The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
42
|
sequence length |
212
|
structure length |
196
|
Chain Sequence |
SPTGLAGSLTNALSNGLLSGGLLGILENLPLLDCLKGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLLPIQGLLDSLTGILNKCLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural Features Essential to the Antimicrobial Functions of Human SPLUNC1.
pubmed doi rcsb |
| molecule keywords |
BPI fold-containing family A member 1
|
| molecule tags |
Antimicrobial protein
|
| source organism |
Homo sapiens
|
| total genus |
42
|
| structure length |
196
|
| sequence length |
212
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2016-02-17 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01273 | LBP_BPI_CETP | LBP / BPI / CETP family, N-terminal domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Super Roll | Bactericidal permeability-increasing protein; domain 1 | Bactericidal permeability-increasing protein; domain 1 |
#chains in the Genus database with same CATH superfamily 5I7L A; 4EWS A; 5I7K A; 4M4D A; 4F2A A; 5I7J A; 4KGO A; 1EWF A; 4KGH A; 1BP1 A; 3ZPM A; 2OBD A; #chains in the Genus database with same CATH topology 3L6I A; 4M4D A; 3E8T A; 1USV B; 1EWF A; 1USU B; 3UV1 A; 4EWS A; 3E8W A; 4KGO A; 1BP1 A; 3ZPM A; 2OBD A; 3A1Z A; 3AOS A; 5I7K A; 3N72 A; 5I7J A; 2RQF A; 3H4Z A; 4KGH A; 4G0S A; 5I7L A; 2RCK A; 4F2A A; 3AOT A; #chains in the Genus database with same CATH homology 3L6I A; 4M4D A; 3E8T A; 1USV B; 1EWF A; 1USU B; 3UV1 A; 4EWS A; 3E8W A; 4KGO A; 1BP1 A; 3ZPM A; 2OBD A; 3A1Z A; 3AOS A; 5I7K A; 3N72 A; 5I7J A; 2RQF A; 3H4Z A; 4KGH A; 4G0S A; 5I7L A; 2RCK A; 4F2A A; 3AOT A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...