The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
45
|
sequence length |
156
|
structure length |
143
|
Chain Sequence |
SSGRENLYFQGERNYNKWAESYIKYNLSNLKIETIYFDNLQVSGNACVSIRKGKQINSFEYIIKFEWLYSYFGGSVEIPDFSTFSLEENDYAINIEDESENLRFIYDSILKKEGKEKIKECLKNFQEDLLKHDKNESNKELKI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Chaperone activator
|
source organism |
Plasmodium falciparum
|
publication title |
Crystal Structure of Aha-1 from plasmodium falciparum, PFC0270w
rcsb |
molecule keywords |
putative activator of HSP90
|
total genus |
45
|
structure length |
143
|
sequence length |
156
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2010-05-26 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF09229 | Aha1_N | Activator of Hsp90 ATPase, N-terminal |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Super Roll | Bactericidal permeability-increasing protein; domain 1 | Bactericidal permeability-increasing protein; domain 1 |
#chains in the Genus database with same CATH superfamily 1USU B; 3N72 A; 1USV B; #chains in the Genus database with same CATH topology 3AOT A; 1EWF A; 4M4D A; 4EWS A; 1USU B; 4KGO A; 1BP1 A; 2OBD A; 5I7L A; 3N72 A; 5I7K A; 4G0S A; 2RCK A; 3ZPM A; 1USV B; 4F2A A; 3E8T A; 3UV1 A; 2RQF A; 3AOS A; 3L6I A; 5I7J A; 3E8W A; 3A1Z A; 4KGH A; 3H4Z A; #chains in the Genus database with same CATH homology 3AOT A; 1EWF A; 4M4D A; 4EWS A; 1USU B; 4KGO A; 1BP1 A; 2OBD A; 5I7L A; 3N72 A; 5I7K A; 4G0S A; 2RCK A; 3ZPM A; 1USV B; 4F2A A; 3E8T A; 3UV1 A; 2RQF A; 3AOS A; 3L6I A; 5I7J A; 3E8W A; 3A1Z A; 4KGH A; 3H4Z A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...