The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
12
|
sequence length |
111
|
structure length |
111
|
Chain Sequence |
MSTVTKYFYKGENTDLIVFAASEELVDEYLKNPSIGKLSEVVELFEVFTPQDGRGAEGELGAASKAQVENEFGKGKKIEEVIDLILRNGKPNSTTSSLKTKGGNAGTKAYN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The Shwachman-Bodian-Diamond syndrome protein family is involved in RNA metabolism.
pubmed doi rcsb |
| molecule keywords |
Hypothetical 12.0 kDa protein in NAM8-GAR1 intergenic region
|
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Saccharomyces cerevisiae
|
| total genus |
12
|
| structure length |
111
|
| sequence length |
111
|
| ec nomenclature | |
| pdb deposition date | 2003-02-13 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01172 | SBDS | Shwachman-Bodian-Diamond syndrome (SBDS) protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Hypothetical 12.0 Kda Protein In Nam8-gar1 Intergenic Region; Chain: A; | Ribosome maturation protein SBDS, N-terminal domain |
#chains in the Genus database with same CATH superfamily 1P9Q C; 1T95 A; 2WBM A; 1NYN A; 2L9N A; 2KDO A; #chains in the Genus database with same CATH topology 1P9Q C; 1T95 A; 2WBM A; 1NYN A; 2L9N A; 2KDO A; #chains in the Genus database with same CATH homology 1P9Q C; 1T95 A; 2WBM A; 1NYN A; 2L9N A; 2KDO A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...