3AOSA

Crystal structure of juvenile hormone binding protein from silkworm in complex with jh ii
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
221
structure length
221
Chain Sequence
ALLKPCKLGDMQCLSSATEQFLEKTSKGIPQYDIWPIDPLVVTSLDVIAPSDAGIVIRFKNLNITGLKNQQISDFQMDTKAKTVLLKTKADLHIVGDIVIELTEQSKSFTGLYTADTNVIGAVRYGYNLKNDDNGVQHFEVQPETFTCESIGEPKITLSSDLSSALEKDSGNNSLEPDMEPLKTLRQAAICKIAEACYISVVHNIRASAKILPASSFFENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone binding protein
molecule keywords Hemolymph juvenile hormone binding protein
publication title Structural mechanism of JH delivery in hemolymph by JHBP of silkworm, Bombyx mori
pubmed doi rcsb
source organism Bombyx mori
total genus 57
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.30 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 3aosA00
2RQFA 3AOSA 2RCKA 4G0SA 3E8WA 3A1ZA 3E8TA 3AOTA
chains in the Genus database with same CATH superfamily
5I7KA 3E8TA 4EWSA 1BP1A 5I7JA 4M4DA 3UV1A 3E8WA 3A1ZA 3ZPMA 3AOSA 3L6IA 1USUB 4G0SA 4KGOA 5I7LA 1USVB 1EWFA 2RQFA 2RCKA 3H4ZA 3N72A 4F2AA 4KGHA 2OBDA 3AOTA
chains in the Genus database with same CATH topology
5I7KA 3E8TA 4EWSA 1BP1A 5I7JA 4M4DA 3UV1A 3E8WA 3A1ZA 3ZPMA 3AOSA 3L6IA 1USUB 4G0SA 4KGOA 5I7LA 1USVB 1EWFA 2RQFA 2RCKA 3H4ZA 3N72A 4F2AA 4KGHA 2OBDA 3AOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQF A;  3AOS A;  2RCK A;  4G0S A;  3E8W A;  3A1Z A;  3E8T A;  3AOT A; 
#chains in the Genus database with same CATH topology
 5I7K A;  3E8T A;  4EWS A;  1BP1 A;  5I7J A;  4M4D A;  3UV1 A;  3E8W A;  3A1Z A;  3ZPM A;  3AOS A;  3L6I A;  1USU B;  4G0S A;  4KGO A;  5I7L A;  1USV B;  1EWF A;  2RQF A;  2RCK A;  3H4Z A;  3N72 A;  4F2A A;  4KGH A;  2OBD A;  3AOT A; 
#chains in the Genus database with same CATH homology
 5I7K A;  3E8T A;  4EWS A;  1BP1 A;  5I7J A;  4M4D A;  3UV1 A;  3E8W A;  3A1Z A;  3ZPM A;  3AOS A;  3L6I A;  1USU B;  4G0S A;  4KGO A;  5I7L A;  1USV B;  1EWF A;  2RQF A;  2RCK A;  3H4Z A;  3N72 A;  4F2A A;  4KGH A;  2OBD A;  3AOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...