2KDOA

Structure of the human shwachman-bodian-diamond syndrome protein, sbds
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
252
structure length
252
Chain Sequence
GHMSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome maturation protein SBDS
publication title Structure, dynamics, and RNA interaction analysis of the human SBDS protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 57
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2009-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01172 SBDS Shwachman-Bodian-Diamond syndrome (SBDS) protein
A PF09377 SBDS_C SBDS protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.900 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2kdoA02
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kdoA03
3.30.1250.10 Alpha Beta 2-Layer Sandwich Hypothetical 12.0 Kda Protein In Nam8-gar1 Intergenic Region; Chain: A; Ribosome maturation protein SBDS, N-terminal domain 2kdoA01
4ZCKA 2WBMA 2BV3A 4ES1A 1T95A 3EXCX 2CVEA 2NPFA 2E1RA 1DARA 5G4DA 3B78A 1FNMA 1ZM4A 3LH2S 2ZITA 4QR1A 4ZCIA 2I8EA 4MYTA 4ES2A 1KTVA 2I0XA 3ZZUA 1N0VC 2EFGA 3UI3A 1ZM9A 2IVYA 4FN5A 4MYUA 2KDOA 3B82A 4TNOA 3E3XA 1VI7A 1P9QC 1ZM3A 2J7KA 3ZZTA 2L9NA 4ZCMA 2XEXA 1N0UA 4MAKA 2BM1A 1ZM2A 1ELOA 2BM0A 4QR2A 4QR0A 3OQ2A 1ZPWX 1NYNA 4M1KA 1U2RA 4ZCLA 4ES3A 3B8HA 3ZZ0A
chains in the Genus database with same CATH superfamily
2K3PA 2K27A 3MM9B 1ICEB 1AW0A 4LLNA 1FEEA 3PCOB 1FIAA 4LF8J 2CJBA 3K10A 3DXBA 3DQVC 3TO8A 1EQMA 4A8KA 4HTJA 3LAKA 1RWOB 3VQSA 3AL0B 4O3QA 1TC3C 1QUVA 1TU0B 3LQRA 1FWKA 4U0VA 5ETVA 5HMWA 3EVMA 1IJWC 4LVOP 3E6CC 2YU3A 4EVIA 4CO2A 4ZVFA 5H9EJ 1NSPA 1CJUB 4M5MA 2HQCA 5TGTA 2DR9A 4IDKA 2MLZA 2G1DA 2RKHA 4IXAA 2O03A 2PD1A 2OCCH 2EKYA 2J7KA 4ZPTR 1U9NA 1FXDA 