The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
65
|
sequence length |
231
|
structure length |
226
|
Chain Sequence |
SQFIFEDVPTFNPEVGYVAFIGKYGQQLNFGVARVFFLNQKKAKMVLHKTAQPSVDLTFGGVKFTVVNNHFPQYVSNPVPDNAITLHRMSGYLARWIADTCKASVLKLAEASAQIVMPLAEVKGCTWADGYTMYLGFAPGAEMFLDAFDFYPLVIEMHRVLKDNMDVNFMKKVLRQRYGTMTAEEWMTQKITEIKAAFNSVGQLAWAKSGFSPAARTFLQQFGINI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Viral protein
|
| molecule keywords |
NUCLEOCAPSID PROTEIN
|
| publication title |
Nucleocapsid Protein Structures from Orthobunyaviruses Reveal Insight Into Ribonucleoprotein Architecture and RNA Polymerization.
pubmed doi rcsb |
| source organism |
Schmallenberg virus
|
| total genus |
65
|
| structure length |
226
|
| sequence length |
231
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature | |
| pdb deposition date | 2013-01-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00952 | Bunya_nucleocap | Bunyavirus nucleocapsid (N) protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Poly(ADP-ribose) Polymerase; domain 1 | Poly(ADP-ribose) Polymerase; domain 1 | ||
| Alpha Beta | Alpha-Beta Complex | UDP-galactose 4-epimerase; domain 1 | UDP-galactose 4-epimerase; domain 1 |
#chains in the Genus database with same CATH superfamily 4IJS A; 3ZLA A; 3ZL9 A; 4JNG A; 4IDX A; 4BGP A; 4BHH B; 4J1J A; 4J1G A; 4IDU B; 4IDU A; #chains in the Genus database with same CATH topology 1E7R A; 4IJS A; 3L3M A; 3E48 A; 4ZZZ A; 1E7S A; 3PVZ A; 1NAI A; 2Q1U A; 3LU1 A; 3I6I A; 4L70 A; 1U9J A; 1Z73 A; 1I3K A; 2ZCV A; 4IDX A; 2GN4 A; 3C1O A; 4R5W A; 3GN7 A; 3W1V A; 3DXF A; 1SB8 A; 4PJV A; 1A9Y A; 3RUF A; 3VVC A; 4XHU A; 4L7N A; 1VL0 A; 1T2A A; 3EHE A; 2VRC D; 1PAX A; 1I2C A; 1KVT A; 4GV2 A; 1KC1 A; 2X6T A; 3CE0 A; 1WOK A; 2C20 A; 3PAX A; 3SXP A; 2WM3 A; 3RUC A; 1GS0 A; 1RKX A; 1N7H A; 2ZCU A; 2QW8 A; 4OPX C; 1XEL A; 2VUS A; 1A9Z A; 1KEP A; 1KEW A; 1K6X A; 2Z1M A; 1Z7B A; 1UDC A; 2Q1S A; 2C54 A; 1UK1 A; 3I52 A; 4LW8 A; 3KO8 A; 4GV4 A; 3ZLA A; 2GNA A; 3GJW A; 4BL5 A; 2HUN A; 2QYS A; 4TWR A; 4E5Y A; 1UDB A; 1LRK A; 3L3L A; 1K6J A; 3RUE A; 3RUD A; 2PAW A; 2CNB A; 2UDP A; 1XGK A; 4WOK A; 4RV6 A; 4L6S A; 1N7G A; 2Q1T A; 2GGS A; 1I3M A; 2R6J A; 1KVS A; 1LRJ A; 2UV8 A; 4J1G A; 2Z95 A; 2X86 A; 2WMD A; 4DQY C; 4OQB C; 2RD6 A; 2GN9 A; 2C5E A; 3SLG A; 3KCZ A; 2RCW A; 2QZZ A; 2GN6 A; 3RUH A; 2GN8 A; 1E7Q A; 3E5M A; 4ID9 A; 2VUT A; 3RU7 A; 1KBZ A; 1I3L A; 3KJD A; 1EK5 A; 1KVQ A; 1BWS A; 3AW9 A; 4B8Z A; 4L7P A; 1TI7 A; 1KEU A; 1HZJ A; 1OC2 A; 1UK0 A; 1EFY A; 5U9C A; 1G1A A; 4PJT A; 3I5M A; 5GY7 A; 2PZJ A; 4BKP A; 4ZRN A; 4EJ0 A; 4G5H A; 2PAX A; 2P5U A; 1KVR A; 1EQ2 A; 3ICP A; 3ZL9 A; 4HHY A; 4WPG A; 1R6D A; 1BXK A; 4L7U A; 2BLL A; 3RUA A; 3VPS A; 4IDU B; 4L7L A; 1RPN A; 4IDU A; 2B69 A; 4L7R A; 1KER A; 3FHB A; 2P5Y A; 2HRZ A; 2EXX A; 4JNG A; 2VUU A; 4ZRM A; 5A00 A; 4BHH B; 4J1J A; 1N2S A; 2VRC A; 2QX7 A; 1KC3 A; 1GY8 A; 4L7O A; 1FXS A; 3I6Q A; 3C3X A; 4B8W A; 4HHZ A; 4OQA C; 4L6Z A; 1A26 A; 1KET A; 1BSV A; 4GV0 A; 1QYD A; 5IN4 A; 2GAS A; 4UXB A; 5IN5 A; 4TVJ A; 2R2G A; 1I3N A; 1E6U A; 1UDA A; 1GFS A; 2VRB A; 3ENK A; 1SB9 A; 4PAX A; 1KVU A; 1Z75 A; 1QYC A; 1NAH A; 1LRL A; 1EK6 A; 4UND A; 1Z74 A; 4ZZX A; 2JL1 A; 1DB3 A; 1QRR A; 3RU9 A; 4R6E A; 4LIS A; 1I24 A; 1Z45 A; 2C5A A; 1I2B A; 2C59 A; 2PK3 A; 1R66 A; 4GV7 A; 4GLL A; 4ZZY A; 3SC6 A; 3C49 A; 4BGP A; 1WVG A; 1K6I A; 4IDG A; 3C4H A; #chains in the Genus database with same CATH homology 4IJS A; 2GN8 A; 4ID9 A; 3PVZ A; 3ZLA A; 2GNA A; 4IDX A; 2GN4 A; 3W1V A; 4G5H A; 3VVC A; 3ZL9 A; 2UV8 A; 4J1G A; 4IDU B; 4IDU A; 4JNG A; 2GN9 A; 4BGP A; 4IDG A; 4BHH B; 4J1J A; 2GN6 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
