The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
32
|
sequence length |
117
|
structure length |
117
|
Chain Sequence |
LSERKNVLQLKLQQRRTREELVSQGIMPPLKSPAAFHEQRRSLERARTEDYLKRKIRSRPERAELVRMHILEETSAEPSLQAKQLKLKRARLADDLNEKIAQRPGPMELVEKNILPV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Sensing actin dynamics: structural basis for G-actin-sensitive nuclear import of MAL
pubmed doi rcsb |
| molecule keywords |
Actin, alpha skeletal muscle
|
| molecule tags |
Contractile protein/transcription
|
| source organism |
Mus musculus
|
| total genus |
32
|
| structure length |
117
|
| sequence length |
117
|
| ec nomenclature | |
| pdb deposition date | 2011-09-08 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Cobalamin-dependent Methionine Synthase; domain 2 | Cobalamin-dependent Methionine Synthase; domain 2 |
#chains in the Genus database with same CATH superfamily 2YJF M; 3TPQ M; #chains in the Genus database with same CATH topology 3IV9 A; 3BUL A; 1K98 A; 1MSK A; 1K7Y A; 3IVA A; 2O2K A; 2YJF M; 3TPQ M; #chains in the Genus database with same CATH homology 2YJF M; 3TPQ M;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...