3E8TA

Crystal structure of epiphyas postvittana takeout 1
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
216
structure length
216
Chain Sequence
b'VEKCNLEDSACMTSAFQQALPTFVAGLPDHGVEVMDVLDLDDFAFDLSGLQFTLKEGKLKGLKGAVIDNVKWDLKKKNIEVDFHLDATVKGHYTAGGRILILPITGDGQMKLKLKNIHIHLVVSYEMEKDAEGVDHVIFKKYTVTFDVKDNAQFGLTNLFNGNKELSDTMLTFLNQNWKQVSEEFGKPVMEAAAKKIFKNIKHFLAKVPIAEIANV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Takeout-like protein 1
publication title Crystal structure of Epiphyas postvittana takeout 1 with bound ubiquinone supports a role as ligand carriers for takeout proteins in insects
pubmed doi rcsb
source organism Epiphyas postvittana
molecule tags Transport protein
total genus 64
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2008-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.30 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 3e8tA00
2RQFA 4G0SA 3A1ZA 3E8WA 3E8TA 3AOTA 2RCKA 3AOSA
chains in the Genus database with same CATH superfamily
2RQFA 1EWFA 3UV1A 4KGHA 5I7LA 3N72A 5I7JA 3E8WA 2OBDA 4F2AA 2RCKA 3AOSA 4G0SA 3A1ZA 4M4DA 1USUB 1BP1A 3ZPMA 3L6IA 4KGOA 4EWSA 3H4ZA 3E8TA 3AOTA 5I7KA 1USVB
chains in the Genus database with same CATH topology
2RQFA 1EWFA 3UV1A 4KGHA 5I7LA 3N72A 5I7JA 3E8WA 2OBDA 4F2AA 2RCKA 3AOSA 4G0SA 3A1ZA 4M4DA 1USUB 1BP1A 3ZPMA 3L6IA 4KGOA 4EWSA 3H4ZA 3E8TA 3AOTA 5I7KA 1USVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQF A;  4G0S A;  3A1Z A;  3E8W A;  3E8T A;  3AOT A;  2RCK A;  3AOS A; 
#chains in the Genus database with same CATH topology
 2RQF A;  1EWF A;  3UV1 A;  4KGH A;  5I7L A;  3N72 A;  5I7J A;  3E8W A;  2OBD A;  4F2A A;  2RCK A;  3AOS A;  4G0S A;  3A1Z A;  4M4D A;  1USU B;  1BP1 A;  3ZPM A;  3L6I A;  4KGO A;  4EWS A;  3H4Z A;  3E8T A;  3AOT A;  5I7K A;  1USV B; 
#chains in the Genus database with same CATH homology
 2RQF A;  1EWF A;  3UV1 A;  4KGH A;  5I7L A;  3N72 A;  5I7J A;  3E8W A;  2OBD A;  4F2A A;  2RCK A;  3AOS A;  4G0S A;  3A1Z A;  4M4D A;  1USU B;  1BP1 A;  3ZPM A;  3L6I A;  4KGO A;  4EWS A;  3H4Z A;  3E8T A;  3AOT A;  5I7K A;  1USV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...