  1S7A A;  3ABL H;  2L9N A;  1P4W A;  4BS9 A;  4CYC B;  1TP4 A;  3SXY A;  4EJW A;  2DW4 A;  3LQQ A;  1U8R A;  1JKR C;  2CQN A;  1YX3 A;  3ONQ A;  3JRE A;  2XRL A;  2ESN A;  3OS2 A;  1D0X A;  2FA1 A;  2F5F A;  1QZY A;  3TO6 A;  4KN7 X;  3WTT C;  3QOD A;  3CJT B;  5KNL A;  3DFG A;  1Y39 A;  2L7F P;  2VKH A;  6PAX A;  1VZ0 A;  1FNN A;  3IAM 2;  5JR3 A;  1Y1V J;  2EJR A;  1IW7 F;  5ICF A;  3MZY A;  1AOY A;  5LGT A;  1PVE A;  2L4M A;  5HS7 A;  4XID A;  2COM A;  1LDK B;  3L2W A;  4J01 A;  5BOX A;  5ERI A;  4XLH A;  4ON0 A;  5E18 F;  2V26 A;  4BDY A;  1YO5 C;  2DMN A;  1D5Y A;  2KRC A;  3VDX A;  5DS9 A;  5IP6 A;  4I01 A;  4XKW A;  2HFH A;  2QKM B;  2XRN A;  5GPC A;  2HQR A;  2FQ3 A;  1R9T J;  5DEQ A;  2OZ6 A;  4XKV A;  2L7Z A;  1WPK A;  2VC1 A;  3KCC A;  2LP0 A;  2M34 A;  3L2U A;  3K0L A;  2FUG 2;  3REO A;  1WFX A;  1IXC A;  2Y0S A;  1H0M A;  1ETK A;  3GTP J;  2K3F A;  2VAS A;  3A2K A;  3C3W A;  3GUD A;  3CDL A;  3KYL A;  4ZZL A;  4LIT A;  3BPV A;  3FXO A;  3PSF A;  1X1B A;  3WE3 A;  1FPQ A;  4HZF A;  1POG A;  4F3Q A;  3OS0 A;  5BMZ A;  1A5J A;  2XKO A;  1FZP B;  3KEY A;  1IRX A;  2VBZ A;  1KZH A;  2ZC2 A;  2KDZ A;  4N9H A;  4OOI A;  1P2F A;  1GLN A;  1FOK A;  1OCR H;  4XON A;  1WJC A;  5B66 C;  2CQK A;  2JTV A;  4IX7 A;  1TL8 A;  3ECO A;  2OQR A;  4PFO A;  3ZN0 A;  2P7C B;  2ZKZ A;  4W97 A;  4CCN A;  2AQE A;  3ASO H;  4HQM A;  2E71 A;  1K78 A;  1Z6T A;  1XN7 A;  1RUN A;  1YQA A;  2R7O A;  5IPA A;  1WZ2 A;  4F91 B;  1U5T B;  2XGC A;  1FYK A;  4ZZD A;  4XM3 A;  1MSF C;  1ZYR F;  2RQP A;  4IO9 F;  3CNV A;  4ABZ A;  1ZRE A;  1WH7 A;  4NBQ A;  3H36 A;  3HSF A;  4C2U A;  3QAH A;  2JRM A;  2M4G A;  1ZQ3 P;  1U0J A;  1SMT A;  4A3L J;  1Z0X A;  4M6Y A;  4ESF A;  3HRU A;  5LRS A;  1QA6 A;  3D5R C;  2ESH A;  2FNP A;  3JCU C;  3TDU C;  2CMP A;  2Y2Z A;  3LQR A;  2LH9 A;  2DDB A;  2OF7 A;  1P6R A;  4BUP A;  3HRS A;  2V1D A;  2PMZ N;  2CS3 A;  2L9V A;  3HC7 A;  2OU2 A;  4S0H B;  5LBQ A;  3RI4 A;  1T56 A;  4EJV A;  3H0G J;  5DM7 F;  1Y0U A;  2B9S A;  2M8E A;  4XOP A;  1APL C;  4W1U A;  2FOW A;  2R5Z B;  2A6H F;  2M3A A;  1CF7 A;  1WSU A;  1Z05 A;  1GXQ A;  2MG4 A;  3IH3 A;  4AWX B;  4HST A;  3O2P E;  3LOC A;  1SMY F;  2H6B A;  2F2E A;  2EIJ H;  5LHI A;  1W36 C;  5JFR A;  1HKQ A;  4UUS B;  3BY6 A;  2KIQ A;  2E2H J;  1JUM A;  3SFZ A;  1EJ9 A;  1VQN I;  2ZME C;  1XSV A;  2M0C A;  2UXX A;  4MHG A;  1BN5 A;  2JN6 A;  2R7W A;  2NNY A;  3IH4 A;  2GIV A;  3O8G A;  4IQJ A;  3FDY A;  2A61 A;  4HW0 A;  2DFI A;  4HLX A;  2CQX A;  1VQ5 I;  2Y75 A;  5E3M A;  2ZME A;  1XS9 A;  5D6E A;  2EIK H;  3S32 A;  4RB2 C;  3OYI A;  2JSC A;  5AON A;  4HPQ A;  2R5Y A;  4KDP A;  2MBF A;  1Q1H A;  3BQZ A;  4CDG A;  5CJ9 A;  5C4X J;  2RRE A;  3FXK A;  3RDI A;  3CCS I;  2WV1 A;  1D5V A;  3BCA A;  3R60 A;  1I3A A;  1QHH D;  3SDG A;  3CMY A;  2DXI A;  2E5Z A;  5IYB J;  5J1R A;  4M3F A;  1KQ8 A;  4QWQ A;  2D45 A;  1ULY A;  4RA2 A;  3S1Q J;  4D0P A;  3LSR A;  1QZZ A;  2W82 A;  4OWR B;  4Y17 A;  3RQI A;  3ABU A;  2E1C A;  2L9S A;  4O5V A;  4Z6Y A;  2XF5 A;  4JOM A;  5EZH A;  2LK2 A;  2MD5 A;  5D4S A;  2R7S A;  4JX5 A;  1YTY A;  1TT0 A;  2QQ9 A;  1YIT I;  4H0E A;  2MAB A;  4UV8 A;  1TT5 B;  4GYG A;  1O4X A;  4EJU A;  5EGO B;  2P7V B;  2EWN A;  1OKR A;  2IAI A;  1XG1 A;  2FOK A;  4KMF A;  4ZC3 A;  3F9K A;  4OAZ A;  3RIR A;  4A3F J;  1XMK A;  3GF2 A;  2QSH X;  5J47 A;  1A36 A;  1IAW A;  4XLN F;  3FKJ A;  4E7Z A;  4LLN A;  1Z6R A;  3RKX A;  1OCP A;  5E20 A;  1V54 H;  1BM9 A;  2BY1 A;  2BY0 A;  2HEO A;  1IXS B;  3VOE A;  2BXY A;  3QYF A;  2K3P A;  5CKT A;  1A31 A;  4PGG A;  2IGK A;  4BJ6 C;  3J7A O;  4EM1 A;  3ZMT A;  2ZXW H;  4DGW B;  1HKT A;  2NXN B;  4F92 B;  3HOT A;  2KRH A;  4XQF A;  1H88 C;  3AL0 C;  3PNV A;  3JSO A;  3OR1 C;  3ZOB A;  2LG4 A;  2X4H A;  4KYW A;  4XSZ F;  2WY7 Q;  2CU7 A;  4UNO A;  3K10 A;  2MC3 A;  1WJE A;  4NB5 A;  1AA7 A;  4PUS A;  4WXC A;  3TOA A;  4Y3O A;  5J6X A;  3FF5 A;  1W4M A;  3CDI A;  4E7I A;  3HOY J;  3D1N I;  3J7A Y;  1XGS A;  4OMZ A;  4PDK A;  4BEH B;  3JRI A;  2JQ7 A;  5LHH A;  2RVC A;  3MQ0 A;  3S3O A;  1WHU A;  1Z7L A;  4IVN A;  1JD3 A;  3K1M A;  3GFL A;  1IRG A;  3GTO J;  3IAS 2;  4II2 A;  3EQL F;  4CA0 A;  4A5N A;  2BVL A;  2JUG A;  2MLK A;  4M3E A;  4I6Z A;  2FE3 A;  1BA5 A;  5F0F A;  1A6Q A;  1S29 A;  2AXT C;  2ZFW A;  1E3O C;  5HOD A;  3GO5 A;  1N25 A;  2W4S A;  1NG6 A;  2ME6 A;  2A68 F;  2ETH A;  2F4M B;  1O3R A;  2DJN A;  4XOR A;  2LY2 A;  2LKX A;  3LA3 A;  2D2W A;  3QYB A;  3JRD A;  1TQI A;  2AO9 A;  3MWM A;  5J1Y A;  2VC0 A;  1E2X A;  4MTD A;  3CCV I;  5BPD A;  1W36 D;  2VKE A;  4ZYA A;  4JK1 X;  4IL6 C;  4P9F A;  2L5Q A;  3EUH C;  5HLT A;  3S1M J;  5D8L B;  4ENK A;  1EV7 A;  1JHF A;  3IP4 B;  1U3E M;  1ZGA A;  1BJA A;  3A02 A;  3ML6 A;  1MDM A;  1FLI A;  2HNH A;  4RMN A;  4Y33 