1HWUA 4EYHB 1HI1A 2K3KA 4HX4A 1R23A 5KFCA 1N48A 3I5CA 2HNYA 4YDDB 3BZQA 2N3OA 3UW1A 2ETHA 3ZP5A 2AJFE 4OYMA 1GK8A 1FJCA 3K1PA 1IXCA 3AD9C 3UI3A 1LDKB 5BJRA 1QSLA 1LVKA 1R5GA 4JI3F 2YKPA 3TUZC 4QWDA 1X5SA 1LXNA 3TOAA 3TARA 2KZZA 4RW4A 1OR7A 2ZKZA 1RTHA 2CUZA 2FX0A 4XDCA 4A8WA 2YNIA 1QTNB 4XICA 1MH3A 2GVDA 5KFNA 4P9SA 2NCKL 3HFZB 2MKCA 2GGPB 2KM8B 1IKYB 1K1SA 3CC4S 3P5TL 1VC6A 3NOCA 2R7DA 3V4IB 5FLXK 3ZFVA 3QWUA 4H0EA 1O51A 1SFEA 2X1AA 3FHNA 3J80U 3LAMA 1OSDA 2HVRA 1HKQA 4MMOA 2HHTA 3K8WA 2JMWA 4HZFA 1GTEA 3R4KA 3JS9A 1WDTA 3CTRA 2B0GA 2FMYA 3QMQA 2X85A 4KT5C 1U0HB 3E2EA 3ZNUA 1HNXJ 1YVFA 2LKSA 2YPZA 1NUEA 3BH6B 4ZTJA 2L7FP 7FDRA 1KYWA 4FXDA 3RBDA 3GMEA 1T03A 4P5OA 2LFBA 3NGSA 2WTEA 5ILUA 4I99C 2KG1A 2AGPA 1PUFB 4ILMA 2ESHA 4DV6F 2MH9A 1DTQA 1XNRF 4KHPJ 2E1AA 4RBTA 5L1LA 4HYKA 4J7CA 4WXHA 2W9CB 2CUYA 1WOSA 1TL5A 3OTDA 2K3FA 2IC3B 3V6DB 4BE1A 4PABA 3SDEB 1JNZB 3HD2A 2ADUA 2MABA 1VYAA 5EX3A 2V8GA 1Q7LB 1KDNA 2F8MA 3GX4X 4IUFA 3K0JA 4XSZF 4HEA2 1FJLA 2LKZA 5B0AA 1PO6A 3MN2A 4C2TA 3T8RA 2CAJA 4KIFA 1VQ8S 4JBAA 2LQ5A 3DRPA 3OR1C 4WFAQ 2DA3A 3Q3SA 3FXQA 4KGXB 1SIZA 1S9GA 3GE9A 4H4KA 1TNTA 5J2MA 1LW0A 1D8YA 2Q66A 4EO6A 3NS7B 1M5PC 5H6QA 3VCDA 1YG2A 3ENWA 4A5NA 1BJAA 4JI0J 3TMOA 3TX8A 1P1TA 1VCTA 4WK8F 2BV6A 1DLOA 1FFSB 4E7HA 1HNXF 1FERA 4OX6A 3TAQA 1X3UA 1XSXA 2L5QA 1U1MA 2AO9A 1FO1A 4FASD 1RT4A 4I2QB 1JUPA 5CJ9A 4LB5A 1C1BB 3MFHA 4O3OA 3M7GA 3MR5A 2GIZA 4NI2B 3CQZJ 5GADJ 3BGLA 4KIAA 2DAOA 2BXJA 4K4ZA 3EZ5A 2ZBPA 5L8RC 3QU3A 3MOZA 3WHIA 1RT7A 2HGMA 4ED1A 3QO9B 3LP1A 4EEFG 3B82A 2P4WA 5K7ZA 4ZVTB 3G86A 2NLWA 4NCAA 4A0XA 4AVPA 1J7KA 5ERIA 2QSGX 3H5RA 1YLXA 2V7FA 4I76A 3ASNH 4BHQA 4CICA 2KL4A 4XLAA 2KVQE 2LMIA 3N4WA 2ILZA 3WU0A 5C5JA 4Y13A 1VISA 2JLEA 5E3MA 2YWEA 3DI6A 5SZTA 3BJAA 3HK2A 3KLGA 2C2NA 2LD5A 