3L6IA

Crystal structure of the uncharacterized lipoprotein yceb from e. coli at the resolution 2.0a. northeast structural genomics consortium target er542
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
171
structure length
171
Chain Sequence
b'HHSHMNQLTQYTITEQEINQSLAKHNNFSKDIGLPGVADAHIVLTNLTSQIGREEPNKVTLTGDANLDMNSLFGSQKATMKLKLKALPVFDKEKGAIFLKEMEVVDATVQPEKMQTVMQTLLPYLNQALRNYFNQQPAYVLREDGSQGEAMAKKLAKGIEVKPGEIVIPFT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized lipoprotein yceB
publication title Crystal structure of the uncharacterized lipoprotein yceb from e. coli at the resolution 2.0a. northeast structural genomics consortium target er542
rcsb
source organism Escherichia coli
molecule tags Structure genomics, unknown function
total genus 38
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07273 DUF1439 Protein of unknown function (DUF1439)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.40 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 3l6iA00
3L6IA
chains in the Genus database with same CATH superfamily
2RQFA 1BP1A 4G0SA 3N72A 3AOTA 2OBDA 3E8WA 1EWFA 3H4ZA 3A1ZA 1USVB 3AOSA 1USUB 3ZPMA 3L6IA 4F2AA 4M4DA 3E8TA 5I7KA 5I7JA 3UV1A 4KGHA 4KGOA 5I7LA 4EWSA 2RCKA
chains in the Genus database with same CATH topology
2RQFA 1BP1A 4G0SA 3N72A 3AOTA 2OBDA 3E8WA 1EWFA 3H4ZA 3A1ZA 1USVB 3AOSA 1USUB 3ZPMA 3L6IA 4F2AA 4M4DA 3E8TA 5I7KA 5I7JA 3UV1A 4KGHA 4KGOA 5I7LA 4EWSA 2RCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L6I A; 
#chains in the Genus database with same CATH topology
 2RQF A;  1BP1 A;  4G0S A;  3N72 A;  3AOT A;  2OBD A;  3E8W A;  1EWF A;  3H4Z A;  3A1Z A;  1USV B;  3AOS A;  1USU B;  3ZPM A;  3L6I A;  4F2A A;  4M4D A;  3E8T A;  5I7K A;  5I7J A;  3UV1 A;  4KGH A;  4KGO A;  5I7L A;  4EWS A;  2RCK A; 
#chains in the Genus database with same CATH homology
 2RQF A;  1BP1 A;  4G0S A;  3N72 A;  3AOT A;  2OBD A;  3E8W A;  1EWF A;  3H4Z A;  3A1Z A;  1USV B;  3AOS A;  1USU B;  3ZPM A;  3L6I A;  4F2A A;  4M4D A;  3E8T A;  5I7K A;  5I7J A;  3UV1 A;  4KGH A;  4KGO A;  5I7L A;  4EWS A;  2RCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...