3AOSA

Crystal structure of juvenile hormone binding protein from silkworm in complex with jh ii
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
221
structure length
221
Chain Sequence
b'ALLKPCKLGDMQCLSSATEQFLEKTSKGIPQYDIWPIDPLVVTSLDVIAPSDAGIVIRFKNLNITGLKNQQISDFQMDTKAKTVLLKTKADLHIVGDIVIELTEQSKSFTGLYTADTNVIGAVRYGYNLKNDDNGVQHFEVQPETFTCESIGEPKITLSSDLSSALEKDSGNNSLEPDMEPLKTLRQAAICKIAEACYISVVHNIRASAKILPASSFFENL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemolymph juvenile hormone binding protein
publication title Structural mechanism of JH delivery in hemolymph by JHBP of silkworm, Bombyx mori
pubmed doi rcsb
source organism Bombyx mori
molecule tags Hormone binding protein
total genus 57
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.30 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 3aosA00
2RCKA 2RQFA 3AOSA 3E8WA 3A1ZA 3E8TA 3AOTA 4G0SA
chains in the Genus database with same CATH superfamily
1EWFA 3A1ZA 2OBDA 2RCKA 3H4ZA 2RQFA 4F2AA 4EWSA 4KGHA 3E8TA 1USUB 3AOSA 3E8WA 5I7JA 1BP1A 5I7LA 4M4DA 5I7KA 4KGOA 3L6IA 3N72A 3UV1A 3AOTA 3ZPMA 4G0SA 1USVB
chains in the Genus database with same CATH topology
1EWFA 3A1ZA 2OBDA 2RCKA 3H4ZA 2RQFA 4F2AA 4EWSA 4KGHA 3E8TA 1USUB 3AOSA 3E8WA 5I7JA 1BP1A 5I7LA 4M4DA 5I7KA 4KGOA 3L6IA 3N72A 3UV1A 3AOTA 3ZPMA 4G0SA 1USVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RCK A;  2RQF A;  3AOS A;  3E8W A;  3A1Z A;  3E8T A;  3AOT A;  4G0S A; 
#chains in the Genus database with same CATH topology
 1EWF A;  3A1Z A;  2OBD A;  2RCK A;  3H4Z A;  2RQF A;  4F2A A;  4EWS A;  4KGH A;  3E8T A;  1USU B;  3AOS A;  3E8W A;  5I7J A;  1BP1 A;  5I7L A;  4M4D A;  5I7K A;  4KGO A;  3L6I A;  3N72 A;  3UV1 A;  3AOT A;  3ZPM A;  4G0S A;  1USV B; 
#chains in the Genus database with same CATH homology
 1EWF A;  3A1Z A;  2OBD A;  2RCK A;  3H4Z A;  2RQF A;  4F2A A;  4EWS A;  4KGH A;  3E8T A;  1USU B;  3AOS A;  3E8W A;  5I7J A;  1BP1 A;  5I7L A;  4M4D A;  5I7K A;  4KGO A;  3L6I A;  3N72 A;  3UV1 A;  3AOT A;  3ZPM A;  4G0S A;  1USV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...