4OYOA 5AJ3J 3FFIB 3KPHA 1IJFB 4A3DJ 4IF4A 2BYVE 5DM6F 2YTCA 4YEAA 3GIKA 3RAQA 4FF4A 2BHZA 2RIJA 3TA0A 4KV8A 4I67A 2FHJD 3E97A 1PP7U 1ZRDA 4F26A 1YRNB 2LH9A 3OFFA 4K7QA 4JI0F 4RW8B 2C3PA 2IMOA 3HXLA 4DHVA 2PLYA 2AJ1A 1RJJA 5CYMB 3VODA 3J81K 1G3SA 3BBFA 1S6QA 5C44J 2OC6A 2VIXA 1UP1A 3F21A 2C3OA 2VF3A 2O6GE 5AE1A 2YQ0A 2NXJA 3ZRGA 3LW5C 1QO0D 5C42A 4I69A 2ZO4A 1CS4A 1X8DA 4RKUC 4GC6A 1FF2A 3SMZA 5DTDA 3Q8QB 1XQIA 3LWLA 2MQNA 1BHNA 2M45A 1C0WA 4J9SA 4EU0A 1UAAA 1W4MA 4RGSA 2FB0A 3T1BA 3MUTP 3FVYA 4DPWA 5E3CA 3DCAA 3PFOA 1HMVA 4J9QA 3IBFB 3GB0A 2FBKA 2C2ZB 1WJBA 2ASJA 3R9LA 4ITVA 4DUYJ 4RPFA 1K83J 3B6BA 3SFUA 4ID5B 1AKHB 2OZ6A 2OUGA 2OIHA 4FF3A 2DNZA 4TU8A 2JPCA 3PV8A 2LQBA 3I0TA 3ZTOA 2R9LA 1S76D 1FDNA 3HG9A 3CDEA 3EMTA 1M1EB 3GTOJ 3NGDA 5D8KB 4J9LA 2MYSA 1U8SA 2M87A 1HWKA 2B9WA 3QPHA 5IM0B 2XMVA 3ISNC 2HDWA 3GEZA 1QVFR 3CUQB 3O6BB 2BJDA 4MTPA 1KLMB 2WB1D 5BNGA 4LSZB 1HA1A 2ASYA 4MFBA 3D0GE 1FZPB 1IN0A 2ATLA 1YOVB 3G6XA 1YK9A 3MFIA 2ZWPA 3QOEA 3R7BB 3CO7C 3VAKA 3T1YJ 1E3OC 1QY7A 3CNQP 4DV2F 2HHXA 5KT5A 3P49B 2P9EA 4ZC3A 5AT1B 2XEXA 3H2LA 1GXQA 1OCRH 3UPFA 1UWBA 2FTRA 5HATA 4GRSA 1FXLA 2FNAA 2LKXA 1V9OA 3AOCA 2EKNA 4ANCA 2XHWA 3S32A 2LREA 1VZ0A 1GEHA 5A8WB 2OLWA 2GAGC 3OIPA 2BHYA 1TELA 2MZSA 3MMBA 2R2RA 1IN6A 1S79A 2ECCA 2EWHA 3WQPA 4J00A 2VASA 1NK6A 3I4HX 3M1CA 3B4MA 3FMRA 5EEGA 2UUTA 4XK8C 3WC0A 1SVMA 2DU9A 2F4FA 5C25A 4KO0A 5F8LA 2KRHA 5ICCA 2M2EA 3AXKA 1AROP 4EZ6A 3TW6A 1HL6A 3N97A 2KDOA 2NXEA 4PRFA 1JGSA 5J1YA 1QAXA 2C22A 1KQSR 2M2BA 3FMSA 1YYVA 5E0OA 1HBMA 4UVAA 4ZMMA 3RR7A 2OO4A 4C3MA 1RCOB 3O3KA 2Q0OA 2HLUA 3MM5A 3IP4B 4GVLA 4CQ1A 4L9NA 2A5YB 3T1YF 4HA8A 1BC7C 1ZARA 3PEJA 3VZHA 5EG0B 5LLQA 4HNTA 3I31A 4CM2A 1DQUA 1LWCA 2AYMA 3M2VB 5GAGU 4Y2KA 3OJSA 1HR0J 2EI5A 3LOUA 3PIOF 5F3TA 4X4PA 1VQ4I 