4KGOA

Crystal structure of double leucine to methionine mutant human splunc1 lacking the secretion signal sequence
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
212
structure length
183
Chain Sequence
SPTGLAGSLTNALSNGLLSGGLLGIMENLPLLDIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKMDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords BPI fold-containing family A member 1
publication title Molecular basis for pH-dependent mucosal dehydration in cystic fibrosis airways.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 183
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01273 LBP_BPI_CETP LBP / BPI / CETP family, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.10 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 4kgoA00
2OBDA 1EWFA 1BP1A 4EWSA 4F2AA 3ZPMA 5I7JA 4M4DA 4KGOA 5I7KA 5I7LA 4KGHA
chains in the Genus database with same CATH superfamily
2OBDA 3AOTA 3AOSA 4EWSA 5I7LA 5I7KA 2RQFA 3N72A 4M4DA 2RCKA 4KGHA 1BP1A 3L6IA 3H4ZA 1USVB 3UV1A 3E8TA 1USUB 1EWFA 4F2AA 3ZPMA 5I7JA 3A1ZA 4KGOA 4G0SA 3E8WA
chains in the Genus database with same CATH topology
2OBDA 3AOTA 3AOSA 4EWSA 5I7LA 5I7KA 2RQFA 3N72A 4M4DA 2RCKA 4KGHA 1BP1A 3L6IA 3H4ZA 1USVB 3UV1A 3E8TA 1USUB 1EWFA 4F2AA 3ZPMA 5I7JA 3A1ZA 4KGOA 4G0SA 3E8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OBD A;  1EWF A;  1BP1 A;  4EWS A;  4F2A A;  3ZPM A;  5I7J A;  4M4D A;  4KGO A;  5I7K A;  5I7L A;  4KGH A; 
#chains in the Genus database with same CATH topology
 2OBD A;  3AOT A;  3AOS A;  4EWS A;  5I7L A;  5I7K A;  2RQF A;  3N72 A;  4M4D A;  2RCK A;  4KGH A;  1BP1 A;  3L6I A;  3H4Z A;  1USV B;  3UV1 A;  3E8T A;  1USU B;  1EWF A;  4F2A A;  3ZPM A;  5I7J A;  3A1Z A;  4KGO A;  4G0S A;  3E8W A; 
#chains in the Genus database with same CATH homology
 2OBD A;  3AOT A;  3AOS A;  4EWS A;  5I7L A;  5I7K A;  2RQF A;  3N72 A;  4M4D A;  2RCK A;  4KGH A;  1BP1 A;  3L6I A;  3H4Z A;  1USV B;  3UV1 A;  3E8T A;  1USU B;  1EWF A;  4F2A A;  3ZPM A;  5I7J A;  3A1Z A;  4KGO A;  4G0S A;  3E8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...