The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
21
|
sequence length |
106
|
structure length |
106
|
Chain Sequence |
ADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural insights into the assembly of the human and archaeal signal recognition particles.
pubmed doi rcsb |
molecule tags |
Rna/rna binding protein
|
source organism |
Homo sapiens
|
molecule keywords |
SRP RNA
|
total genus |
21
|
structure length |
106
|
sequence length |
106
|
chains with identical sequence |
D
|
ec nomenclature | |
pdb deposition date | 2009-11-26 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
B | PF01922 | SRP19 | SRP19 protein |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Phenylalanyl-tRNA Synthetase; Chain B, domain 1 | Signal recognition particle, SRP19-like subunit |
#chains in the Genus database with same CATH superfamily 1KVV A; 4XCO A; 2V3C A; 3KTW A; 3NDB A; 1MFQ B; 1LNG A; 1L9A A; 4P3E B; 3DLU A; 3DLV A; 3KTV B; 1JID A; 5M73 B; 1KVN A; #chains in the Genus database with same CATH topology 4DDV A; 2ALY B; 3AXT A; 4IOH A; 4P72 A; 4TVA B; 4P73 A; 1JID A; 2DUL A; 1B70 B; 1JJC B; 1KVV A; 2RHQ B; 4P75 A; 2EJT A; 1LNG A; 2AKW B; 1EIY B; 3KTV B; 4DDW A; 5M73 B; 1KVN A; 4XCO A; 4DDT A; 2CXI A; 2V3C A; 3KTW A; 3PCO B; 2EJU A; 3HFZ B; 4P74 A; 1L9A A; 4P3E B; 2HG7 A; 2RHS B; 3DLV A; 3DLU A; 4P71 A; 3TEH B; 1ND9 A; 3AXS A; 2AMC B; 2LQ3 A; 1B7Y B; 1MFQ B; 2IY5 B; 3NDB A; 4DDU A; 3L4G B; 2YTZ A; 1PYS B; 3USH A; #chains in the Genus database with same CATH homology 1KVV A; 4XCO A; 2V3C A; 3KTW A; 3NDB A; 1MFQ B; 1LNG A; 1L9A A; 4P3E B; 3DLU A; 3DLV A; 3KTV B; 1JID A; 5M73 B; 1KVN A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...