1R4MB 3LAJA 2JA5J 2H3EB 2LXUA 4BDZA 1WELA 5BXIA 4DYRA 3QWPA 2DHXA 1ZBTA 2MW8A 4M6VA 4YB7A 4PCQA 1UETA 1NK4A 2EK5A 4J37A 1VQ5I 3B73A 4FPIA 3CGIA 4XOPA 2ZBIA 2OPQB 3QOPA 4UUSA 1HW2A 1VRTA 1S9EB 3SQOP 4D7NA 1B59A 5A76A 2P5LC 4B9UA 3CMES 3BWGA 3IGVA 1E3HA 3KLOA 1X7VA 1ETWA 3HUGB 3CDIA 4EM1A 3G9CA 2RNGA 2XCAA 1VQNS 2CV1A 2NSCA 2HZDA 5T7LB 2BXYA 3BV8A 2XLIA 3NAHA 1LEBA 5E1XA 4C8LA 1SBRA 3U02A 3MQ0A 2PJRA 4CT9A 2VPYB 3UCZP 3HOZJ 4HT7A 3ZMDA 4DR4J 1VQPS 2UUCF 1SC6A 2STTA 3L2CA 3HOXJ 1JKHA 4X4VA 2FBIA 5IT9U 1TZ0A 2VN2A 4OYAA 2ZXIA 1W36C 1IKXB 1LWXA 3FRYA 2Z57B 2CQDA 1A6QA 1SCJB 2BDPA 3VPRA 1E6VA 1KP6A 2DK5A 2EIJH 1ZQ3P 1I3OB 2ZE2B 1HNVB 2BRKA 2NS0A 2LY2A 3CCUS 4K50A 4JOUA 1N5YB 4M3DA 1ITPA 3HSGA 2BW7A 1NO8A 4XKVA 2GOMA 2AV5A 2W2NP 4BQQA 3FK4A 3TA2A 3CJ8A 4K59A 4DSFA 3WHCA 3NGTA 4DN9A 2DT7B 5EWGA 5IT0A 2J0WA 4IKFA 1P92A 4EGYA 1NG6A 4DV7J 3R6LB 4BE0A 3QZ7A 1RWKB 2O7OA 2W8LA 2RSQA 1FJGJ 4ECYA 2VI6A 5M2RA 1YZ6A 4ICLB 2RILA 4Y15A 3CJKA 3SFZA 2EA4A 4TLRA 4WYLA 3R7NB 2VPRA 4V19K 2E1RA 3ZMUA 1B99A 1WSRA 4Z6YA 4HPQA 4RS8A 4LF9F 2WOMB 1VQYA 1S1WA 3BQZA 5AIPA 2EFNA 3ZN0A 2QBYA 2HSEB 1IRZA 1DGWY 3TWZA 2MY7A 4C4WA 3U1KA 1JE8A 3HPOA 4AUXA 3WC2A 2DEJA 3NBPB 1T56A 4ESBA 5L39A 4KYWA 5F8NA 1S4FA 4UY8I 2O61A 5I3UA 2FUG9 4DR1J 2Y69H 4JYKA 4OI3A 5GMEA 1F5BA 4I2PB 1FBUA 2BJ9A 3GU0A 1RLDA 4BHPA 2V1XA 1SKRA 2ZJ2A 4RL1A 3W1YC 5T14A 4DUTA 1OPCA 3MCSA 4OQJA 2COBA 1NB7A 2JSPA 4QWAA 1OY6A 4V2FA 5F41A 4I1TA 4UUTA 3U1NA 2AX0A 2E7XA 1XGOA 3OV7A 2YNGA 3DTIA 3GR1A 3OXGA 3SCLE 4NHJA 4D3GA 2ISYA 1IKVA 1NRKA 2KHDA 2P5VA 3DDKA 3J7YU 2R7QA 2Y1RI 2RB7A 4ZLNA 5LHIA 4NYPA 1YBAA 3QT5A 1KHVA 3RSNA 2F5VA 3L2UA 4CLSA 2DK2A 2VFUA 2XG8A 2UXBJ 1MMAA 3LA3A 4CH0S 3O2PE 1UJ5A 1N5TA 2HG4A 2LLZA 1IWAA 3AOAA 4JP8A 3I9V2 4CTAA 5HLTA 1UWAA 1Y0HA 3IRXB 2VG5A 