3MYWI

The bowman-birk type inhibitor from mung bean in ternary complex with porcine trypsin
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
55
structure length
55
Chain Sequence
b'CCDSCDCTKSKPPQCHCANIRLNSCHSACKSCICTRSMPGKCRCLDTDDFCYKPC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title The 0.25-nm X-ray structure of the Bowman-Birk-type inhibitor from mung bean in ternary complex with porcine trypsin.
pubmed rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 4
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00228 Bowman-Birk_leg Bowman-Birk serine protease inhibitor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.69.10 Mainly Beta Ribbon Cysteine Protease (Bromelain) Inhibitor, subunit H Cysteine Protease (Bromelain) Inhibitor, subunit H 3mywI00
2QN5B 2R33A 2G81I 1H34A 3RU4B 2ILNI 5J4QB 1PI2A 1K9BA 2BBIA 1C2AA 2BI6H 2AIHA 3MYWI 1BI6H 1D6RI 1BBIA 2FJ8A 1TX6I 1PBIA 1MVZA 5J4SB
chains in the Genus database with same CATH superfamily
2QN5B 2R33A 2G81I 1H34A 3RU4B 2ILNI 5J4QB 1PI2A 1K9BA 2BBIA 1C2AA 2BI6H 2AIHA 3MYWI 1BI6H 1D6RI 1BBIA 2FJ8A 1TX6I 1PBIA 1MVZA 5J4SB
chains in the Genus database with same CATH topology
2QN5B 2R33A 2G81I 1H34A 3RU4B 2ILNI 5J4QB 1PI2A 1K9BA 2BBIA 1C2AA 2BI6H 2AIHA 3MYWI 1BI6H 1D6RI 1BBIA 2FJ8A 1TX6I 1PBIA 1MVZA 5J4SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QN5 B;  2R33 A;  2G81 I;  1H34 A;  3RU4 B;  2ILN I;  5J4Q B;  1PI2 A;  1K9B A;  2BBI A;  1C2A A;  2BI6 H;  2AIH A;  3MYW I;  1BI6 H;  1D6R I;  1BBI A;  2FJ8 A;  1TX6 I;  1PBI A;  1MVZ A;  5J4S B; 
#chains in the Genus database with same CATH topology
 2QN5 B;  2R33 A;  2G81 I;  1H34 A;  3RU4 B;  2ILN I;  5J4Q B;  1PI2 A;  1K9B A;  2BBI A;  1C2A A;  2BI6 H;  2AIH A;  3MYW I;  1BI6 H;  1D6R I;  1BBI A;  2FJ8 A;  1TX6 I;  1PBI A;  1MVZ A;  5J4S B; 
#chains in the Genus database with same CATH homology
 2QN5 B;  2R33 A;  2G81 I;  1H34 A;  3RU4 B;  2ILN I;  5J4Q B;  1PI2 A;  1K9B A;  2BBI A;  1C2A A;  2BI6 H;  2AIH A;  3MYW I;  1BI6 H;  1D6R I;  1BBI A;  2FJ8 A;  1TX6 I;  1PBI A;  1MVZ A;  5J4S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...