3AOTA

Crystal structure of juvenile hormone binding protein from silkworm in its apo form
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
203
structure length
203
Chain Sequence
b'SSATEQFLEKTSKGIPQYDIWPIDPLVVTSLDVIAPSDAGIVIRFKNLNITGLKNQQISDFQMDTKAKTVLLKTKADLHIVGDIVIELTEQSKSFTGLYTADTNVIGAVRYGYNLKNDDNGVQHFEVQPETFTCESIGEPKITLSSDLSSALEKDSGNNSLEPDMEPLKTLRQAAICKIAEACYISVVHNIRASAKILPASSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemolymph juvenile hormone binding protein
publication title Structural mechanism of JH delivery in hemolymph by JHBP of silkworm, Bombyx mori.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Hormone binding protein
total genus 57
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2010-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.30 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 3aotA00
3E8TA 3E8WA 4G0SA 3AOTA 2RCKA 3A1ZA 2RQFA 3AOSA
chains in the Genus database with same CATH superfamily
3AOTA 5I7JA 1USVB 3E8TA 4G0SA 3N72A 5I7KA 3A1ZA 5I7LA 4EWSA 1EWFA 4KGOA 1BP1A 1USUB 4F2AA 3E8WA 2OBDA 2RCKA 3H4ZA 4KGHA 3L6IA 4M4DA 2RQFA 3UV1A 3ZPMA 3AOSA
chains in the Genus database with same CATH topology
3AOTA 5I7JA 1USVB 3E8TA 4G0SA 3N72A 5I7KA 3A1ZA 5I7LA 4EWSA 1EWFA 4KGOA 1BP1A 1USUB 4F2AA 3E8WA 2OBDA 2RCKA 3H4ZA 4KGHA 3L6IA 4M4DA 2RQFA 3UV1A 3ZPMA 3AOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E8T A;  3E8W A;  4G0S A;  3AOT A;  2RCK A;  3A1Z A;  2RQF A;  3AOS A; 
#chains in the Genus database with same CATH topology
 3AOT A;  5I7J A;  1USV B;  3E8T A;  4G0S A;  3N72 A;  5I7K A;  3A1Z A;  5I7L A;  4EWS A;  1EWF A;  4KGO A;  1BP1 A;  1USU B;  4F2A A;  3E8W A;  2OBD A;  2RCK A;  3H4Z A;  4KGH A;  3L6I A;  4M4D A;  2RQF A;  3UV1 A;  3ZPM A;  3AOS A; 
#chains in the Genus database with same CATH homology
 3AOT A;  5I7J A;  1USV B;  3E8T A;  4G0S A;  3N72 A;  5I7K A;  3A1Z A;  5I7L A;  4EWS A;  1EWF A;  4KGO A;  1BP1 A;  1USU B;  4F2A A;  3E8W A;  2OBD A;  2RCK A;  3H4Z A;  4KGH A;  3L6I A;  4M4D A;  2RQF A;  3UV1 A;  3ZPM A;  3AOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...