2RQFA

Solution structure of juvenile hormone binding protein from silkworm in complex with jh iii
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
227
structure length
227
Chain Sequence
GSDGDALLKPCKLGDMQCLSSATEQFLEKTSKGIPQYDIWPIDPLVVTSLDVIAPSDAGIVIRFKNLNITGLKNQQISDFQMDTKAKTVLLKTKADLHIVGDIVIELTEQSKSFTGLYTADTNVIGAVRYGYNLKNDDNGVQHFEVQPETFTCESIGEPKITLSSDLSSALEKDSGNNSLEPDMEPLKTLRQAAICKIAEACYISVVHNIRASAKILPASSFFENLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone binding protein
molecule keywords Hemolymph juvenile hormone binding protein
publication title Structural mechanism of JH delivery in hemolymph by JHBP of silkworm, Bombyx mori
pubmed doi rcsb
source organism Bombyx mori
total genus 41
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2009-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.30 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 2rqfA01
2RCKA 2RQFA 3A1ZA 3AOSA 4G0SA 3E8TA 3E8WA 3AOTA
chains in the Genus database with same CATH superfamily
2RCKA 3UV1A 2RQFA 3ZPMA 5I7JA 2OBDA 3AOSA 1USVB 3L6IA 3AOTA 4EWSA 4G0SA 4M4DA 1EWFA 1BP1A 3E8TA 3N72A 3E8WA 4KGOA 3A1ZA 1USUB 4F2AA 5I7KA 3H4ZA 5I7LA 4KGHA
chains in the Genus database with same CATH topology
2RCKA 3UV1A 2RQFA 3ZPMA 5I7JA 2OBDA 3AOSA 1USVB 3L6IA 3AOTA 4EWSA 4G0SA 4M4DA 1EWFA 1BP1A 3E8TA 3N72A 3E8WA 4KGOA 3A1ZA 1USUB 4F2AA 5I7KA 3H4ZA 5I7LA 4KGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RCK A;  2RQF A;  3A1Z A;  3AOS A;  4G0S A;  3E8T A;  3E8W A;  3AOT A; 
#chains in the Genus database with same CATH topology
 2RCK A;  3UV1 A;  2RQF A;  3ZPM A;  5I7J A;  2OBD A;  3AOS A;  1USV B;  3L6I A;  3AOT A;  4EWS A;  4G0S A;  4M4D A;  1EWF A;  1BP1 A;  3E8T A;  3N72 A;  3E8W A;  4KGO A;  3A1Z A;  1USU B;  4F2A A;  5I7K A;  3H4Z A;  5I7L A;  4KGH A; 
#chains in the Genus database with same CATH homology
 2RCK A;  3UV1 A;  2RQF A;  3ZPM A;  5I7J A;  2OBD A;  3AOS A;  1USV B;  3L6I A;  3AOT A;  4EWS A;  4G0S A;  4M4D A;  1EWF A;  1BP1 A;  3E8T A;  3N72 A;  3E8W A;  4KGO A;  3A1Z A;  1USU B;  4F2A A;  5I7K A;  3H4Z A;  5I7L A;  4KGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...