3A1ZA

Crystal structure of juvenile hormone binding protein from silkworm
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
216
structure length
208
Chain Sequence
b'KPCKLGDMQCLSSATEQFLEKTSKGIPQYDIWPIDPLVVTSLDVIAPSDAGIVIRFKNLNITGLKNQQISDFQMDTKAKTVLLKTKADLHIVGDIVIELTEQSKSFTGLYTADTNVIGAVRYGYNLKNDDNGVQHFEVQPETFTCESIGEPKITLSSDLSSALEKDSGEPLKTLRQAAICKIAEACYISVVHNIRASAKILPASSFFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemolymph juvenile hormone binding protein
publication title Crystal structure of silkworm Bombyx mori JHBP in complex with 2-methyl-2,4-pentanediol: plasticity of JH-binding pocket and ligand-induced conformational change of the second cavity in JHBP
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
total genus 55
structure length 208
sequence length 216
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.30 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 3a1zA00
3E8TA 3E8WA 3AOTA 3AOSA 2RCKA 2RQFA 4G0SA 3A1ZA
chains in the Genus database with same CATH superfamily
4EWSA 4KGOA 4KGHA 3AOSA 1USUB 3N72A 4M4DA 2OBDA 2RCKA 3L6IA 5I7LA 3ZPMA 5I7KA 1BP1A 2RQFA 4G0SA 3E8TA 3E8WA 3UV1A 3H4ZA 4F2AA 3AOTA 1EWFA 1USVB 5I7JA 3A1ZA
chains in the Genus database with same CATH topology
4EWSA 4KGOA 4KGHA 3AOSA 1USUB 3N72A 4M4DA 2OBDA 2RCKA 3L6IA 5I7LA 3ZPMA 5I7KA 1BP1A 2RQFA 4G0SA 3E8TA 3E8WA 3UV1A 3H4ZA 4F2AA 3AOTA 1EWFA 1USVB 5I7JA 3A1ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E8T A;  3E8W A;  3AOT A;  3AOS A;  2RCK A;  2RQF A;  4G0S A;  3A1Z A; 
#chains in the Genus database with same CATH topology
 4EWS A;  4KGO A;  4KGH A;  3AOS A;  1USU B;  3N72 A;  4M4D A;  2OBD A;  2RCK A;  3L6I A;  5I7L A;  3ZPM A;  5I7K A;  1BP1 A;  2RQF A;  4G0S A;  3E8T A;  3E8W A;  3UV1 A;  3H4Z A;  4F2A A;  3AOT A;  1EWF A;  1USV B;  5I7J A;  3A1Z A; 
#chains in the Genus database with same CATH homology
 4EWS A;  4KGO A;  4KGH A;  3AOS A;  1USU B;  3N72 A;  4M4D A;  2OBD A;  2RCK A;  3L6I A;  5I7L A;  3ZPM A;  5I7K A;  1BP1 A;  2RQF A;  4G0S A;  3E8T A;  3E8W A;  3UV1 A;  3H4Z A;  4F2A A;  3AOT A;  1EWF A;  1USV B;  5I7J A;  3A1Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...