The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
46
|
sequence length |
155
|
structure length |
153
|
Chain Sequence |
HKQIKIEENATGFSYESLFREYLNETVTEVWIEDPYIRHTHQLYNFLRFCEMLIKCKVKTIHLLTSLDEGIEQVQQSRGLQEIEESLRSHGVLLEVQYSSSIHDREIRFNNGWMIKIGRGLDYFKKPQSRFSLGYCDFDLRPCHETTVDIFHK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Escrt-III Binding Protein Mitd1 is Involved in Cytokinesis and Has an Unanticipated Pld Fold that Binds Membranes.
pubmed doi rcsb |
| molecule tags |
Protein transport
|
| source organism |
Homo sapiens
|
| molecule keywords |
MIT DOMAIN-CONTAINING PROTEIN 1
|
| total genus |
46
|
| structure length |
153
|
| sequence length |
155
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature | |
| pdb deposition date | 2012-10-08 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF04212 | MIT | MIT (microtubule interacting and transport) domain |
| A | PF16565 | MIT_C | Phospholipase D-like domain at C-terminus of MIT |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Endonuclease; Chain A | Endonuclease; Chain A |
#chains in the Genus database with same CATH superfamily 2YMB A; 4A5Z A; #chains in the Genus database with same CATH topology 3HSI A; 1BYR A; 4URJ A; 1XDO A; 1RG2 A; 2ZE9 A; 2C1L A; 1RH0 A; 1V0Y A; 1MU7 A; 1MU9 A; 5LZK A; 4GGJ A; 1V0S A; 4RCT A; 5BPD A; 1RGU A; 4H4A A; 4GEM A; 5BPI A; 1RGT A; 1RFF A; 2F5T X; 1V0T A; 1V0V A; 5BOX A; 4GGK A; 1F0I A; 1ODG A; 3QPH A; 1V0W A; 1V0R A; 3SQ5 A; 2O8R A; 1RFI A; 5BQT A; 3SQ7 A; 3R3P A; 2ZE4 A; 1V0U A; 3HRL A; 1RG1 A; 1VSR A; 3SQ3 A; 3SQ8 A; 1Q32 A; 2YMB A; 1BYS A; 1CW0 A; 1QZQ A; 4GEN A; 4A5Z A; 1NOP A; 1JY1 A; 4GEL A; 1XDP A; #chains in the Genus database with same CATH homology 2YMB A; 4A5Z A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