A;  1WRJ A;  4YIF A;  2O0Y A;  2NVX J;  4OIP F;  2ZSI B;  1G6N A;  1J75 A;  2R7Z J;  3WGI A;  1LQ1 A;  1MBJ A;  3HIF A;  1LNW A;  4FE7 A;  4FAS D;  5HS8 A;  2IA0 A;  2TCT A;  4HYE A;  4NQW A;  4CHU A;  1JGG A;  2K5C A;  4OAY A;  2LFB A;  3PQK A;  4GRI A;  1B8I A;  5L3G A;  4D1Q A;  2P6S A;  3W6K B;  3E7L A;  3EYI A;  3DTK A;  3QYE A;  4M3D A;  5CQG A;  2XUB A;  2MYS A;  5HDN A;  2JMW A;  3GVA A;  3H5N A;  4M3G A;  3K4B A;  4HBL A;  2QLZ A;  2ZXI A;  2DK8 A;  5EG0 A;  2IVM A;  2J5O A;  5JVG F;  4QPQ A;  2OD5 A;  1T95 A;  3TO9 A;  4HRI A;  3U2R A;  2GQQ A;  1KQ0 A;  3DLA A;  3LSJ A;  3I3L A;  4Y52 J;  2JT1 A;  2OA4 A;  3FM5 A;  1MJ9 A;  3COA C;  4MLO A;  1UJ8 A;  3DLL F;  3ZRG A;  3BZ6 A;  5BNG A;  5F1R A;  4E7J A;  3FX3 A;  2BYV E;  3CZ6 A;  2ID6 A;  3VOD A;  3L00 A;  2VE8 A;  2PQ8 A;  5KCM A;  5EF6 A;  3D5S C;  2HWV A;  3PFI A;  4A2U A;  2FSW A;  2W1O A;  4ZSI A;  1PP8 F;  2DBB A;  2DK5 A;  3QOE A;  1G4D A;  1E3P A;  3FIS A;  5KHD A;  4XBF A;  3M9A A;  1IN8 A;  1WCM J;  2CYY A;  1JE8 A;  2EIN H;  2VE9 A;  3CCR I;  2L4A A;  2KIF A;  1KU7 A;  3ZQQ A;  2CW0 F;  2DOA A;  1ETQ A;  5JLW A;  5FFX A;  4CYC A;  4BKX A;  3OL4 A;  4MEY F;  4WXD A;  2NS8 A;  3ESW B;  1RET A;  2H27 A;  1R00 A;  4RAY A;  3MFK A;  2DMT A;  2LR8 A;  3LA7 A;  4RGU A;  3V4G A;  2XPV A;  1Z3Y A;  5M5W J;  2LTP A;  3I5U A;  3P5J A;  3ZQ7 A;  1Z7U A;  1OMI A;  2BHZ A;  2MC4 A;  2DMP A;  4DBQ A;  4YG2 F;  1GVJ A;  3ZP5 A;  1SVM A;  2VQH A;  4XNF A;  2CRG A;  4K2E A;  3DBH B;  2L7K A;  1PDN C;  1SFO J;  5F1J A;  3UNG C;  1LFP A;  2MH9 A;  4LLG F;  1OR7 A;  3IKV A;  4L0Z B;  1YW8 A;  5GAH J;  1LJ9 A;  1Z67 A;  4IOA F;  5FKN A;  2QKL B;  1WGX A;  3DU6 A;  1MKM A;  1Y8R B;  3KZI C;  4IRG A;  1FBS A;  2PMZ A;  1DP7 P;  5HVQ C;  2FEZ A;  2O03 A;  5E8G A;  1BIB A;  1J5Y A;  4IQ4 A;  5FLX Z;  3FBI B;  4UV9 A;  3OYG A;  2CGP A;  1MW7 A;  4M3B A;  4C3J J;  3GCM A;  4MQ9 F;  3BTJ A;  2IKK A;  1JKO C;  5CVR A;  3OSF A;  4F7Z A;  1JI8 A;  5DD8 A;  3BG9 A;  2HXI A;  2NOG A;  2V7F A;  2LOO A;  4EVI A;  4EJO A;  1W0T A;  2VOP A;  2NVY J;  2UUZ A;  2QEX I;  1JJ8 C;  1X3W B;  4ZTF A;  1QVU A;  1QQI A;  1STZ A;  3CCM I;  2BVM A;  4LGW A;  2K02 A;  3HL2 A;  4L5E A;  4ANJ A;  1JTX A;  1F9N A;  5GAD J;  4CZZ A;  2BHY A;  2GXG A;  3A4C A;  1K83 J;  2DU9 A;  4BGD A;  2YR2 A;  4YEJ A;  1XD7 A;  5AIQ A;  4LIU A;  1U5T A;  2LYC A;  1IN7 A;  3J81 K;  4KFC A;  5IY5 H;  1G2H A;  4E7S A;  4TV7 A;  4LG0 B;  4XL9 A;  5CVJ A;  2XB5 A;  2H1K A;  1OPC A;  4P1W A;  1YFH A;  2FA5 A;  4UUT A;  1R6R A;  2ID3 A;  1RZ4 A;  3QRF F;  3NAU A;  2IPQ X;  1RPW A;  2JUC A;  4CZC A;  2H8W A;  2ZFU A;  4EV0 A;  3JRH A;  3HG9 A;  1XDU A;  3VSL A;  4Y15 A;  3KP5 A;  4G6Q A;  4P96 A;  3NAR A;  2EIL H;  2RC4 A;  2VJ5 A;  2GM4 A;  4PJJ A;  3WU2 C;  2HGC A;  4DYQ A;  3LSG A;  1BW5 A;  1LVK A;  4IZZ A;  1T38 A;  1SAX A;  2R5Z A;  1USS A;  2WAD A;  1EF4 A;  5F27 A;  1X1C A;  1R1V A;  2EV0 A;  5GTI C;  2L3D A;  3QP5 A;  3KE2 A;  2LNB A;  5K7Z A;  4MGR A;  3F8L A;  1E17 A;  1FP1 D;  2DOE A;  3PM1 A;  1U9O A;  1OYI A;  1IGN A;  5ILS A;  4FIS A;  4G8X A;  4RS8 A;  1J59 A;  3BOQ A;  3BG6 A;  5GPA A;  2EZL A;  5L3B A;  2VJI A;  4IHW A;  3GYH X;  5KVR A;  1YHQ I;  3ZQC A;  1MBE A;  1FEX A;  2HS5 A;  3DEU A;  4UUS A;  1LE8 B;  4A3B J;  5IT9 Z;  3I59 B;  3TKY A;  1WH5 A;  2WAF A;  4XKC A;  1VQM I;  2HXO A;  3K2Z A;  2M87 A;  2H94 A;  1X1A A;  3D5L A;  2WB1 N;  3BTC A;  5M3M J;  5FRO A;  4XRS A;  1XCV A;  1RKT A;  2IJL A;  2OTL I;  4D7N A;  2R7F A;  1I1G A;  2DYS H;  1P4A A;  4MFE A;  3MKW B;  1HLV A;  2F5V A;  3S2D J;  4H4K C;  4BHP A;  3QQA A;  4A3K J;  3SFI A;  3M4O J;  4IJA A;  3JAM Z;  2VKV A;  1KU9 A;  1F5T A;  3CJR B;  1ZRF A;  3H3V K;  4JYK A;  2CWE A;  2E5N A;  4X6A J;  1KGS A;  2PN6 A;  3ZQH A;  2KP6 A;  2KIM A;  5L3E A;  4ZSK A;  1WJF A;  3DWL E;  3KP2 A;  1MZB A;  1TC3 C;  2WAE A;  4GGG A;  4A3G J;  3H5R A;  1V5E A;  3KLO A;  3MD2 A;  1BR2 A;  4I0A A;  5B1B H;  4P9U A;  4ZTJ A;  5FRM A;  2NWI A;  2VXD A;  3HOW J;  3PFY A;  2ZJR F;  1VTN C;  3BJO A;  4NC8 A;  2V9P A;  2RN7 A;  5K1Y A;  4ITV A;  4AD9 A;  5EGO A;  3N97 A;  4Y4R A;  4XLF A;  1I27 A;  1IV8 A;  3VYT B;  3WE2 A;  3CC4 I;  3HDD A;  1Y1W J;  2PKH A;  3U1D A;  4G12 A;  1D1C A;  1MMD A;  1QZE A;  4PZJ A;  2M7B A;  3FXQ A;  3FXM A;  4RB1 A;  4F55 A;  2M2E A;  3CMM A;  2K85 A;  4BBS J;  3FZV A;  3JRF A;  2W84 A;  4BY7 J;  3A0B C;  4G9Y A;  1H89 C;  2GXA A;  1MBG A;  2L9R A;  4PJM A;  3PO2 J;  2RGV A;  3GW2 A;  2KLO A;  3F8M A;  1ZGJ A;  4A5M A;  1IN4 A;  3R6S A;  1MH3 A;  1WI9 A;  3SJM A;  4RAG A;  3E5Q A;  4DW6 A;  1UCR A;  2IGO A;  4BJ5 C;  4BE1 A;  2E1M B;  4KIB A;  3C7J A;  3I54 A;  3E1S A;  2VPL A;  5D5V B;  4G6D A;  3SQN A;  1XGN A;  1MMN A;  1U8B A;  4RM3 A;  3LWF A;  3V8J A;  1TNS A;  2A5W A;  5ED4 