3N72A

Crystal structure of aha-1 from plasmodium falciparum, pfc0270w
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
156
structure length
143
Chain Sequence
SSGRENLYFQGERNYNKWAESYIKYNLSNLKIETIYFDNLQVSGNACVSIRKGKQINSFEYIIKFEWLYSYFGGSVEIPDFSTFSLEENDYAINIEDESENLRFIYDSILKKEGKEKIKECLKNFQEDLLKHDKNESNKELKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone activator
molecule keywords putative activator of HSP90
publication title Crystal Structure of Aha-1 from plasmodium falciparum, PFC0270w
rcsb
source organism Plasmodium falciparum
total genus 45
structure length 143
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09229 Aha1_N Activator of Hsp90 ATPase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.20 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 3n72A00
1USUB 3N72A 1USVB
chains in the Genus database with same CATH superfamily
4EWSA 3H4ZA 3N72A 3L6IA 1EWFA 3ZPMA 3AOSA 4KGOA 5I7JA 1BP1A 3A1ZA 5I7KA 4M4DA 2RQFA 4KGHA 3E8TA 4F2AA 5I7LA 1USUB 1USVB 3UV1A 2OBDA 3AOTA 4G0SA 2RCKA 3E8WA
chains in the Genus database with same CATH topology
4EWSA 3H4ZA 3N72A 3L6IA 1EWFA 3ZPMA 3AOSA 4KGOA 5I7JA 1BP1A 3A1ZA 5I7KA 4M4DA 2RQFA 4KGHA 3E8TA 4F2AA 5I7LA 1USUB 1USVB 3UV1A 2OBDA 3AOTA 4G0SA 2RCKA 3E8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USU B;  3N72 A;  1USV B; 
#chains in the Genus database with same CATH topology
 4EWS A;  3H4Z A;  3N72 A;  3L6I A;  1EWF A;  3ZPM A;  3AOS A;  4KGO A;  5I7J A;  1BP1 A;  3A1Z A;  5I7K A;  4M4D A;  2RQF A;  4KGH A;  3E8T A;  4F2A A;  5I7L A;  1USU B;  1USV B;  3UV1 A;  2OBD A;  3AOT A;  4G0S A;  2RCK A;  3E8W A; 
#chains in the Genus database with same CATH homology
 4EWS A;  3H4Z A;  3N72 A;  3L6I A;  1EWF A;  3ZPM A;  3AOS A;  4KGO A;  5I7J A;  1BP1 A;  3A1Z A;  5I7K A;  4M4D A;  2RQF A;  4KGH A;  3E8T A;  4F2A A;  5I7L A;  1USU B;  1USV B;  3UV1 A;  2OBD A;  3AOT A;  4G0S A;  2RCK A;  3E8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...