2RCKA

Crystal structure of juvenile hormone binding protein from galleria mellonella hemolymph
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
221
structure length
221
Chain Sequence
b'SKLNLSTEPCDVSDIECISKATQVFLDNTYQGIPEYNIKKLDPITIPSLEKSIEKINLNVRYNNLKVTGFKNQKISHFTLVRDTKAVNFKTKVNFTAEGKLVIELPKSSKTYTGEVTIEASAEGGAAYSYSVKTDDKGVEHYEAGPETVSCEIFGEPTLSVSSTLEDALKLDSDFKKIFTEYGKQLTEGRKQTACRIVETVYAVSVHNIRAAARILPKSAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Juvenile hormone binding protein
publication title Insect Juvenile Hormone Binding Protein Shows Ancestral Fold Present in Human Lipid-Binding Proteins.
pubmed doi rcsb
molecule tags Hormone binding protein
total genus 60
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.30 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 2rckA01
3E8TA 3AOSA 4G0SA 2RCKA 2RQFA 3E8WA 3AOTA 3A1ZA
chains in the Genus database with same CATH superfamily
3H4ZA 4G0SA 5I7JA 4EWSA 1BP1A 2RQFA 3E8WA 3A1ZA 1EWFA 3AOSA 5I7KA 1USUB 3ZPMA 4KGOA 4KGHA 3E8TA 3N72A 5I7LA 4F2AA 3AOTA 3L6IA 3UV1A 1USVB 2RCKA 2OBDA 4M4DA
chains in the Genus database with same CATH topology
3H4ZA 4G0SA 5I7JA 4EWSA 1BP1A 2RQFA 3E8WA 3A1ZA 1EWFA 3AOSA 5I7KA 1USUB 3ZPMA 4KGOA 4KGHA 3E8TA 3N72A 5I7LA 4F2AA 3AOTA 3L6IA 3UV1A 1USVB 2RCKA 2OBDA 4M4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E8T A;  3AOS A;  4G0S A;  2RCK A;  2RQF A;  3E8W A;  3AOT A;  3A1Z A; 
#chains in the Genus database with same CATH topology
 3H4Z A;  4G0S A;  5I7J A;  4EWS A;  1BP1 A;  2RQF A;  3E8W A;  3A1Z A;  1EWF A;  3AOS A;  5I7K A;  1USU B;  3ZPM A;  4KGO A;  4KGH A;  3E8T A;  3N72 A;  5I7L A;  4F2A A;  3AOT A;  3L6I A;  3UV1 A;  1USV B;  2RCK A;  2OBD A;  4M4D A; 
#chains in the Genus database with same CATH homology
 3H4Z A;  4G0S A;  5I7J A;  4EWS A;  1BP1 A;  2RQF A;  3E8W A;  3A1Z A;  1EWF A;  3AOS A;  5I7K A;  1USU B;  3ZPM A;  4KGO A;  4KGH A;  3E8T A;  3N72 A;  5I7L A;  4F2A A;  3AOT A;  3L6I A;  3UV1 A;  1USV B;  2RCK A;  2OBD A;  4M4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...