The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
18
|
sequence length |
101
|
structure length |
95
|
Chain Sequence |
AVRIRLAKFGRKHHPIYRIVVMDAKYIDILGTYDPKRKVLINVYPEKVKEWVLKGVELSHRAKAILWNHGILKEVVPEGYEMKRVGDYYVFEKRE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Ribosome
|
molecule keywords |
30S ribosomal protein S16
|
publication title |
Extreme temperature tolerance of a hyperthermophilic protein coupled to residual structure in the unfolded state
pubmed doi rcsb |
source organism |
Aquifex aeolicus
|
total genus |
18
|
structure length |
95
|
sequence length |
101
|
ec nomenclature | |
pdb deposition date | 2007-12-13 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00886 | Ribosomal_S16 | Ribosomal protein S16 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | S16 Ribosomal Protein; Chain: A; | S16 Ribosomal Protein; Chain: A; |
#chains in the Genus database with same CATH superfamily 4LFA P; 4DV6 P; 1HNW P; 4LF4 P; 4X62 P; 4OX9 P; 5LMU P; 2VQF P; 2UUB P; 4JI2 P; 4JI7 P; 4DUZ P; 1N36 P; 1EMW A; 2ZM6 P; 4JI6 P; 4DR4 P; 4K0K P; 1FJG P; 3T1H P; 1XMO P; 4NXN P; 4DR1 P; 4KHP P; 4B3M P; 3T1Y P; 4B3S P; 5AJ3 P; 4DUY P; 1IBL P; 4DV3 P; 1XMQ P; 4LF7 P; 4LF9 P; 4LF8 P; 2UU9 P; 1IBM P; 2HHH P; 2VQE P; 4YY3 P; 1HR0 P; 4JI5 P; 4DV7 P; 5IWA P; 4JV5 P; 4JI4 P; 4JYA P; 2F4V P; 1I94 P; 4X66 P; 2UUC P; 4DR3 P; 4X65 P; 1HNX P; 1N33 P; 5LMN P; 4LFB P; 4B3T P; 4NXM P; 2UUA P; 4JI0 P; 4DV2 P; 2UXB P; 2UXD P; 1HNZ P; 1XNQ P; 3BN0 A; 4LFC P; 1J5E P; 1XNR P; 4GKJ P; 4JI1 P; 4DR6 P; 4JI3 P; 1IBK P; 4LF6 P; 4JI8 P; 4DR2 P; 4DV4 P; 4LF5 P; 4DV0 P; 4DR5 P; 3OTO P; 1N34 P; 4B3R P; 2UXC P; 4DV1 P; 4DR7 P; 4AQY P; 4X64 P; 1N32 P; 4GKK P; 4YHH P; 2E5L P; 4DV5 P; 5BR8 P; #chains in the Genus database with same CATH topology 4LFA P; 4DV6 P; 1HNW P; 4LF4 P; 4X62 P; 4OX9 P; 5LMU P; 2VQF P; 2UUB P; 4JI2 P; 4JI7 P; 4DUZ P; 1N36 P; 1EMW A; 2ZM6 P; 4JI6 P; 4DR4 P; 4K0K P; 1FJG P; 3T1H P; 1XMO P; 4NXN P; 4DR1 P; 4KHP P; 4B3M P; 3T1Y P; 4B3S P; 5AJ3 P; 4DUY P; 1IBL P; 4DV3 P; 1XMQ P; 4LF7 P; 4LF9 P; 4LF8 P; 2UU9 P; 1IBM P; 2HHH P; 2VQE P; 4YY3 P; 1HR0 P; 4JI5 P; 4DV7 P; 5IWA P; 4JV5 P; 4JI4 P; 4JYA P; 2F4V P; 1I94 P; 4X66 P; 2UUC P; 4DR3 P; 4X65 P; 1HNX P; 1N33 P; 5LMN P; 4LFB P; 4B3T P; 4NXM P; 2UUA P; 4JI0 P; 4DV2 P; 2UXB P; 2UXD P; 1HNZ P; 1XNQ P; 3BN0 A; 4LFC P; 1J5E P; 1XNR P; 4GKJ P; 4JI1 P; 4DR6 P; 4JI3 P; 1IBK P; 4LF6 P; 4JI8 P; 4DR2 P; 4DV4 P; 4LF5 P; 4DV0 P; 4DR5 P; 3OTO P; 1N34 P; 4B3R P; 2UXC P; 4DV1 P; 4DR7 P; 4AQY P; 4X64 P; 1N32 P; 4GKK P; 4YHH P; 2E5L P; 4DV5 P; 5BR8 P; #chains in the Genus database with same CATH homology 4LFA P; 4DV6 P; 1HNW P; 4LF4 P; 4X62 P; 4OX9 P; 5LMU P; 2VQF P; 2UUB P; 4JI2 P; 4JI7 P; 4DUZ P; 1N36 P; 1EMW A; 2ZM6 P; 4JI6 P; 4DR4 P; 4K0K P; 1FJG P; 3T1H P; 1XMO P; 4NXN P; 4DR1 P; 4KHP P; 4B3M P; 3T1Y P; 4B3S P; 5AJ3 P; 4DUY P; 1IBL P; 4DV3 P; 1XMQ P; 4LF7 P; 4LF9 P; 4LF8 P; 2UU9 P; 1IBM P; 2HHH P; 2VQE P; 4YY3 P; 1HR0 P; 4JI5 P; 4DV7 P; 5IWA P; 4JV5 P; 4JI4 P; 4JYA P; 2F4V P; 1I94 P; 4X66 P; 2UUC P; 4DR3 P; 4X65 P; 1HNX P; 1N33 P; 5LMN P; 4LFB P; 4B3T P; 4NXM P; 2UUA P; 4JI0 P; 4DV2 P; 2UXB P; 2UXD P; 1HNZ P; 1XNQ P; 3BN0 A; 4LFC P; 1J5E P; 1XNR P; 4GKJ P; 4JI1 P; 4DR6 P; 4JI3 P; 1IBK P; 4LF6 P; 4JI8 P; 4DR2 P; 4DV4 P; 4LF5 P; 4DV0 P; 4DR5 P; 3OTO P; 1N34 P; 4B3R P; 2UXC P; 4DV1 P; 4DR7 P; 4AQY P; 4X64 P; 1N32 P; 4GKK P; 4YHH P; 2E5L P; 4DV5 P; 5BR8 P;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...