1W1WE 3E5UA 1VQOS 5KFOA 1OMIA 3G6ES 3S1TA 1M1HA 1FIPA 3DLLQ 3ZTRA 5B1BH 3HI9A 3IG1B 1JHFA 4ZITA 2HBRB 4OHZA 1WJEA 4HW0A 3AJ1A 3BQYA 1WC1A 2VKVA 1R0CB 4IL6C 3JREA 4A4JA 3OYKA 2YX7A 2V79A 1RISA 4J5OA 4QQBA 4X0GA 1XN7A 1U7LA 2M8EA 1N77A 5CCLA 3B6AA 1IRGA 1PBUA 2NUHA 1IBLJ 3QJPA 2A6EF 4CUGA 3BQ0A 3BG3A 3CC4I 2W2MP 4HYEA 3MM8A 1RT6B 3SQGB 2V8HA 5JMNA 4X62J 5FGMA 4PXBA 4I64A 2BXZA 3KHLA 4BE2A 3P45B 2R8KA 3BKUA 3T3FA 3OWTA 1SJ3P 2WAEA 4QR2A 2BJ1A 1SL2A 2VV5A 4WXWA 3LO3A 2FHJA 3A8IA 4ZN1A 4PR6A 5DV5A 4PFOA 4DCPB 2OI2A 3DBHB 1M0SA 3A2KA 1RACB 3HHLD 2C42A 2H09A 3Q83A 1ZG5A 1S5ZA 4YQWA 4MHGA 4JI7J 1RWWB 2E44A 1OYWA 3FWEA 2VPLA 2DT9A 3FBBA 4N47A 2H1KA 1I5OB 3R5AA 5ADZA 1A9NB 3BG5A 5I3PA 3GF2A 3W5YA 3NL0A 2HGLA 2EFOA 1W0UA 1PYTA 4YB1P 5ETMA 2HPMA 3EYZA 2WK4A 3A8JA 5HDGA 1JXLA 3PFEA 4A8XA 3UDVA 2WVEA 9ATCB 2VJUA 3RKXA 1KFSA 2X6YA 3ZQLA 2HFZA 5HS8A 2ZMEC 4EQQA 3M7VA 1PKUA 2XHKA 2HEOA 1ULRA 2OKQA 2X1BA 3DRSA 1Q4RA 4OLPA 3OYCA 2DHSA 2LDYA 4O3RA 2BKNA 2IM0A 2VA2A 2QM3A 4L5EA 1RAGB 1B64A 2P9CA 1VQSA 2FHOB 4LF4J 1FK9A 3TEDA 1U6ZA 2E7WA 1MWQA 2MLYA 4I6YA 2C3YA 2Q6BA 2V34A 1NPRA 3PW0A 2HVDA 4CO8A 1SMYF 4CCOA 3SIPB 3MAAB 4NZ7A 2E35A 4II3A 4PXEA 2HHSA 2K02A 1KQ0A 1C1CB 2VKEA 1I3QJ 1VQKS 1REVA 1JLEB 2WAQD 1UFMA 2XZTB 5LGNA 4HSTA 3FBFA 3KNAA 3DYAA 3ELKA 3OSFA 3KLNA 1HIYA 1S9HA 2IY5B 3VGSA 2QUFA 3OS2A 5KFKA 1XCVA 3MEGA 1G2HA 1F4KA 2WB1N 5IP6A 4IFYA 1RAHB 1JLGA 3MCNA 2QEXI 4OINF 4FN5A 3QT8A 2JLGA 3V8KA 4FXVA 2BYCA 4YHHF 4ZJZA 2P81A 1PDNC 3HRTA 4JX5A 4ZVEA 1H6KX 2YKAA 3PO5A 3ZCOA 4O5VA 3L2RA 2RDDA 3RYLA 4F0KA 1DFDA 4ANDA 4M73A 4ZK7M 2AHQA 2OAUA 2XMWA 4XO0A 4HDHA 3L09A 1I27A 3KZZA 2PMZA 1TKTA 3FUYA 4RX6A 5KFWA 3CC7I 3K2AA 3TZYA 2B4OA 4OX7A 4C3LA 5LGTA 3J81j 5DZ7A 3HOYJ 2PI5A 2AX1A 1WOPA 1C0UB 3FX3A 1FYLA 5E3LA 5HNFA 2ZH2A 