A;  2Z9O A;  3HOU J;  3M07 A;  2PBI A;  2K9L A;  3DBL B;  3BDD A;  4NUB A;  2BGC A;  5C4J J;  3DQV C;  3UR3 C;  3HEF A;  1NTC A;  2ICW G;  4A0X A;  1TWA J;  3K4C A;  2JA7 J;  2STT A;  3I64 A;  2KT0 A;  3CO7 C;  4ASN A;  2E34 A;  2ELK A;  1G3W A;  3BCB A;  3U21 A;  3M8J A;  3KET A;  4EGZ A;  3V8K A;  3JTH A;  2NVU B;  3GWZ A;  4B3A A;  4A6D A;  2VJJ A;  4G7H F;  1FWZ A;  4LG3 A;  1O7L A;  2CW7 A;  2VLA A;  1YG2 A;  2A05 A;  4XN0 A;  3ABT A;  1ZHF A;  5DYM A;  2VQC A;  1T08 B;  3V7R A;  3RJP A;  2P81 A;  1FOW A;  2AHQ A;  1Y8Q B;  1OCC H;  3F3X A;  5B3S H;  4A3M J;  2HDW A;  1D0Y A;  5ICC A;  5FO5 A;  2NVT J;  2LMD A;  4A69 C;  1ZR2 A;  4IRI A;  4GCV A;  2K40 A;  3TBI A;  2CFO A;  1HW2 A;  3OMY A;  2DMU A;  4LK0 F;  1FY7 A;  3A0H C;  2E7W A;  4RAF A;  2UZK A;  4L0Y B;  2XSJ C;  2LKP A;  5FKK A;  1YX5 A;  2XF6 A;  2HKO A;  1TTY A;  2M30 A;  3O3K A;  5FFZ A;  3ASN H;  1YOV B;  3EPZ A;  3WGH A;  2JPB A;  2L02 A;  2DOD A;  2QGU A;  4II3 A;  4RGX A;  4L18 B;  3BR1 A;  1O3T A;  1QVT A;  3HHG A;  1S9H A;  4B47 A;  3G73 A;  1XPX A;  2O9L A;  4U7D A;  3PJR A;  1S7O A;  2RAE A;  1ACI A;  2VPR A;  1J9I A;  1TT8 A;  2XGD A;  4E6K G;  3ZMV A;  1FBQ A;  5FB2 A;  1D0Z A;  2E60 A;  1T33 A;  1TQP A;  3Q0V A;  2PMU A;  5C3E J;  2UXN A;  4R1H A;  3ZN1 A;  3W6J B;  2VJ4 A;  2LRE A;  3S2H J;  3TDZ C;  3GTK J;  3L2R A;  1AHD P;  2HPM A;  3I55 I;  3F6O A;  2XGE A;  4S04 A;  5GAG J;  1VND A;  5KAI C;  2WV0 A;  1IUF A;  1NH3 A;  1R7J A;  4JX6 A;  3IWF A;  5IP7 J;  1G8X A;  3HGG A;  1PUE E;  2XVC A;  2BE5 F;  2YX7 A;  3CMA I;  2IS2 A;  4LIV A;  4BHB A;  2XRO A;  2MLG A;  3Q5F A;  1H9G A;  5J4Y A;  2DCE A;  2NS7 A;  4HNT A;  3CUO A;  3J7Y J;  2PX9 A;  2HVR A;  4MQV A;  2O6G E;  1JUP A;  1ZEL A;  2ECC A;  3F8F A;  2FML A;  4NC7 A;  3IRQ A;  1ERD A;  1TZL A;  2H09 A;  5J8F A;  4E4H A;  3F6V A;  4RAZ A;  3N05 A;  5ILV A;  1BI0 A;  4XLP F;  2PJP A;  2DT7 B;  2R4G A;  4BHC A;  4C3H J;  3C2G A;  1UAA A;  3O6B B;  4A3C J;  3S2W A;  3BTI A;  1U78 A;  5IOZ A;  4UHT A;  1ON2 A;  3PUF A;  1YW7 A;  3VFZ A;  2K4B A;  2EPF A;  2KKO A;  1NG7 A;  2KDO A;  5D5U B;  2YSR A;  2MD0 A;  3TL4 X;  1F36 A;  4Q47 A;  4N4O B;  2V9K A;  1HF0 A;  3OOP A;  2VBW A;  4BQO A;  4CSW A;  1JXS A;  2DT5 A;  2M0M A;  2VOD A;  1YLF A;  4PSW A;  1UHM A;  5TIS C;  3RKQ A;  2ZSH B;  2IXS A;  1RC9 A;  1V4R A;  2FXA A;  3DKW A;  2DN0 A;  2RQQ A;  2B63 J;  4CCJ A;  1BOA A;  1EA3 A;  1QGP A;  3UKG A;  1O57 A;  1X4P A;  1QBJ A;  3KYC B;  2EA2 A;  2P0W A;  2IBD A;  3FHZ A;  4QLC U;  1HKS A;  2HOA A;  2M9H A;  2QM3 A;  4LLL A;  2A6E F;  3VSK A;  1ZK8 A;  2YPR A;  3W6V A;  2CJJ A;  2NNN A;  5CQE A;  4C2M J;  3RZO J;  3NWS A;  5E8I A;  4MFD A;  3LSI A;  4I2O A;  3RKY A;  1UMQ A;  4IHX A;  5TGT A;  2DAO A;  2DO7 A;  3BJA A;  5CYV A;  3AG4 H;  4ZDP A;  1YJW I;  1DQU A;  1BI2 A;  5CPR B;  2VIX A;  1MBH A;  2ISZ A;  1X19 A;  3CME I;  3L5Z A;  4ZH4 F;  3HZJ A;  2V79 A;  2DTR A;  2X6X A;  4M74 A;  3IWZ A;  3MKY B;  2BXZ A;  2RNG A;  3FXL A;  1NK3 P;  1KU2 A;  3CF5 F;  3B6A A;  3CP2 A;  3MZH A;  4EAT A;  1WJB A;  1SEU A;  3OOU A;  3V7C A;  4EJT A;  2QVO A;  3LMM A;  2VI6 A;  1FP2 A;  4HX4 A;  2F48 A;  4FHT A;  1ZR4 A;  4CGZ A;  3QU3 A;  2WB1 A;  4EEF G;  4B3X A;  5H20 A;  5DUI A;  5J4V A;  1SAU A;  1ZLK A;  4HX8 A;  1RKW A;  3WTS C;  2QUF A;  3MKL A;  3FXR A;  4D9J A;  2F5D A;  2PG4 A;  3G6E I;  3GLL A;  5HNH A;  4LG0 A;  5L3C A;  2HU9 A;  2XSD C;  4ENM A;  3SEZ A;  4GDF A;  1DP3 A;  1KYZ A;  4CIC A;  3R61 A;  1NK2 P;  2G0E A;  3DXJ F;  3PQJ A;  5D6F A;  1FOY A;  3K4L A;  4PJN A;  1IC8 A;  3JRG A;  1PP7 U;  1BW6 A;  2HVQ A;  3CCQ I;  3NEU A;  1UHW A;  1DU0 A;  1MNE A;  2YS9 A;  1OYY A;  2E1N A;  4V19 K;  4CCL A;  4DNC A;  5LGU A;  2DA2 A;  3DEW A;  1D1A A;  3E6B A;  4WXH A;  4BXU A;  2DA1 A;  5LEJ A;  1WJ5 A;  1G81 A;  2A6T A;  4G7Z F;  2PLY A;  4WK8 F;  3S3M A;  3AKZ A;  1J0R A;  2MA3 A;  2LY9 A;  2Y48 A;  3FKI J;  4KA4 A;  5H6R A;  4XLE A;  1YI2 I;  3NWT A;  2GIZ A;  3I4P A;  4BBR J;  3BR2 A;  5L3F A;  1I5Z A;  1R1U A;  1GXP A;  3DDV A;  4QSH A;  5M5X J;  3CJQ B;  1S7E A;  3HPH A;  3GFI A;  4HOB A;  4LJZ F;  3LST A;  5HNF A;  1GV2 A;  2QBY B;  3QWL A;  4KMU X;  2CUJ A;  2Q1Z B;  4IHS A;  2HI3 A;  4CYD A;  4HDU A;  1LE8 A;  1QU3 A;  3VYR B;  3I59 A;  5JVT A;  3DKY A;  4QIW N;  3P9C A;  2VUM J;  2QQ8 A;  2CUF A;  3DF8 A;  2R7T A;  5F0C A;  4CCO A;  4I99 C;  5JI6 A;  3LAP A;  1W1W E;  2XB0 X;  3H9Q A;  3KIO A;  4A12 A;  3IC7 A;  3BC8 A;  2CQQ A;  4MIM A;  2I10 A;  2ZBK A;  4Q5S F;  1OIS A;  3P9I A;  3C1D A;  2DT6 A;  2CH0 A;  1VQ7 I;  2E2I J;  2E36 A;  1Z21 A;  3GTG J;  2X1E A;  5CVU A;  5CVI A;  1FT9 A;  1WWX A;  3I9V 2;  4FE4 A;  3WGG A;  1IN6 A;  3H1C A;  1XLR A;  2RA5 A;  2EZI A;  3DPT A;  2KJB A;  3HPG A;  1DU6 A;  1U6G A;  4UVB A;  3HUG B;  2CO5 