5I7JA

Crystal structure of human splunc1 disulfide mutant m3 (i76c, v214c)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
212
structure length
196
Chain Sequence
SPTGLAGSLTNALSNGLLSGGLLGILENLPLLDCLKGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLLPIQGLLDSLTGILNKCLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein
molecule keywords BPI fold-containing family A member 1
publication title Structural Features Essential to the Antimicrobial Functions of Human SPLUNC1.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 196
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01273 LBP_BPI_CETP LBP / BPI / CETP family, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.10 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 5i7jA00
5I7LA 3ZPMA 4KGHA 1EWFA 1BP1A 5I7KA 4EWSA 5I7JA 2OBDA 4F2AA 4M4DA 4KGOA
chains in the Genus database with same CATH superfamily
2RCKA 3AOSA 1EWFA 3H4ZA 3N72A 4G0SA 3L6IA 3UV1A 5I7LA 3ZPMA 1USVB 5I7KA 1USUB 2OBDA 3E8WA 3E8TA 4KGOA 4KGHA 1BP1A 3A1ZA 4EWSA 5I7JA 4F2AA 4M4DA 3AOTA 2RQFA
chains in the Genus database with same CATH topology
2RCKA 3AOSA 1EWFA 3H4ZA 3N72A 4G0SA 3L6IA 3UV1A 5I7LA 3ZPMA 1USVB 5I7KA 1USUB 2OBDA 3E8WA 3E8TA 4KGOA 4KGHA 1BP1A 3A1ZA 4EWSA 5I7JA 4F2AA 4M4DA 3AOTA 2RQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I7L A;  3ZPM A;  4KGH A;  1EWF A;  1BP1 A;  5I7K A;  4EWS A;  5I7J A;  2OBD A;  4F2A A;  4M4D A;  4KGO A; 
#chains in the Genus database with same CATH topology
 2RCK A;  3AOS A;  1EWF A;  3H4Z A;  3N72 A;  4G0S A;  3L6I A;  3UV1 A;  5I7L A;  3ZPM A;  1USV B;  5I7K A;  1USU B;  2OBD A;  3E8W A;  3E8T A;  4KGO A;  4KGH A;  1BP1 A;  3A1Z A;  4EWS A;  5I7J A;  4F2A A;  4M4D A;  3AOT A;  2RQF A; 
#chains in the Genus database with same CATH homology
 2RCK A;  3AOS A;  1EWF A;  3H4Z A;  3N72 A;  4G0S A;  3L6I A;  3UV1 A;  5I7L A;  3ZPM A;  1USV B;  5I7K A;  1USU B;  2OBD A;  3E8W A;  3E8T A;  4KGO A;  4KGH A;  1BP1 A;  3A1Z A;  4EWS A;  5I7J A;  4F2A A;  4M4D A;  3AOT A;  2RQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...