2RCKA

Crystal structure of juvenile hormone binding protein from galleria mellonella hemolymph
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
221
structure length
221
Chain Sequence
SKLNLSTEPCDVSDIECISKATQVFLDNTYQGIPEYNIKKLDPITIPSLEKSIEKINLNVRYNNLKVTGFKNQKISHFTLVRDTKAVNFKTKVNFTAEGKLVIELPKSSKTYTGEVTIEASAEGGAAYSYSVKTDDKGVEHYEAGPETVSCEIFGEPTLSVSSTLEDALKLDSDFKKIFTEYGKQLTEGRKQTACRIVETVYAVSVHNIRAAARILPKSAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone binding protein
molecule keywords Juvenile hormone binding protein
publication title Insect Juvenile Hormone Binding Protein Shows Ancestral Fold Present in Human Lipid-Binding Proteins.
pubmed doi rcsb
total genus 60
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.30 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 2rckA01
3A1ZA 2RQFA 4G0SA 3E8WA 2RCKA 3AOSA 3E8TA 3AOTA
chains in the Genus database with same CATH superfamily
2OBDA 4KGOA 3ZPMA 2RCKA 1USUB 1EWFA 1USVB 4M4DA 1BP1A 4G0SA 3L6IA 3H4ZA 3E8WA 5I7KA 3AOSA 3AOTA 3UV1A 4F2AA 5I7LA 4EWSA 3N72A 3A1ZA 2RQFA 5I7JA 3E8TA 4KGHA
chains in the Genus database with same CATH topology
2OBDA 4KGOA 3ZPMA 2RCKA 1USUB 1EWFA 1USVB 4M4DA 1BP1A 4G0SA 3L6IA 3H4ZA 3E8WA 5I7KA 3AOSA 3AOTA 3UV1A 4F2AA 5I7LA 4EWSA 3N72A 3A1ZA 2RQFA 5I7JA 3E8TA 4KGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A1Z A;  2RQF A;  4G0S A;  3E8W A;  2RCK A;  3AOS A;  3E8T A;  3AOT A; 
#chains in the Genus database with same CATH topology
 2OBD A;  4KGO A;  3ZPM A;  2RCK A;  1USU B;  1EWF A;  1USV B;  4M4D A;  1BP1 A;  4G0S A;  3L6I A;  3H4Z A;  3E8W A;  5I7K A;  3AOS A;  3AOT A;  3UV1 A;  4F2A A;  5I7L A;  4EWS A;  3N72 A;  3A1Z A;  2RQF A;  5I7J A;  3E8T A;  4KGH A; 
#chains in the Genus database with same CATH homology
 2OBD A;  4KGO A;  3ZPM A;  2RCK A;  1USU B;  1EWF A;  1USV B;  4M4D A;  1BP1 A;  4G0S A;  3L6I A;  3H4Z A;  3E8W A;  5I7K A;  3AOS A;  3AOT A;  3UV1 A;  4F2A A;  5I7L A;  4EWS A;  3N72 A;  3A1Z A;  2RQF A;  5I7J A;  3E8T A;  4KGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...