The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
28
|
sequence length |
120
|
structure length |
120
|
Chain Sequence |
DSEVGTEAGLTLGGDGILRLTWPRGAAITAADAERAMLRVNQLCGDDRHPMLVDMATTADVSRGARAVFGRPCQASRIALLGSSPVDRVLANFFLGINAVPCPTKFFTSERDALTWLALT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of uncharacterized protein (YP_829618.1) from Arthrobacter sp. FB24 at 2.20 A resolution
rcsb |
molecule tags |
Unknown function
|
source organism |
Arthrobacter sp.
|
molecule keywords |
Uncharacterized protein
|
total genus |
28
|
structure length |
120
|
sequence length |
120
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2007-12-10 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF11964 | SpoIIAA-like | SpoIIAA-like |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Ribonuclease HI; Chain A | yp_829618.1 like domains | ||
Alpha Beta | 3-Layer(aba) Sandwich | yp_829618.1 fold | yp_829618.1 domain like |
#chains in the Genus database with same CATH superfamily 3BL4 A; #chains in the Genus database with same CATH topology 3I01 M; 1QHK A; 3DOA A; 3I04 M; 3BL4 A; 3GIT A; 1MJG M; 1OAO C; 3PMQ A; 3BSU A; 5H3X A; 2Z8Y M; 1RU3 A; #chains in the Genus database with same CATH homology 3BL4 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...