4KGHA

Crystal structure of human splunc1 lacking the secretion signal sequence
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
212
structure length
193
Chain Sequence
SPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILLGKVTSVIPGLNNVIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords BPI fold-containing family A member 1
publication title Molecular basis for pH-dependent mucosal dehydration in cystic fibrosis airways.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 193
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01273 LBP_BPI_CETP LBP / BPI / CETP family, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.10 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 4kghA00
1EWFA 4KGHA 4M4DA 1BP1A 5I7JA 5I7LA 4KGOA 3ZPMA 5I7KA 4EWSA 2OBDA 4F2AA
chains in the Genus database with same CATH superfamily
3A1ZA 3N72A 4KGHA 3L6IA 3ZPMA 3AOSA 4G0SA 5I7KA 3AOTA 1BP1A 2RCKA 3H4ZA 3E8WA 2OBDA 4F2AA 1EWFA 1USUB 2RQFA 4M4DA 3UV1A 5I7JA 5I7LA 1USVB 4KGOA 4EWSA 3E8TA
chains in the Genus database with same CATH topology
3A1ZA 3N72A 4KGHA 3L6IA 3ZPMA 3AOSA 4G0SA 5I7KA 3AOTA 1BP1A 2RCKA 3H4ZA 3E8WA 2OBDA 4F2AA 1EWFA 1USUB 2RQFA 4M4DA 3UV1A 5I7JA 5I7LA 1USVB 4KGOA 4EWSA 3E8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EWF A;  4KGH A;  4M4D A;  1BP1 A;  5I7J A;  5I7L A;  4KGO A;  3ZPM A;  5I7K A;  4EWS A;  2OBD A;  4F2A A; 
#chains in the Genus database with same CATH topology
 3A1Z A;  3N72 A;  4KGH A;  3L6I A;  3ZPM A;  3AOS A;  4G0S A;  5I7K A;  3AOT A;  1BP1 A;  2RCK A;  3H4Z A;  3E8W A;  2OBD A;  4F2A A;  1EWF A;  1USU B;  2RQF A;  4M4D A;  3UV1 A;  5I7J A;  5I7L A;  1USV B;  4KGO A;  4EWS A;  3E8T A; 
#chains in the Genus database with same CATH homology
 3A1Z A;  3N72 A;  4KGH A;  3L6I A;  3ZPM A;  3AOS A;  4G0S A;  5I7K A;  3AOT A;  1BP1 A;  2RCK A;  3H4Z A;  3E8W A;  2OBD A;  4F2A A;  1EWF A;  1USU B;  2RQF A;  4M4D A;  3UV1 A;  5I7J A;  5I7L A;  1USV B;  4KGO A;  4EWS A;  3E8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...