3UV1A

Crystal structure a major allergen from dust mite
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
190
structure length
190
Chain Sequence
b'DKITEEINKAIDDAIAAIEQSETIDPMKVPDHADKFERHVGILDFKGELAMRNIEARGLKQMKRQGDANVKGEEGIVKAHLLIGVHDDIVSMEYDLAYKLGDLHPTTHVISDIQDFVVALSLEIPDEGNITMTSFEVRQFANVVNHIGGLSILDPIFGVLSDVLTAIFQDTVRKEMTKVLAPAFKRELEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Der f 7 allergen
publication title Crystal Structure of Der f 7, a Dust Mite Allergen from Dermatophagoides farinae.
pubmed doi rcsb
source organism Dermatophagoides farinae
molecule tags Allergen
total genus 41
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16984 Grp7_allergen Group 7 allergen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.50 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 3uv1A00
3UV1A 3H4ZA
chains in the Genus database with same CATH superfamily
1USVB 4F2AA 4KGHA 2RCKA 3A1ZA 5I7JA 3ZPMA 3E8WA 1BP1A 4KGOA 3AOSA 3E8TA 3UV1A 3N72A 1EWFA 3AOTA 4EWSA 4M4DA 3H4ZA 2RQFA 2OBDA 4G0SA 3L6IA 5I7LA 5I7KA 1USUB
chains in the Genus database with same CATH topology
1USVB 4F2AA 4KGHA 2RCKA 3A1ZA 5I7JA 3ZPMA 3E8WA 1BP1A 4KGOA 3AOSA 3E8TA 3UV1A 3N72A 1EWFA 3AOTA 4EWSA 4M4DA 3H4ZA 2RQFA 2OBDA 4G0SA 3L6IA 5I7LA 5I7KA 1USUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UV1 A;  3H4Z A; 
#chains in the Genus database with same CATH topology
 1USV B;  4F2A A;  4KGH A;  2RCK A;  3A1Z A;  5I7J A;  3ZPM A;  3E8W A;  1BP1 A;  4KGO A;  3AOS A;  3E8T A;  3UV1 A;  3N72 A;  1EWF A;  3AOT A;  4EWS A;  4M4D A;  3H4Z A;  2RQF A;  2OBD A;  4G0S A;  3L6I A;  5I7L A;  5I7K A;  1USU B; 
#chains in the Genus database with same CATH homology
 1USV B;  4F2A A;  4KGH A;  2RCK A;  3A1Z A;  5I7J A;  3ZPM A;  3E8W A;  1BP1 A;  4KGO A;  3AOS A;  3E8T A;  3UV1 A;  3N72 A;  1EWF A;  3AOT A;  4EWS A;  4M4D A;  3H4Z A;  2RQF A;  2OBD A;  4G0S A;  3L6I A;  5I7L A;  5I7K A;  1USU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...