The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
16
|
sequence length |
101
|
structure length |
101
|
Chain Sequence |
LPMALEYESLTDVQTQIVTAIQAELAHFRNTAQPINLGAVLQEQLARYPQSRHFDVARIIVDQAVKLGMASQDHQAVYPVWQPIDDFSAAVQAHLIDQYDK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural studies of a bacterial condensin complex reveal ATP-dependent disruption of intersubunit interactions.
pubmed doi rcsb |
molecule tags |
Cell cycle
|
source organism |
Haemophilus ducreyi (strain 35000hp / atcc 700724)
|
molecule keywords |
Chromosome partition protein mukB, Linker
|
total genus |
16
|
structure length |
101
|
sequence length |
101
|
chains with identical sequence |
J
|
ec nomenclature | |
pdb deposition date | 2008-10-10 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | NK-Lysin | NK-Lysin |
#chains in the Genus database with same CATH superfamily 3EUK E; 3EUJ B; #chains in the Genus database with same CATH topology 1L9L A; 1NKL A; 2W50 A; 2RB3 A; 3BQQ A; 3EUJ B; 3S64 A; 3S63 A; 2LPN A; 2RQY A; 4V2O A; 2JQ3 A; 4DDJ A; 1OF9 A; 1QDM A; 2JSA A; 2DOB A; 2QYP A; 4UEX A; 3EUK E; 1SN6 A; 3RFI A; 2KVD A; 1M12 A; 3CJL A; 2R0R A; 2GTG A; 2W51 A; 2Z9A A; 1N69 A; 3BQP A; 2JS9 A; 2R1Q A; 4BIT A; #chains in the Genus database with same CATH homology 2JQ3 A; 3EUK E; 3EUJ B; 3CJL A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...