4G0SA

Crystal structure of epiphyas postvittana takeout 1 expressed in sf9 cells
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
219
structure length
219
Chain Sequence
VLPVEKCNLEDSACMTSAFQQALPTFVAGLPDHGVEVMDVLDLDDFAFDLSGLQFTLKEGKLKGLKGAVIDNVKWDLKKKNIEVDFHLDATVKGHYTAGGRILILPITGDGQMKLKLKNIHIHLVVSYEMEKDAEGVDHVIFKKYTVTFDVKDNAQFGLTNLFNGNKELSDTMLTFLNQNWKQVSEEFGKPVMEAAAKKIFKNIKHFLAKVPIAEIANV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Takeout-like protein 1
publication title Ligand promiscuity within the internal cavity of Epiphyas postvittana Takeout 1 protein.
pubmed doi rcsb
source organism Epiphyas postvittana
total genus 64
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.30 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 4g0sA00
3A1ZA 3AOSA 3E8TA 2RQFA 3AOTA 2RCKA 4G0SA 3E8WA
chains in the Genus database with same CATH superfamily
4KGOA 3AOSA 2RQFA 3ZPMA 4KGHA 4G0SA 3E8WA 3A1ZA 3E8TA 1BP1A 2OBDA 4M4DA 4EWSA 3UV1A 1USVB 5I7LA 5I7KA 5I7JA 2RCKA 1USUB 3H4ZA 4F2AA 1EWFA 3N72A 3AOTA 3L6IA
chains in the Genus database with same CATH topology
4KGOA 3AOSA 2RQFA 3ZPMA 4KGHA 4G0SA 3E8WA 3A1ZA 3E8TA 1BP1A 2OBDA 4M4DA 4EWSA 3UV1A 1USVB 5I7LA 5I7KA 5I7JA 2RCKA 1USUB 3H4ZA 4F2AA 1EWFA 3N72A 3AOTA 3L6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A1Z A;  3AOS A;  3E8T A;  2RQF A;  3AOT A;  2RCK A;  4G0S A;  3E8W A; 
#chains in the Genus database with same CATH topology
 4KGO A;  3AOS A;  2RQF A;  3ZPM A;  4KGH A;  4G0S A;  3E8W A;  3A1Z A;  3E8T A;  1BP1 A;  2OBD A;  4M4D A;  4EWS A;  3UV1 A;  1USV B;  5I7L A;  5I7K A;  5I7J A;  2RCK A;  1USU B;  3H4Z A;  4F2A A;  1EWF A;  3N72 A;  3AOT A;  3L6I A; 
#chains in the Genus database with same CATH homology
 4KGO A;  3AOS A;  2RQF A;  3ZPM A;  4KGH A;  4G0S A;  3E8W A;  3A1Z A;  3E8T A;  1BP1 A;  2OBD A;  4M4D A;  4EWS A;  3UV1 A;  1USV B;  5I7L A;  5I7K A;  5I7J A;  2RCK A;  1USU B;  3H4Z A;  4F2A A;  1EWF A;  3N72 A;  3AOT A;  3L6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...