3E8WA

Crystal structure of epiphyas postvittana takeout 1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
219
structure length
219
Chain Sequence
b'VLPVEKCNLEDSACMTSAFQQALPTFVAGLPDHGVEVMDVLDLDDFAFDLSGLQFTLKEGKLKGLKGAVIDNVKWDLKKKNIEVDFHLDATVKGHYTAGGRILILPITGDGQMKLKLKNIHIHLVVSYEMEKDAEGVDHVIFKKYTVTFDVKDNAQFGLTNLFNGNKELSDTMLTFLNQNWKQVSEEFGKPVMEAAAKKIFKNIKHFLAKVPIAEIANV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Takeout-like protein 1
publication title Crystal structure of Epiphyas postvittana takeout 1 with bound ubiquinone supports a role as ligand carriers for takeout proteins in insects
pubmed doi rcsb
source organism Epiphyas postvittana
molecule tags Transport protein
total genus 62
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2008-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.30 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 3e8wA00
2RQFA 3A1ZA 4G0SA 3AOTA 3AOSA 3E8TA 2RCKA 3E8WA
chains in the Genus database with same CATH superfamily
4KGHA 1BP1A 3UV1A 3AOSA 3N72A 4G0SA 3L6IA 3AOTA 2OBDA 3A1ZA 3ZPMA 5I7KA 3E8TA 5I7JA 3H4ZA 2RCKA 3E8WA 4EWSA 4F2AA 2RQFA 4KGOA 5I7LA 4M4DA 1EWFA 1USVB 1USUB
chains in the Genus database with same CATH topology
4KGHA 1BP1A 3UV1A 3AOSA 3N72A 4G0SA 3L6IA 3AOTA 2OBDA 3A1ZA 3ZPMA 5I7KA 3E8TA 5I7JA 3H4ZA 2RCKA 3E8WA 4EWSA 4F2AA 2RQFA 4KGOA 5I7LA 4M4DA 1EWFA 1USVB 1USUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQF A;  3A1Z A;  4G0S A;  3AOT A;  3AOS A;  3E8T A;  2RCK A;  3E8W A; 
#chains in the Genus database with same CATH topology
 4KGH A;  1BP1 A;  3UV1 A;  3AOS A;  3N72 A;  4G0S A;  3L6I A;  3AOT A;  2OBD A;  3A1Z A;  3ZPM A;  5I7K A;  3E8T A;  5I7J A;  3H4Z A;  2RCK A;  3E8W A;  4EWS A;  4F2A A;  2RQF A;  4KGO A;  5I7L A;  4M4D A;  1EWF A;  1USV B;  1USU B; 
#chains in the Genus database with same CATH homology
 4KGH A;  1BP1 A;  3UV1 A;  3AOS A;  3N72 A;  4G0S A;  3L6I A;  3AOT A;  2OBD A;  3A1Z A;  3ZPM A;  5I7K A;  3E8T A;  5I7J A;  3H4Z A;  2RCK A;  3E8W A;  4EWS A;  4F2A A;  2RQF A;  4KGO A;  5I7L A;  4M4D A;  1EWF A;  1USV B;  1USU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...