3CCMS 4K0KF 2W7PA 2ZKTA 1WI9A 1T9VA 7FD1A 1ON2A 5I4MA 4UUXA 4MAKA 1S9FA 1U6GA 2ZJRQ 1Y11A 2HI3A 1S6PA 3WU2C 4RR5A 1HLVA 2QE5A 4DL5A 3V8LA 3MEKA 2XUBA 4OI0A 3TQ1A 1H72C 3CESA 2Q2EB 4URGA 1ZGAA 3M30A 2X3DA 1Q81T 2W4PA 1YJUA 2XGCA 5FJ8J 3WTUC 3MKZA 3OTOJ 1Z0XA 2LDUA 1V55H 1P1LA 2X3GA 2DNMA 4MQ9F 5A6WA 4C0HA 1P4XA 4KBIA 3DRRB 4PJMA 3WU1B 1DAXA 2FZCB 3JTGA 1RBOB 2AP6A 4G12A 2VHGA 4LD5A 2OELA 1Z1ZA 1U5TA 2WBMA 3ZQCA 4UOCA 5IYBJ 4KRWA 3UKGA 3QRQA 2RQCA 2MKSA 5F0UA 1A35A 3KX2A 4DR3J 1MJAA 4MNUA 2LG4A 4CNYA 2DGWA 3JRGA 1WJCA 5FFZA 3F8FA 3KMQA 1S1XB 4ZPCA 3EYYA 4Y2IA 3BS9A 4M5NA 5A8KB 4F4KA 2QV6A 2K40A 1SI9A 1T11A 5F0FA 2RNEA 3JTPA 1SJQA 1WPKA 5AONA 2BJ3A 5DO2A 4WXDA 3TOQA 1U09A 4WP9A 3ADAC 2FY8A 1YJ9S 4B3RF 2DD8S 4AL7A 3TI0A 4Y2MA 1SXLA 3K4MA 4Q2LA 3H8YA 3KP5A 2DVIA 4ZLJA 2CV2A 2KL8A 5DRKA 1T8IA 3DKWA 1SH3A 4LVNP 1Q8BA 2XS5A 1P2FA 1IM6A 1TL7B 1TQIA 1CJVB 1S4EA 1OJLA 4RAYA 3W5XA 4CO5A 4K5RA 5E3OA 1XN9A 1ZTWA 4AXIA 4OJ3A 2MXYA 3GV8B 4EYIB 4U8YA 4JI6J 2V5HG 3IBWA 1WC5A 1OO0B 3M6WA 5HAOA 3NGRA 1W26A 3AA8A 2UUAF 4CDGA 5HQLA 1A6IA 1JLAB 3QPSA 3CC2S 1VNDA 3BTLA 2GV1A 2VH7A 3BEGB 5K14A 2BV3A 1YX5A 4R8UA 2M0MA 4BJ6C 4H4OB 5E2QA 4MKAA 2Y0BB 3LP0A 4A6EA 1U0JA 1FT9A 2FD2A 3HLUA 1N56A 2AQFA 4RMNA 1STZA 5DS7A 1S6LA 2OV7A 3CB4A 2JLFA 4N4OB 4DCJB 1RADB 5BYSA 3A03A 2PSZA 2QSWA 3OFEA 3QAHA 5FD1A 1RHMB 2M0GB 2K5CA 5K20B 1NSAA 3CO9A 2IJFA 3IA0A 1PAUB 1NDCA 5G4DA 2FLNA 5JHUA 3FEZA 1A36A 2LEPA 3J7A1 1GXUA 2CQCA 1POGA 1IR1A 2RAEA 3A8EA 3SFIA 3FSYA 1Z21A 3BPSP 3C14B 4DBQA 3UDEA 3HOTA 3ZGKA 4PUOA 5MLCV 1GH8A 3H92A 2CV0A 1NDPA 2RN7A 4E6KG 5D5XB 2CNKB 2O5RA 2MKYA 1RYRA 2HIQA 1ZM3A 2DOEA 3M1VB 3J80Z 3TQNA 4FNHA 4N5SA 1BGXT 1X4HA 3TVZA 3O3LA 1HW8A 1KS2A 4IOBA 2G1HA 3I59B 2L9SA 2DJWA 2V1DA 5KFIA 2MSTA 4QYZK 1U5TC 1KU2A 4BH9A 3WTZA 