3N72A

Crystal structure of aha-1 from plasmodium falciparum, pfc0270w
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
156
structure length
143
Chain Sequence
b'SSGRENLYFQGERNYNKWAESYIKYNLSNLKIETIYFDNLQVSGNACVSIRKGKQINSFEYIIKFEWLYSYFGGSVEIPDFSTFSLEENDYAINIEDESENLRFIYDSILKKEGKEKIKECLKNFQEDLLKHDKNESNKELKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative activator of HSP90
publication title Crystal Structure of Aha-1 from plasmodium falciparum, PFC0270w
rcsb
source organism Plasmodium falciparum
molecule tags Chaperone activator
total genus 45
structure length 143
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09229 Aha1_N Activator of Hsp90 ATPase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.20 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 3n72A00
1USVB 1USUB 3N72A
chains in the Genus database with same CATH superfamily
3E8TA 3L6IA 3H4ZA 4KGHA 4G0SA 2OBDA 5I7KA 3E8WA 2RCKA 2RQFA 3AOSA 3UV1A 3A1ZA 1BP1A 1EWFA 1USVB 5I7LA 4KGOA 3ZPMA 4EWSA 5I7JA 3AOTA 1USUB 3N72A 4F2AA 4M4DA
chains in the Genus database with same CATH topology
3E8TA 3L6IA 3H4ZA 4KGHA 4G0SA 2OBDA 5I7KA 3E8WA 2RCKA 2RQFA 3AOSA 3UV1A 3A1ZA 1BP1A 1EWFA 1USVB 5I7LA 4KGOA 3ZPMA 4EWSA 5I7JA 3AOTA 1USUB 3N72A 4F2AA 4M4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USV B;  1USU B;  3N72 A; 
#chains in the Genus database with same CATH topology
 3E8T A;  3L6I A;  3H4Z A;  4KGH A;  4G0S A;  2OBD A;  5I7K A;  3E8W A;  2RCK A;  2RQF A;  3AOS A;  3UV1 A;  3A1Z A;  1BP1 A;  1EWF A;  1USV B;  5I7L A;  4KGO A;  3ZPM A;  4EWS A;  5I7J A;  3AOT A;  1USU B;  3N72 A;  4F2A A;  4M4D A; 
#chains in the Genus database with same CATH homology
 3E8T A;  3L6I A;  3H4Z A;  4KGH A;  4G0S A;  2OBD A;  5I7K A;  3E8W A;  2RCK A;  2RQF A;  3AOS A;  3UV1 A;  3A1Z A;  1BP1 A;  1EWF A;  1USV B;  5I7L A;  4KGO A;  3ZPM A;  4EWS A;  5I7J A;  3AOT A;  1USU B;  3N72 A;  4F2A A;  4M4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...