A;  3ERM A;  2LD5 A;  3OYB A;  2X48 A;  1WJA A;  1FMV A;  4M72 A;  3M1C A;  2OAZ A;  5DUK A;  4HF0 A;  1PYV A;  1S8N A;  5DCM B;  3FMQ A;  4FTH A;  2F4O B;  2ZNZ A;  3Q9V A;  2X6W A;  1VQO I;  3RYR A;  3OR2 C;  2EV6 A;  2FMY A;  2HPI A;  3LNQ A;  2VQL A;  2Y31 A;  1JJ6 C;  5F0H A;  3WU1 B;  3RPU A;  4EMS A;  1ZAO A;  3E6D A;  1VF9 A;  4A3J J;  5E1W A;  3K1P A;  5K7H A;  4LB5 A;  2W24 A;  1OCT C;  1EH8 A;  4L5J A;  4BL0 B;  3BQY A;  3E0J B;  1LVA A;  1IV6 A;  4BU2 A;  2O8K A;  2BOL A;  5FGM A;  2GWR A;  2VBY A;  3R4K A;  1HSJ A;  1UFM A;  2XAU A;  1DPR A;  4QPO A;  3IUO A;  5DV5 A;  3OYJ A;  2G7U A;  2HR3 A;  3IKT A;  1GT0 C;  1IG7 A;  1UST A;  3RZD J;  5F6F A;  5HDG A;  3CQZ J;  2W48 A;  3AFH A;  4D7M A;  1VQ4 I;  3VPR A;  3BWG A;  5FJ8 J;  3JR9 A;  4AC0 A;  3ELK A;  2DA7 A;  3I56 I;  5E1Z B;  2HDC A;  1XC5 A;  3GME A;  4DBR A;  3HSE A;  2X6O A;  4DZJ A;  2E1M C;  1QO0 D;  1SD5 A;  3QPL A;  4GXO A;  3JW4 A;  1LEB A;  3T0Y A;  4NC6 A;  2N8G A;  4IOC F;  3S3N A;  4PK4 A;  4WF2 A;  2HOS A;  3VYS B;  1XX5 A;  3WG7 H;  3H92 A;  1MBF A;  1OR7 C;  1X2M A;  2ADU A;  4AID A;  4YFN F;  4FX4 A;  2IS6 A;  5HS9 A;  4OU0 A;  5C44 J;  2GOM A;  3WHC A;  1MJA A;  1A04 A;  5LD2 C;  2R7X A;  2VT3 A;  2OZU A;  1R1T A;  4DYR A;  2QYO A;  2L0K A;  4IXA A;  1ZTR A;  1ZAR A;  3S14 J;  1KA8 A;  3HRT A;  5E3N A;  5LGN A;  4ZYG A;  4LD5 A;  1ZLJ A;  1OYW A;  5J3L A;  4G94 A;  3T1B A;  2VB6 A;  5HOO A;  4WWC A;  1HDP A;  4A3E J;  4S05 A;  4PJL A;  3LL7 A;  5EEG A;  3ZQG A;  1DPU A;  4OMY A;  4YIR X;  4EGY A;  5BPI A;  1D8K A;  1FIP A;  5LFA A;  1LUJ B;  1HA8 A;  2WAQ A;  1R36 A;  2GBY A;  3K4K A;  1VQK I;  4M6V A;  1RES A;  1U5T C;  2JVG A;  3CF2 A;  2Y0M A;  4UUV A;  5F08 A;  1ON1 A;  4C3I J;  4YRV A;  3WTW C;  2PJR B;  3Q9S A;  4HA8 A;  2JRT A;  3BZC A;  4GFB A;  2IEK A;  3TW7 A;  1ZH5 A;  4BY1 J;  4KIS A;  2DA5 A;  4YFX F;  4WX9 A;  1HCR A;  4LB6 B;  1W5T A;  1K61 A;  1SVO A;  3R0A A;  2F5E A;  4U88 A;  5TJJ A;  1V55 H;  3OIO A;  3SZT A;  2K86 A;  3K2A A;  5A2Q K;  3V8L A;  2R7Q A;  2R92 J;  2Z33 A;  4IHT A;  2XHK A;  3FM3 A;  3CLQ A;  2QWW A;  2KZG A;  2BBY A;  1TBX A;  2XKP A;  3KEO A;  1KYW A;  5E79 C;  4PJ0 C;  2M5W A;  3HKZ A;  2FBI A;  3BR6 A;  2DA4 A;  4BQA A;  1I50 J;  2R7D A;  4XLA A;  4HSR A;  1LFU P;  3GZ6 A;  3RSN A;  1L3L A;  4RLQ A;  2F5C A;  4AYB A;  1B6A A;  1FMW A;  2EK5 A;  2KL4 A;  3RPU D;  3HOZ J;  4AVZ A;  2C6Y A;  1V3F A;  4B44 A;  2VON A;  2OCC H;  3PNT A;  2DPU A;  3L2Q A;  1YIJ I;  1K4T A;  2B0L A;  3JTG A;  1K7A A;  2DJI A;  2WY8 Q;  3G2B A;  3KP3 A;  4ZJZ A;  3QPS A;  3OYD A;  3NRV A;  4BXF A;  3ABM H;  3H35 A;  5F04 A;  4E7K A;  3OY9 A;  4EM2 A;  4NHJ A;  3KX2 A;  2V6E A;  1FSE A;  2HVS A;  1SD6 A;  4AIH A;  2DLL A;  4LFU A;  3ZMD A;  3F0C A;  2V1N A;  2D1V A;  4ENN A;  1ZRC A;  3M8E A;  4IF4 A;  2STW A;  5IOY A;  3MVP A;  4NDL A;  1G3S A;  1RUO A;  5E1X A;  1ZKG A;  4CH7 A;  3PO3 J;  1I39 A;  4MTE A;  1T2K A;  1K6Y A;  3H3U A;  3RTR A;  3BR3 A;  2H1L A;  4ETS A;  2P5K A;  4XIC A;  2G7H A;  1ONV A;  1VQL I;  1HW5 A;  2Q2E B;  5J8C A;  2K4J A;  2K7L A;  1EH6 A;  2XV4 S;  4A3I J;  1AU7 A;  1WI3 A;  4X0G A;  1LB2 A;  2Y30 A;  2K9Q A;  1HBX G;  2A07 F;  3KP6 A;  3TGN A;  2NOJ B;  4CO8 A;  2EFQ A;  3P9K A;  4EM0 B;  2O61 A;  2NYX A;  1Y6I A;  2OC6 A;  1RR7 A;  4M9Z A;  4HNU A;  2GZW A;  1V5F A;  2VBX A;  2EA4 A;  5K7F A;  1LFB A;  3AAF A;  4I02 A;  2Y9Z A;  4OIN F;  5LHG A;  4HLY A;  2VN2 A;  2Y9Y A;  3WTY C;  1G1B A;  3OIP A;  4DOZ A;  1W7P B;  1BC7 C;  2E2J J;  3L1P A;  4BQQ A;  1XMX A;  2WBM A;  2BV6 A;  2DI3 A;  3L2C A;  5H2F C;  1R22 A;  1H9T A;  1VQ8 I;  4PSX A;  3F23 A;  1VQ6 I;  4KT6 A;  3KYD B;  4KUM A;  1HST A;  3WG9 A;  2JZY A;  4O3M A;  2CSO A;  3S16 J;  1LKX A;  2TRT A;  2LKS A;  4XK4 A;  2YU3 A;  1J2X A;  2AS5 F;  1TQM A;  3SYT A;  5HLG A;  2J5P A;  3NQO A;  3V42 A;  2P8T A;  4RB0 A;  2X0L A;  2XIG A;  1XDS A;  3U9G A;  4KIF A;  1G3T A;  3HBL A;  3MAJ A;  3MEX A;  5IP9 J;  3G4S I;  3DPL C;  1BL0 A;  3BPX A;  1PUF B;  2WC2 A;  3I4M J;  3TW6 A;  2HYF A;  1OLT A;  1W5S A;  1B4A A;  1D8J A;  2KQR A;  3WTU C;  3QP6 A;  3OYF A;  3TED A;  4CUG A;  1PJR A;  3DV8 A;  1MSE C;  4LMY A;  1VQ9 I;  3BG5 A;  3TMO A;  5EZG A;  4UY8 I;  2O8X A;  2PMH A;  1LDJ A;  1YS6 A;  2DA3 A;  3F72 A;  3KLN A;  4KJZ A;  2P4W A;  4OIO F;  1IRF A;  3DTI A;  3TP0 A;  3LSH A;  3E5X A;  5GAE J;  3PUB A;  1F43 A;  1MBK A;  4HEA 2;  3CCJ I;  1I6H J;  1TWH J;  5D5X B;  1O3Q A;  1B72 B;  4BEH A;  3BP8 A;  1ZRD A;  4FET A;  4FCY A;  2MW8 A;  2CV2 A;  4I09 A;  3G71 I;  2COB A;  4HF1 A;  2HZT A;  1X1P A;  1GHC A;  2GA1 A;  2XPU A;  5KAF C;  3QU6 A;  4A0Z A;  3BR5 A;  3GZN B;  3A01 B;  1BI1 A;  5CVV A;  1WJD A;  3B02 A;  2QSG X;  1EKE A;  2KHM A;  5DCF A;  3FWE A;  3AG3 H;  2K9N A;  2LBF B;  4ZYE