5I7LA

Crystal structure of splunc1 disulfide mutant m2 (a48c, v253c)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
192
Chain Sequence
b'SPTGLCGSLTNALSNGLLSGGLLGILENLPLLDILGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFCI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BPI fold-containing family A member 1
publication title Structural Features Essential to the Antimicrobial Functions of Human SPLUNC1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antimicrobial protein
total genus 45
structure length 192
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01273 LBP_BPI_CETP LBP / BPI / CETP family, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.10 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 5i7lA00
4KGOA 1BP1A 4M4DA 3ZPMA 5I7LA 5I7KA 4EWSA 4F2AA 1EWFA 4KGHA 5I7JA 2OBDA
chains in the Genus database with same CATH superfamily
3AOTA 4KGOA 3N72A 3AOSA 3L6IA 5I7LA 3E8WA 4F2AA 1EWFA 4KGHA 2RQFA 1USVB 3UV1A 4G0SA 2RCKA 3E8TA 4M4DA 1USUB 4EWSA 5I7JA 3A1ZA 2OBDA 1BP1A 3ZPMA 5I7KA 3H4ZA
chains in the Genus database with same CATH topology
3AOTA 4KGOA 3N72A 3AOSA 3L6IA 5I7LA 3E8WA 4F2AA 1EWFA 4KGHA 2RQFA 1USVB 3UV1A 4G0SA 2RCKA 3E8TA 4M4DA 1USUB 4EWSA 5I7JA 3A1ZA 2OBDA 1BP1A 3ZPMA 5I7KA 3H4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KGO A;  1BP1 A;  4M4D A;  3ZPM A;  5I7L A;  5I7K A;  4EWS A;  4F2A A;  1EWF A;  4KGH A;  5I7J A;  2OBD A; 
#chains in the Genus database with same CATH topology
 3AOT A;  4KGO A;  3N72 A;  3AOS A;  3L6I A;  5I7L A;  3E8W A;  4F2A A;  1EWF A;  4KGH A;  2RQF A;  1USV B;  3UV1 A;  4G0S A;  2RCK A;  3E8T A;  4M4D A;  1USU B;  4EWS A;  5I7J A;  3A1Z A;  2OBD A;  1BP1 A;  3ZPM A;  5I7K A;  3H4Z A; 
#chains in the Genus database with same CATH homology
 3AOT A;  4KGO A;  3N72 A;  3AOS A;  3L6I A;  5I7L A;  3E8W A;  4F2A A;  1EWF A;  4KGH A;  2RQF A;  1USV B;  3UV1 A;  4G0S A;  2RCK A;  3E8T A;  4M4D A;  1USU B;  4EWS A;  5I7J A;  3A1Z A;  2OBD A;  1BP1 A;  3ZPM A;  5I7K A;  3H4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...