The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
16
|
sequence length |
88
|
structure length |
88
|
Chain Sequence |
GMGNIYQITVEEKAEHQRTLSFEFSLHDDLFKLLEKVDGKMDMTPEQTQAFMVGLKLFGEVMMQQRKHPLFKEFSAPFRAFMMNLKKQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of domain of unknown function (YP_050007.1) from Erwinia carotovora atroseptica SCRI1043 at 2.20 A resolution
rcsb |
| molecule tags |
Unknown function
|
| source organism |
Pectobacterium atrosepticum scri1043
|
| molecule keywords |
Domain of unknown function
|
| total genus |
16
|
| structure length |
88
|
| sequence length |
88
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2008-03-13 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF12977 | DUF3861 | Domain of Unknown Function with PDB structure (DUF3861) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | NK-Lysin | NK-Lysin |
#chains in the Genus database with same CATH superfamily 3CJL A; #chains in the Genus database with same CATH topology 2RB3 A; 4DDJ A; 3S63 A; 4BIT A; 2Z9A A; 3CJL A; 2QYP A; 2KVD A; 2LPN A; 2W50 A; 1M12 A; 1SN6 A; 3S64 A; 2DOB A; 4UEX A; 2JSA A; 1L9L A; 4V2O A; 2RQY A; 3BQQ A; 2R0R A; 1N69 A; 1QDM A; 2JQ3 A; 2GTG A; 2W51 A; 1NKL A; 3RFI A; 3BQP A; 3EUK E; 2R1Q A; 3EUJ B; 1OF9 A; 2JS9 A; #chains in the Genus database with same CATH homology 3EUJ B; 3CJL A; 2JQ3 A; 3EUK E;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