A;  3CTA A;  3SZP A;  3I53 A;  4KIC A;  1FX7 A;  4RGS A;  3CJN A;  2XAQ A;  3T5X A;  1WVR A;  4YFK F;  3CUQ B;  1B59 A;  1YW9 A;  2EZH A;  3J81 Z;  3RPQ A;  4RLF A;  1FJL A;  3PIP F;  1QHG A;  2FRH A;  1P4X A;  2GOX B;  2WA0 A;  2R93 J;  4HF2 A;  3HHH A;  5EEA A;  1G59 A;  2EQR A;  1Y0N A;  4ENJ A;  2Z1D A;  2Z99 A;  1OQY A;  1TWC J;  1T0F C;  1S6L A;  3BTL A;  2VT2 A;  3S8P A;  3C2H A;  5A2Q Z;  2UWM A;  3LA2 A;  1R58 A;  2DQL A;  3K6G A;  2R7R A;  2DOF A;  4M73 A;  3JRA A;  1IXR C;  1T0F A;  2M7A A;  3GEZ A;  2MH2 A;  4L9T A;  1JKP C;  2QBY A;  4NNJ A;  1IDZ A;  3CLO A;  2XDV A;  4ESJ A;  3O8H A;  1MD0 A;  1FIA A;  4ZDL A;  2LF8 A;  2OV7 A;  1GVD A;  3EYY A;  2M8G X;  3GBG A;  1RI7 A;  2JA8 J;  2MGQ A;  1ZN2 A;  5ICG A;  4KN4 X;  4KNY A;  3GZ5 A;  4BE2 A;  3HRM A;  3S1R J;  3HM5 A;  3PL8 A;  1GV5 A;  1QPM A;  2BEO A;  2HQA A;  3G1L A;  4BH9 A;  4E7H A;  3OSG A;  4MEX F;  2HOE A;  3OS1 A;  1P9Q C;  2CV0 A;  5ILU A;  3GXO A;  1FBU A;  2OBP A;  3DEE A;  1X3Z B;  1ENH A;  3HB9 A;  3DBR B;  1JKQ C;  1ZG1 A;  4XRF A;  3HUG A;  1RNL A;  4MO7 A;  4XRM A;  3IV5 A;  2NVQ J;  2AQF A;  2DMQ A;  3HSR A;  2R0Q C;  1YS7 A;  1WKM A;  2QQA A;  3DCF A;  5DCM A;  4C30 A;  2BW3 B;  1UZC A;  4I76 A;  4DQ2 A;  4P55 A;  2ME0 A;  4IHV A;  3OYE A;  2LC2 A;  2VKD A;  1QPI A;  1W5C C;  2PEX A;  1MND A;  4JP0 A;  4E7L A;  3CCU I;  1I1S A;  2WAQ N;  2VQG A;  2D1H A;  1UEL B;  2LDU A;  2ACJ A;  4L9J A;  1A35 A;  3FIW A;  2IW5 A;  2BZT A;  3RQ4 A;  4LOC A;  3G1O A;  3BT9 A;  5GP9 A;  4FX0 A;  3SEQ A;  2ZJ2 A;  2XPW A;  4IKF A;  5DD4 A;  5HLI A;  4KT5 C;  1R71 A;  1SVL A;  3K9T A;  2L2O A;  1O3S A;  3S15 J;  3ZGK A;  1T6S A;  3Q0U A;  2ISY A;  1YYV A;  2XAJ A;  4MNU A;  3JRC A;  3ROU A;  4XKB A;  1OCZ H;  5B1A H;  2WWY A;  1JT0 A;  2X1D A;  5J40 A;  3A03 A;  1DGR M;  2O7O A;  2M4K A;  2CUZ A;  4HV5 A;  4J19 A;  1T98 A;  2M45 A;  1R49 A;  1KQ9 A;  3HGY A;  1R4M B;  3ABK H;  1SFU A;  1AKH B;  4ZSB A;  1X3U A;  1Z1D A;  1JT6 A;  1HDD C;  4PGH A;  4Y13 A;  2EV5 A;  1XB4 A;  1V5G A;  3BRO A;  3HKZ N;  2KFD A;  3HOS A;  4V2F A;  1M1E B;  2PI0 A;  2HYG D;  5FD6 A;  3KFW X;  4AYB N;  4HV6 A;  2IGM A;  3SZG A;  1IJW C;  1GUU A;  2FF4 A;  2X51 A;  4V2G A;  4RB3 C;  3ZQI A;  1DDN A;  1FOX A;  3VB2 A;  1H8A C;  1KU3 A;  5ICE A;  2W25 A;  1YRN B;  2DFE A;  3AG2 H;  5FLM J;  2IA1 A;  5E3O A;  4Q4Z F;  3CD6 I;  2A3S A;  5FKL A;  3B6C A;  1IZ1 A;  2DFH A;  2IS4 A;  1YJN I;  3B73 A;  2ELH A;  2HTJ A;  5DM6 F;  4HNV A;  3M1E A;  3VEP A;  2JA6 J;  2F6C A;  4XR6 A;  3ZMU A;  3I4N J;  4X1E A;  1B1B A;  2CQ7 A;  2FQ4 A;  4RBO A;  3WTV C;  3KP4 A;  4QTR A;  5F64 A;  2R3S A;  1IUY A;  1FTZ A;  4U7B A;  1U2W A;  2LF7 A;  4N9I A;  3K4J A;  1DGW Y;  1R5I D;  4M6X A;  3L9F A;  5EDN A;  1D1B A;  2RV8 A;  1MGT A;  2Q0O A;  1FSH A;  3E97 A;  3P7N A;  5KK1 A;  1ZG5 A;  5FKO A;  3LAJ A;  3HFI A;  5HDK A;  2JSP A;  4Q48 A;  1BR1 A;  3MKZ A;  3Q3S A;  4ESB A;  2FJ1 A;  2I5U A;  4RM2 A;  3PSI A;  1BC8 C;  2QZ8 A;  4HX7 A;  3HTU A;  4M9X A;  5LLQ A;  2F4I A;  2JA2 A;  1IDY A;  4DYC A;  3FMS A;  3GTQ J;  2QEN A;  2AHC A;  2CG4 A;  2ECB A;  2EB7 A;  5K5O A;  1K6O A;  2PJR A;  3MMY B;  2OOI A;  2JWT A;  2FNA A;  5FLX K;  3FHN A;  3IH2 A;  5DDG A;  3FK7 A;  2CV1 A;  4U87 A;  4D5F A;  1BIA A;  3LSM A;  4A0Y A;  2HKX A;  2P6T A;  5D8K B;  1R5H A;  1X4O A;  3JSP A;  1C0W A;  2XAG A;  2JJ7 A;  1FYL A;  2OTJ I;  1REP C;  3PNY A;  1F4K A;  3LSP A;  2JVH A;  3DU5 A;  4BXX J;  5TRD A;  2QCO A;  1P7J A;  1TW3 A;  4BQN A;  2LY1 A;  2P5V A;  3QPH A;  4KIT B;  5K5Q A;  3OYH A;  1SC7 A;  3W2V A;  1MMA A;  2X6Y A;  1R4N B;  3K1N A;  2V4J C;  5E17 F;  1TNT A;  3KP7 A;  1BBY A;  4XN3 A;  1GDT A;  1LEA A;  3DKX A;  2KIU A;  3TQN A;  3JRB A;  2MSY A;  2UV1 A;  2IT0 A;  1CGP A;  5K5R A;  4UVA A;  4XMY A;  4IHY A;  2H6C A;  2ZNY A;  3LFK A;  1J09 A;  3IHU A;  2DDA A;  5J1U A;  2ZCW A;  1TWG J;  2E1O A;  2E35 A;  1ETX A;  3EUA A;  2YU9 J;  1TLH B;  3I71 A;  4E70 A;  5BS6 A;  2R7U A;  2FBH A;  5FKM A;  1TW2 A;  2V1U A;  4N4N B;  1N78 A;  4DJA A;  3CDH A;  3QPT A;  3V7S A;  2LSO A;  3VYU B;  2IRF G;  1K78 B;  4UVC A;  1S3J A;  5L3D A;  3L2V A;  2G9W A;  1FTT A;  3WTZ A;  1RR8 C;  2EBI A;  1N77 A;  4CXF A;  2EIM H;  3HXL A;  2DA6 A;  4BNC A;  2Q2E A;  5AIP A;  3WHB A;  1UHS A;  5IYC J;  2HOT A;  5EJC A;  4JX4 A;  3HOX J;  4A3D J;  1IRZ A;  3U1K A;  3EET A;  4XSX F;  2FU4 A;  3ZR8 X;  2A5Y B;  2NAZ A;  3EUH A;  4UB8 C;  2DTZ A;  2L54 A;  4JQF A;  3MN2 A;  2ELJ A;  3ZXS A;  4BAY A;  5FLV A;  1IF1 A;  3HOV J;  4WCG A;  1E0E A;  5IT9 K;  3Q0W A;  4A93 J;  3E3V A;  4F93 B;  4J00 A;  1TWF J;  3OL3 A;  3J7Z I;  2W7N A;  1CQT A;  3KEQ A;  3W2W A;  2DPD A;  2MFZ A;  1W7P A;  2OJE D;  2WTE A;  2JA5 J;  3CCE I;  3MZ8 A;  3CCL I;  5IYD J;  2Y0S N;  1CF7 B;  1YJ9 I;  1XMA