The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
21
|
sequence length |
85
|
structure length |
84
|
Chain Sequence |
MFQQEVTITPNGLDTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The aspartyl replacement of the active site histidine in histidine-containing protein, HPr, of the Escherichia coli Phosphoenolpyruvate:Sugar phosphotransferase system can accept and donate a phosphoryl group. Spontaneous dephosphorylation of acyl-phosphate autocatalyzes an internal cyclization
pubmed doi rcsb |
molecule tags |
Transferase
|
source organism |
Escherichia coli
|
molecule keywords |
HISTIDINE-CONTAINING PROTEIN
|
total genus |
21
|
structure length |
84
|
sequence length |
85
|
ec nomenclature | |
pdb deposition date | 1999-05-13 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00381 | PTS-HPr | PTS HPr component phosphorylation site |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Histidine-containing Protein; Chain: A; | HPr-like |
#chains in the Genus database with same CATH superfamily 3IHS A; 2HPR A; 1HDN A; 2XDF C; 3LE1 A; 1SPH A; 5T17 A; 1FU0 A; 1CM3 A; 1ZVV J; 1Y50 A; 2LRK D; 2NZV L; 3EZB B; 3LFG A; 5T1O A; 3EZE B; 3LE5 A; 3OQO D; 1PFH A; 1OPD A; 1Y51 A; 2OEN L; 1KKL H; 1QFR A; 1TXE A; 1PCH A; 1KKM H; 3OQM D; 1MO1 B; 1MU4 A; 1Y4Y A; 1MO1 A; 2HID A; 2AK7 A; 1KA5 A; 1GGR B; 1JEM A; 2LRL D; 3CCD A; 3LE3 A; 1QR5 A; 3EZA B; 1K1C A; 2NZU L; 1CM2 A; 2FEP S; 3OQN D; 1VRC C; 1RZR L; 5T1N A; 1POH A; 1J6T B; 2JEL P; 4XWJ B; 3LNW A; 2RLZ A; 1PTF A; #chains in the Genus database with same CATH topology 3IHS A; 2HPR A; 1HDN A; 2XDF C; 3LE1 A; 1SPH A; 5T17 A; 1FU0 A; 1CM3 A; 1ZVV J; 1Y50 A; 2LRK D; 2NZV L; 3EZB B; 3LFG A; 2RLZ A; 5T1O A; 3EZE B; 3LE5 A; 3OQO D; 1PFH A; 1OPD A; 1Y51 A; 2OEN L; 1KKL H; 1QFR A; 1TXE A; 1PCH A; 1KKM H; 3OQM D; 1MO1 B; 1MU4 A; 1Y4Y A; 1MO1 A; 2HID A; 2AK7 A; 1KA5 A; 1GGR B; 1JEM A; 2LRL D; 3CCD A; 3LE3 A; 1QR5 A; 3EZA B; 1K1C A; 2NZU L; 1CM2 A; 2FEP S; 3OQN D; 1VRC C; 1RZR L; 5T1N A; 1POH A; 1J6T B; 2JEL P; 4XWJ B; 3LNW A; 1J5Y A; 1PTF A; #chains in the Genus database with same CATH homology 3IHS A; 2HPR A; 1HDN A; 2XDF C; 3LE1 A; 1SPH A; 5T17 A; 1FU0 A; 1CM3 A; 1ZVV J; 1Y50 A; 2LRK D; 2NZV L; 3EZB B; 3LFG A; 5T1O A; 3EZE B; 3LE5 A; 3OQO D; 1PFH A; 1OPD A; 1Y51 A; 2OEN L; 1KKL H; 1QFR A; 1TXE A; 1PCH A; 1KKM H; 3OQM D; 1MO1 B; 1MU4 A; 1Y4Y A; 1MO1 A; 2HID A; 2AK7 A; 1KA5 A; 1GGR B; 1JEM A; 2LRL D; 3CCD A; 3LE3 A; 1QR5 A; 3EZA B; 1K1C A; 2NZU L; 1CM2 A; 2FEP S; 3OQN D; 1VRC C; 1RZR L; 5T1N A; 1POH A; 1J6T B; 2JEL P; 4XWJ B; 3LNW A; 2RLZ A; 1PTF A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...