2RQFA

Solution structure of juvenile hormone binding protein from silkworm in complex with jh iii
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
227
structure length
227
Chain Sequence
b'GSDGDALLKPCKLGDMQCLSSATEQFLEKTSKGIPQYDIWPIDPLVVTSLDVIAPSDAGIVIRFKNLNITGLKNQQISDFQMDTKAKTVLLKTKADLHIVGDIVIELTEQSKSFTGLYTADTNVIGAVRYGYNLKNDDNGVQHFEVQPETFTCESIGEPKITLSSDLSSALEKDSGNNSLEPDMEPLKTLRQAAICKIAEACYISVVHNIRASAKILPASSFFENLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemolymph juvenile hormone binding protein
publication title Structural mechanism of JH delivery in hemolymph by JHBP of silkworm, Bombyx mori
pubmed doi rcsb
source organism Bombyx mori
molecule tags Hormone binding protein
total genus 41
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2009-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.30 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 2rqfA01
3AOTA 3A1ZA 3AOSA 2RQFA 3E8WA 4G0SA 3E8TA 2RCKA
chains in the Genus database with same CATH superfamily
3AOTA 1BP1A 3AOSA 4KGHA 4KGOA 1USVB 4M4DA 5I7KA 4EWSA 3A1ZA 3E8WA 3ZPMA 3E8TA 3H4ZA 1USUB 5I7JA 3L6IA 5I7LA 3UV1A 1EWFA 2OBDA 2RQFA 4F2AA 4G0SA 3N72A 2RCKA
chains in the Genus database with same CATH topology
3AOTA 1BP1A 3AOSA 4KGHA 4KGOA 1USVB 4M4DA 5I7KA 4EWSA 3A1ZA 3E8WA 3ZPMA 3E8TA 3H4ZA 1USUB 5I7JA 3L6IA 5I7LA 3UV1A 1EWFA 2OBDA 2RQFA 4F2AA 4G0SA 3N72A 2RCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AOT A;  3A1Z A;  3AOS A;  2RQF A;  3E8W A;  4G0S A;  3E8T A;  2RCK A; 
#chains in the Genus database with same CATH topology
 3AOT A;  1BP1 A;  3AOS A;  4KGH A;  4KGO A;  1USV B;  4M4D A;  5I7K A;  4EWS A;  3A1Z A;  3E8W A;  3ZPM A;  3E8T A;  3H4Z A;  1USU B;  5I7J A;  3L6I A;  5I7L A;  3UV1 A;  1EWF A;  2OBD A;  2RQF A;  4F2A A;  4G0S A;  3N72 A;  2RCK A; 
#chains in the Genus database with same CATH homology
 3AOT A;  1BP1 A;  3AOS A;  4KGH A;  4KGO A;  1USV B;  4M4D A;  5I7K A;  4EWS A;  3A1Z A;  3E8W A;  3ZPM A;  3E8T A;  3H4Z A;  1USU B;  5I7J A;  3L6I A;  5I7L A;  3UV1 A;  1EWF A;  2OBD A;  2RQF A;  4F2A A;  4G0S A;  3N72 A;  2RCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...