A;  4AVP A;  2O3F A;  3F8C A;  1ORK A;  1LPQ A;  3QOP A;  1UB9 A;  4Y7N J;  4B1R A;  1YIO A;  2KPM A;  2IGN A;  1MH4 A;  2K9M A;  4XRS G;  2HDD A;  3C18 A;  3E6M A;  5E3L A;  1BI3 A;  4O6J A;  5JLX A;  3K70 C;  1SFE A;  4AIJ A;  1Z77 A;  2W85 A;  5M5Y J;  3JAM K;  3CC2 I;  5LEK A;  4B4C A;  4HG2 A;  4YII A;  2CW8 A;  3RYP A;  1QRY A;  2RKH A;  3LSK A;  5D4R A;  3WOD F;  1ZG3 A;  1HC8 A;  1PUF A;  1BOB A;  1I6X A;  1SFK A;  1B9M A;  1IN5 A;  3ZMZ A;  1F1Z A;  2XAS A;  2ZXH A;  4B43 A;  1LDD A;  2ZME B;  3IL2 A;  2ZJP F;  3ZMS A;  2EZK A;  1ZGW A;  3H9J A;  1J7K A;  2DYR H;  2R5Y B;  1WQ2 A;  4I98 B;  4M9S A;  3OYL A;  1NHA A;  1ETO A;  2I8D A;  3OYK A;  3ERE D;  2GAU A;  4M71 A;  4FT8 A;  4C2T A;  3L7W A;  1XGO A;  1X2N A;  3J80 K;  2EFN A;  2QF7 A;  4ZYD A;  1KON A;  1A6I A;  4C9Y A;  1HOM A;  3CCY A;  4U0Y A;  1Z91 A;  3T8T A;  3DP7 A;  2E7X A;  1P7I A;  4L9N A;  2IS1 A;  2K27 A;  1SD4 A;  3EUK L;  1MIJ A;  4AIK A;  1B72 A;  2JK3 A;  4AUX A;  3OWT A;  4DZP A;  2EFW A;  3AG1 H;  3HYI A;  3FXJ A;  2VL8 A;  3S17 J;  4BJT A;  3I58 A; 
#chains in the Genus database with same CATH homology
 4UXN A;  4HAM A;  4R79 A;  2P5L C;  2GA2 A;  3ULQ B;  3KZZ A;  1JGS A;  1FC3 A;  4HQE A;  3CUQ C;  3L09 A;  4RGR A;  2XAF A;  5JHU A;  1DUX C;  1FYM A;  2OGG A;  3CUQ A;  4HDV A;  2L01 A;  2RDP A;  4A6E A;  2V1X A;  4P5O A;  4B8X A;  3D0S A;  2V6C A;  3CO6 C;  2EFO A;  2RNJ A;  4KIG A;  3F21 A;  1MJB A;  1AWC A;  1JHH A;  2A69 F;  2M1B A;  5BQT A;  4L5I A;  2P19 A;  3T8R A;  3MCZ A;  3WTX C;  4Z2Y A;  5HLH A;  3H3Z A;  3OV8 A;  1B9N A;  4IRH A;  3TOB A;  2V9V A;  2HTS A;  1SD7 A;  2Z5U A;  1T39 A;  2TDX A;  3GFJ A;  4PCQ A;  1HXD A;  3BJ6 A;  2IA2 A;  2OQG A;  1D3Y A;  1W7P D;  4EQQ A;  2VXZ A;  2QQB A;  3KZY A;  2ZO4 A;  3F8B A;  1P92 A;  5IT3 A;  4OIR F;  1SFX A;  3FMR A;  2ZXJ A;  3LHE A;  4U0V A;  4B09 A;  3ECH A;  5CLS A;  2XGX A;  3F8N A;  1QNT A;  2DQR A;  1XSD A;  2NRA C;  3RKW A;  3GX4 X;  1G3Y A;  2EFP A;  1Z9C A;  1R23 A;  1ODD A;  2Z3Y A;  2PFB A;  1XCB A;  5LRR A;  4IPA A;  2CFX A;  3WU0 A;  3G3Z A;  1MDM B;  4OIQ F;  2VOO A;  1XGM A;  5EEH A;  1O7F A;  4I7H A;  3SHF A;  3E5U A;  3IRR A;  3M7G A;  4I0B A;  2KRF A;  5H6Q A;  3FXU A;  4N0B A;  1HQC A;  1L0O C;  2KJC A;  4R8H A;  2IP2 A;  4GO1 A;  4U0W A;  2XAH A;  1K79 A;  4GYI A;  4ZYH A;  4JBA A;  2YX4 A;  2HQN A;  3R0J A;  3N4M A;  2NS0 A;  3I0T A;  1FW9 A;  5FD5 A;  3F22 A;  1R5G A;  2FBK A;  1XSX A;  2JPC A;  4LK1 F;  3TO7 A;  3GLX A;  1HW1 A;  2Q8K A;  3K69 A;  2AXL A;  4G7O F;  5D5W B;  3GFM A;  3J80 Z;  3EDP A;  2W57 A;  3ISP A;  3ZPL A;  3M8F A;  2GXB A;  3E6C C;  3HTS B;  1EH7 A;  4BYY A;  4L9V A;  1RIO H;  1S7A A;  1P4W A;  3SXY A;  4EJW A;  2DW4 A;  3LQQ A;  1U8R A;  2FA1 A;  2ESN A;  2F5F A;  1QZY A;  3TO6 A;  4KN7 X;  3WTT C;  3DFG A;  6PAX A;  1FNN A;  5JR3 A;  2EJR A;  1IW7 F;  5ICF A;  3MZY A;  1AOY A;  5LGT A;  2L4M A;  5HS7 A;  2COM A;  1LDK B;  5BOX A;  5ERI A;  4ON0 A;  5E18 F;  1YO5 C;  4I01 A;  2HFH A;  2XRN A;  2HQR A;  2FQ3 A;  5DEQ A;  2OZ6 A;  2VC1 A;  3KCC A;  3K0L A;  3REO A;  1IXC A;  1H0M A;  3C3W A;  3GUD A;  4ZZL A;  3BPV A;  3WE3 A;  5BMZ A;  1FPQ A;  4HZF A;  2XKO A;  1FZP B;  2VBZ A;  4N9H A;  4OOI A;  1P2F A;  1FOK A;  2CQK A;  2JTV A;  3ECO A;  2OQR A;  3ZN0 A;  2P7C B;  2ZKZ A;  4HQM A;  1K78 A;  1Z6T A;  1XN7 A;  1RUN A;  1YQA A;  1U5T B;  1FYK A;  4ZZD A;  1ZYR F;  2RQP A;  3CNV A;  1ZRE A;  3HSF A;  3QAH A;  1SMT A;  4M6Y A;  4ESF A;  3HRU A;  5LRS A;  2ESH A;  2FNP A;  3TDU C;  3LQR A;  1P6R A;  3HRS A;  2V1D A;  2OU2 A;  5LBQ A;  3RI4 A;  4EJV A;  1Y0U A;  2M8E A;  2A6H F;  1CF7 A;  1WSU A;  1Z05 A;  1GXQ A;  4AWX B;  3O2P E;  1SMY F;  2H6B A;  2F2E A;  5LHI A;  5JFR A;  1HKQ A;  3BY6 A;  3SFZ A;  1XSV A;  4MHG A;  2UXX A;  1BN5 A;  2NNY A;  2GIV A;  2A61 A;  4HW0 A;  2DFI A;  4HLX A;  2Y75 A;  2ZME A;  5D6E A;  4RB2 C;  2JSC A;  5AON A;  4KDP A;  2MBF A;  1Q1H A;  4CDG A;  5CJ9 A;  3RDI A;  1D5V A;  3R60 A;  1KQ8 A;  4QWQ A;  2D45 A;  1ULY A;  4D0P A;  1QZZ A;  4Y17 A;  3ABU A;  2E1C A;  4O5V A;  2MD5 A;  5D4S A;  1YTY A;  2QQ9 A;  4H0E A;  4UV8 A;  4GYG A;  4EJU A;  2P7V B;  2EWN A;  1OKR A;  4KMF A;  2FOK A;  3RIR A;  1XMK A;  3GF2 A;  1IAW A;  4XLN F;  4LLN A;  1Z6R A;  3RKX A;  5E20 A;  1BM9 A;  2HEO A;  1IXS B;  3VOE A;  4PGG A;  3J7A O;  4EM1 A;  3ZMT A;  1HKT A;  3HOT A;  3JSO A;  4KYW A;  2X4H A;  4XSZ F;  4UNO A;  2MC3 A;  5J6X A;  4NB5 A;  4WXC A;  3TOA A;  3FF5 A;  1W4M A;  1XGS A;  4OMZ A;  4PDK A;  5LHH A;  2RVC A;  3MQ0 A;  4IVN A;  1JD3 A;  3K1M A;  3GFL A;  1IRG A;  3EQL F;  4A5N A;  2MLK A;  2FE3 A;  1S29 A;  2ZFW A;  3GO5 A;  2A68 F;  2ETH A;  1O3R A;  3LA3 A;  2D2W A;  1TQI A;  3MWM A;  2VC0 A;  1E2X A;  4MTD A;  5BPD A;  4JK1 X;  4P9F A;  5D8L B;  4ENK A;  1EV7 A;  1JHF A;  1U3E M;  1ZGA A;  1BJA A;  3ML6 A;  1MDM A;  1FLI A;  4YIF A;  1WRJ A;  2O0Y A;  4OIP F;  1G6N A;  1J75 A;  3WGI A;  1LQ1 A;  3HIF A;  1LNW A;  5HS8 A;  2IA0 A;  4HYE A;  4NQW A;  4CHU A;  3PQK A;  5L3G A;  2P6S A;  3W6K B;  3EYI A;  2XUB A;  5HDN A;  3GVA A;  4HBL A;  2QLZ A;  2DK8 A;  2IVM A;  2J5O A;  2OD5 A;  3TO9 A;  3U2R A;  2GQQ A;  1KQ0 A;  2JT1 A;  2OA4 A;  3FM5 A;  1MJ9 A;  3COA C;  3BZ6 A;  5F1R A;  3FX3 A;  2BYV E;  3VOD A;  3L00 A;  2VE8 A;  2PQ8 A;  2HWV A;  3PFI A;  4A2U A;  2FSW A;  4ZSI A;  1PP8 F;  2DBB A;  2DK5 A;  1G4D A;  4XBF A;  3M9A A;  1IN8 A;  2CYY A;  1JE8 A;  2VE9 A;  2L4A A;  2KIF A;  1KU7 A;  2CW0 F;  5FFX A;  4MEY F;  4WXD A;  2H27 A;  1R00 A;  4RAY A;  3MFK A;  3LA7 A;  4RGU A;  3V4G A;  3ZQ7 A;  3I5U A;  1Z7U A;  1OMI A;  4YG2 F;  1GVJ A;  3ZP5 A;  4K2E A;  1PDN C;  2MH9 A;  4LLG F;  1OR7 A;  3IKV A;  4L0Z B;  1YW8 A;  1LJ9 A;  1MKM A;  4IRG A;  1FBS A;  1DP7 P;  5HVQ C;  2FEZ A;  2O03 A;  5E8G A;  1BIB A;  1J5Y A;  5FLX Z;  4UV9 A;  2CGP A;  4MQ9 F;  2IKK A;  5CVR A;  4F7Z A;  5DD8 A;  4EVI A;  4EJO A;  2VOP A;  1QQI A;  1STZ A;  4LGW A;  2K02 A;  1F9N A;  4CZZ A;  2GXG A;  2DU9 A;  2YR2 A;  1XD7 A;  5AIQ A;  1U5T A;  1IN7 A;  3J81 K;  4KFC A;  4TV7 A;  4LG0 B;  5CVJ A;  1OPC A;  1YFH A;  2FA5 A;  1RZ4 A;  3QRF F;  2IPQ X;  4EV0 A;  1XDU A;  4Y15 A;  3KP5 A;  4G6Q A;  4P96 A;  2RC4 A;  2HGC A;  1T38 A;  1SAX A;  1USS A;  1R1V A;  2EV0 A;  2L3D A;  3QP5 A;  3KE2 A;  2LNB A;  4MGR A;  3F8L A;  1E17 A;  1FP1 D;  1OYI A;  5ILS A;  4RS8 A;  4G8X A;  1J59 A;  3BOQ A;  5L3B A;  3GYH X;  5KVR A;  2HS5 A;  3DEU A;  5IT9 Z;  3I59 B;  3TKY A;  3K2Z A;  2M87 A;  2H94 A;  3D5L A;  1XCV A;  2IJL A;  2R7F A;  1I1G A;  1P4A A;  4BHP A;  4IJA A;  3JAM Z;  1KU9 A;  1F5T A;  1ZRF A;  2CWE A;  1KGS A;  2PN6 A;  2KIM A;  5L3E A;  4ZSK A;  3KP2 A;  1MZB A;  4GGG A;  4P9U A;  3KLO A;  4I0A A;  2NWI A;  1VTN C;  3BJO A;  5K1Y A;  2RN7 A;  4AD9 A;  3N97 A;  1I27 A;  3WE2 A;  2PKH A;  3U1D A;  4PZJ A;  3FXQ A;  4RB1 A;  3FZV A;  2W84 A;  4G9Y A;  2RGV A;  3GW2 A;  3F8M A;  1ZGJ A;  4A5M A;  1IN4 A;  3R6S A;  1WI9 A;  3E5Q A;  1UCR A;  4KIB A;  3C7J A;  3I54 A;  5D5V B;  4G6D A;  3SQN A;  1XGN A;  3LWF A;  3V8J A;  1TNS A;  5ED4 A;  2Z9O A;  2PBI A;  3BDD A;  2BGC A;  3DQV C;  4A0X A;  2STT A;  3I64 A;  3CO7 C;  4ASN A;  1G3W A;  3KET A;  4EGZ A;  3V8K A;  3JTH A;  3GWZ A;  4G7H F;  4A6D A;  1FWZ A;  1O7L A;  1YG2 A;  3ABT A;  1ZHF A;  5DYM A;  3V7R A;  3RJP A;  3F3X A;  5ICC A;  5FO5 A;  4IRI A;  4GCV A;  1HW2 A;  4LK0 F;  1FY7 A;  2E7W A;  2UZK A;  4L0Y B;  2LKP A;  2HKO A;  1TTY A;  2M30 A;  3O3K A;  5FFZ A;  3WGH A;  2JPB A;  2L02 A;  4L18 B;  4RGX A;  1O3T A;  3HHG A;  3G73 A;  1TT8 A;  4U7D A;  1S7O A;  1J9I A;  3ZMV A;  1FBQ A;  5FB2 A;  1TQP A;  2PMU A;  2UXN A;  4R1H A;  3ZN1 A;  3W6J B;  3TDZ C;  3F6O A;  4S04 A;  2WV0 A;  1R7J A;  3IWF A;  1PUE E;  2XVC A;  2BE5 F;  2YX7 A;  2XRO A;  4BHB A;  2MLG A;  3Q5F A;  1H9G A;  3CUO A;  4MQV A;  2O6G E;  3F8F A;  2FML A;  3IRQ A;  2H09 A;  5J8F A;  3F6V A;  4RAZ A;  5ILV A;  1BI0 A;  4XLP F;  2PJP A;  4BHC A;  3O6B B;  3S2W A;  1U78 A;  4UHT A;  1ON2 A;  1YW7 A;  3VFZ A;  2K4B A;  2KKO A;  5D5U B;  2YSR A;  4Q47 A;  3OOP A;  2VBW A;  1JXS A;  2DT5 A;  2VOD A;  1YLF A;  1UHM A;  1V4R A;  2FXA A;  3DKW A;  1BOA A;  1QGP A;  1O57 A;  1QBJ A;  2EA2 A;  3FHZ A;  4QLC U;  1HKS A;  2QM3 A;  4LLL A;  2A6E F;  2YPR A;  2NNN A;  5E8I A;  4I2O A;  3RKY A;  2DAO A;  2DO7 A;  3BJA A;  5CYV A;  1BI2 A;  2ISZ A;  3L5Z A;  4ZH4 F;  2V79 A;  2DTR A;  4M74 A;  3IWZ A;  1KU2 A;  3MZH A;  3V7C A;  4EJT A;  2QVO A;  1FP2 A;  4HX4 A;  4FHT A;  4CGZ A;  3QU3 A;  5H20 A;  5DUI A;  1ZLK A;  4HX8 A;  3WTS C;  2QUF A;  3FXR A;  2F5D A;  2PG4 A;  4LG0 A;  5L3C A;  4ENM A;  1KYZ A;  4CIC A;  3R61 A;  3DXJ F;  3PQJ A;  5D6F A;  1PP7 U;  3NEU A;  1UHW A;  2E1N A;  1OYY A;  4DNC A;  5LGU A;  4WXH A;  3E6B A;  4BXU A;  5LEJ A;  1G81 A;  4G7Z F;  2PLY A;  4WK8 F;  1J0R A;  2MA3 A;  2Y48 A;  4KA4 A;  5H6R A;  3I4P A;  5L3F A;  1I5Z A;  1R1U A;  1GXP A;  3DDV A;  3GFI A;  4HOB A;  4LJZ F;  3LST A;  2QBY B;  4KMU X;  4IHS A;  4CYD A;  4HDU A;  3I59 A;  5JVT A;  3P9C A;  3DF8 A;  5JI6 A;  3LAP A;  4A12 A;  3IC7 A;  4Q5S F;  2ZBK A;  3P9I A;  3C1D A;  5CVU A;  5CVI A;  1FT9 A;  1WWX A;  3WGG A;  2RA5 A;  1IN6 A;  1XLR A;  3DPT A;  2KJB A;  1U6G A;  4UVB A;  2CO5 A;  4M72 A;  2OAZ A;  5DUK A;  4HF0 A;  5DCM B;  1S8N A;  3FMQ A;  2ZNZ A;  3Q9V A;  3RYR A;  2EV6 A;  2FMY A;  3WU1 B;  3RPU A;  4EMS A;  1ZAO A;  3E6D A;  5E1W A;  3K1P A;  4LB5 A;  2W24 A;  1EH8 A;  4L5J A;  1LVA A;  5FGM A;  2GWR A;  2VBY A;  3R4K A;  1HSJ A;  1UFM A;  1DPR A;  5DV5 A;  2G7U A;  2HR3 A;  3IKT A;  1UST A;  5F6F A;  5HDG A;  3BWG A;  3ELK A;  5E1Z B;  2HDC A;  3HSE A;  1QO0 D;  1SD5 A;  4GXO A;  3JW4 A;  1LEB A;  3T0Y A;  4WF2 A;  3H92 A;  2ADU A;  4FX4 A;  4YFN F;  5HS9 A;  4OU0 A;  1MJA A;  1A04 A;  2VT3 A;  2OZU A;  1R1T A;  2QYO A;  4IXA A;  1ZAR A;  1KA8 A;  3HRT A;  5LGN A;  4ZYG A;  4LD5 A;  1ZLJ A;  1OYW A;  3T1B A;  4G94 A;  5HOO A;  4WWC A;  4S05 A;  5EEG A;  1DPU A;  4OMY A;  4EGY A;  5BPI A;  1D8K A;  1R36 A;  1U5T C;  2Y0M A;  4UUV A;  1ON1 A;  3WTW C;  3Q9S A;  4HA8 A;  2JRT A;  1ZH5 A;  4YFX F;  4WX9 A;  4LB6 B;  1W5T A;  3R0A A;  2F5E A;  4U88 A;  5TJJ A;  3SZT A;  2K86 A;  5A2Q K;  3V8L A;  2Z33 A;  4IHT A;  2XHK A;  3FM3 A;  2QWW A;  2BBY A;  1TBX A;  2XKP A;  3KEO A;  1KYW A;  2M5W A;  2FBI A;  4BQA A;  2R7D A;  3GZ6 A;  1L3L A;  2F5C A;  1B6A A;  2EK5 A;  2C6Y A;  1V3F A;  2VON A;  2DPU A;  2B0L A;  3JTG A;  1K7A A;  3KP3 A;  3NRV A;  4EM2 A;  4NHJ A;  1FSE A;  1SD6 A;  4AIH A;  2DLL A;  4LFU A;  3ZMD A;  2D1V A;  4ENN A;  1ZRC A;  3M8E A;  4IF4 A;  2STW A;  1G3S A;  1RUO A;  5E1X A;  4MTE A;  1T2K A;  3RTR A;  3H3U A;  4ETS A;  2P5K A;  2G7H A;  1ONV A;  1HW5 A;  5J8C A;  2K4J A;  2K7L A;  1EH6 A;  2XV4 S;  1LB2 A;  1HBX G;  2A07 F;  3KP6 A;  3TGN A;  4CO8 A;  2EFQ A;  3P9K A;  4EM0 B;  2O61 A;  2NYX A;  4M9Z A;  2GZW A;  2VBX A;  2EA4 A;  3AAF A;  4I02 A;  4OIN F;  5LHG A;  4HLY A;  2VN2 A;  3WTY C;  1G1B A;  1W7P B;  1BC7 C;  2BV6 A;  2DI3 A;  3L2C A;  1H9T A;  1R22 A;  3F23 A;  4KUM A;  1HST A;  3WG9 A;  2JZY A;  4O3M A;  2CSO A;  2YU3 A;  1J2X A;  2AS5 F;  1TQM A;  5HLG A;  2J5P A;  3NQO A;  2P8T A;  4RB0 A;  2X0L A;  2XIG A;  1XDS A;  3U9G A;  4KIF A;  1G3T A;  3MAJ A;  3MEX A;  3DPL C;  3BPX A;  2WC2 A;  2HYF A;  1W5S A;  1B4A A;  1D8J A;  3WTU C;  3QP6 A;  3DV8 A;  4LMY A;  2O8X A;  2PMH A;  1LDJ A;  1YS6 A;  3F72 A;  3KLN A;  2P4W A;  4OIO F;  1IRF A;  3E5X A;  5D5X B;  1O3Q A;  3BP8 A;  1ZRD A;  4I09 A;  4HF1 A;  2HZT A;  1GHC A;  2GA1 A;  3QU6 A;  4A0Z A;  1BI1 A;  5CVV A;  3B02 A;  5DCF A;  3FWE A;  4ZYE A;  3CTA A;  3SZP A;  3I53 A;  4KIC A;  1FX7 A;  4RGS A;  3CJN A;  2XAQ A;  3T5X A;  4YFK F;  3CUQ B;  1B59 A;  1YW9 A;  3J81 Z;  3RPQ A;  2FRH A;  1P4X A;  4HF2 A;  3HHH A;  4ENJ A;  2Z99 A;  1S6L A;  2VT2 A;  5A2Q Z;  2UWM A;  3LA2 A;  1R58 A;  2DQL A;  4M73 A;  1IXR C;  1T0F A;  3GEZ A;  2MH2 A;  4L9T A;  2QBY A;  3CLO A;  4ESJ A;  1MD0 A;  2LF8 A;  3EYY A;  1RI7 A;  1ZN2 A;  5ICG A;  4KN4 X;  4KNY A;  3GZ5 A;  3HRM A;  1QPM A;  2BEO A;  4BH9 A;  4MEX F;  2HOE A;  5ILU A;  3GXO A;  1FBU A;  2OBP A;  1ZG1 A;  4XRF A;  3HUG A;  1RNL A;  3HSR A;  1YS7 A;  1WKM A;  2QQA A;  5DCM A;  4DQ2 A;  4P55 A;  2PEX A;  1I1S A;  2D1H A;  2LDU A;  2ACJ A;  4L9J A;  2IW5 A;  4FX0 A;  2ZJ2 A;  5DD4 A;  5HLI A;  4KT5 C;  3K9T A;  1O3S A;  1T6S A;  2ISY A;  1YYV A;  2XAJ A;  4MNU A;  3ROU A;  2WWY A;  4HV5 A;  1T98 A;  2M45 A;  1KQ9 A;  1SFU A;  4ZSB A;  1X3U A;  1Z1D A;  4PGH A;  4Y13 A;  2EV5 A;  1XB4 A;  3BRO A;  3HOS A;  2PI0 A;  2HYG D;  5FD6 A;  3KFW X;  4HV6 A;  2FF4 A;  4RB3 C;  1DDN A;  3VB2 A;  1KU3 A;  5ICE A;  2W25 A;  2IA1 A;  4Q4Z F;  2A3S A;  1IZ1 A;  3B73 A;  2ELH A;  2HTJ A;  3M1E A;  3VEP A;  3ZMU A;  1B1B A;  3WTV C;  3KP4 A;  5F64 A;  2R3S A;  1IUY A;  4U7B A;  1U2W A;  2LF7 A;  4N9I A;  4M6X A;  3L9F A;  2RV8 A;  1MGT A;  2Q0O A;  1FSH A;  3E97 A;  3P7N A;  5KK1 A;  1ZG5 A;  3HFI A;  3LAJ A;  5HDK A;  4Q48 A;  4ESB A;  1BC8 C;  2QZ8 A;  4HX7 A;  3HTU A;  4M9X A;  5LLQ A;  3FMS A;  2QEN A;  2AHC A;  2CG4 A;  2EB7 A;  5K5O A;  1K6O A;  2OOI A;  5FLX K;  2FNA A;  5DDG A;  1BIA A;  4A0Y A;  2HKX A;  2P6T A;  5D8K B;  1R5H A;  3JSP A;  1C0W A;  2XAG A;  1FYL A;  1REP C;  1F4K A;  5TRD A;  1TW3 A;  2P5V A;  3QPH A;  5K5Q A;  3K1N A;  5E17 F;  1TNT A;  3KP7 A;  1BBY A;  1LEA A;  2KIU A;  3TQN A;  2IT0 A;  1CGP A;  5K5R A;  4UVA A;  2H6C A;  2ZNY A;  3LFK A;  3IHU A;  2ZCW A;  1TLH B;  3I71 A;  4E70 A;  5BS6 A;  2FBH A;  1TW2 A;  2V1U A;  3CDH A;  3QPT A;  3V7S A;  2LSO A;  2IRF G;  1K78 B;  4UVC A;  1S3J A;  5L3D A;  2G9W A;  3WTZ A;  4CXF A;  4BNC A;  2Q2E A;  5AIP A;  3EET A;  4XSX F;  2FU4 A;  2A5Y B;  2NAZ A;  3EUH A;  2L54 A;  4JQF A;  4BAY A;  1IF1 A;  4WCG A;  5IT9 K;  3E3V A;  2DPD A;  3KEQ A;  1W7P A;  2WTE A;  1CF7 B;  1XMA A;  4AVP A;  2O3F A;  3F8C A;  3QOP A;  1UB9 A;  1YIO A;  3C18 A;  3E6M A;  1BI3 A;  4O6J A;  1SFE A;  4AIJ A;  2W85 A;  3JAM K;  5LEK A;  4YII A;  3RYP A;  2RKH A;  5D4R A;  3WOD F;  1ZG3 A;  1I6X A;  1B9M A;  1IN5 A;  3ZMZ A;  1F1Z A;  2XAS A;  1LDD A;  2ZME B;  3IL2 A;  3ZMS A;  1J7K A;  1WQ2 A;  4I98 B;  4M9S A;  1NHA A;  3ERE D;  2GAU A;  4M71 A;  4FT8 A;  3L7W A;  1XGO A;  3J80 K;  2EFN A;  4ZYD A;  4U0Y A;  1Z91 A;  3T8T A;  3DP7 A;  2E7X A;  4L9N A;  2K27 A;  1SD4 A;  4AIK A;  2EFW A;  3HYI A;  3I58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...