3NMAA 3RRGA 3DHXA 1K1QA 5HBMA 4RAGA 4QPQA 1WKLA 4ZHRA 3DBLB 4DV0J 5BS6A 3UD3P 4IO9Q 2ZUAA 1O3SA 3C15A 2W48A 3NRBA 1OJ4A 2RH3A 4G1QA 5KFTA 5MAOA 2ELKA 4QU6A 3IBCB 3H2VE 3COAC 4ILLA 2AU0A 3GVAA 1S29A 5FD6A 2PFFB 2FJWA 2FLOA 1KFDA 2KT2A 2CDRB 4ZZLA 3TW7A 4M5JA 3CCUI 4WX9A 4RAFA 2R4GA 1XMOF 2NVQJ 3LNQA 2RRBA 1YFHA 2LA6A 3MEEA 1YJRA 1SQFA 3BM7A 5DDQC 2CRGA 1S48A 4J9UE 2KFDA 3FXUA 4WU3A 5ETSA 1EKSA 2QYGA 2IRXA 1IO2A 2DNLA 2QFJA 4JI1J 3BO4A 4IDKB 2W2QP 1OCZH 4USTA 1CBKA 4OI2A 2DGUA 2IGNA 2HHVA 3HFKA 4CIOA 5GPAA 1HHQA 4A3KJ 2WSEC 2XO7A 2CZ4A 4I6WA 3IAM2 1YTYA 1Y9OA 3GYGA 3IWFA 1MNMC 4Q48A 3W6JB 1H2TZ 2HNYB 3NAIA 3BR3A 4U6PA 1F6TA 4GMKA 4B09A 1FEXA 2QLXA 3FK6A 3EDQB 2FD5A 3E6DA 4W90B 2M34A 1FJ7A 3ENQA 3FEXB 1XMQF 2KYZA 2IDEA 3THPA 5J1UA 1DDNA 3VWBA 4UOGA 4RW4B 5L3FA 3I58A 4M5IA 1G59A 2JTVA 1HA8A 1KEKA 5F8HA 1RTHB 1D1CA 3GW2A 2YNIB 2DGTA 3BKFA 2NVTJ 2XC7A 2MLKA 2GVDB 4B3SF 1YQAA 4ZVUB 3OYIA 3CEDA 2WONA 5FRNA 2K7LA 3EM1A 4JX6A 1RR8C 2OA4A 2Y1LB 4FS2A 2R2TA 3PXGa 5JVHQ 4F04B 2IRYA 3HHEA 2FRHA 2HVSA 2QTWA 2QN6B 4NLWA 3CF2A 3BTJA 4IHYA 1AUSL 1NCLA 1XGMA 2A5WA 4Y52J 3H9GA 3VF0B 3CCLS 1LWFA 2XIGA 1N32F 2BZTA 5DQHA 1I50J 3IWZA 3K0LA 3K70C 3O8HA 3AXMA 3A4TA 2VQEJ 4JI1F 2E66A 2NYHA 2V4JC 5E1ZB 8RUCA 3LQQA 1SD7A 3N28A 3BYPA 3ZZPA 2WAQN 4CP5A 2ZXJA 1RT1A 2MQQA 2HDCA 3CT9A 1FFGB 2HFUA 5EWEA 1XGNA 4AIDA 2DNQA 2K06A 1T03B 3H25A 3IM9A 2NRAC 1M5SA 3D0HE 1WJ9A 4F3MA 1M1KT 1VS3A 1DTQB 1BC8C 3H7HB 1Y39A 2BE2A 3W8GA 5LHGA 3S14J 1HHTP 2ZC2A 1SAXA 4A8QA 4ED8A 1G3TA 4RU2A 3JRFA 4NC6A 4M3FA 2O66A 4TNOA 5KK1A 1I6JA 1SPBP 4BXFA 1VQMI 4NWBA 4CA0A 3OTCA 3LTOA 4ENNA 4I68A 2CPYA 4JP0A 4ON0A 4LG3A 2QO3A 4C48A 1NH8A 3RIRA 2BRLA 2VFVA 2WAFA 1XTAA 4AM3A 2HS5A 1XMAA 1WHWA 1WJ5A 1RP5A 3UVJA 3OHAA 3S3OA 1QSSA 3DRPB 1ETYA 2BM1A 2V8VA 1VBZA 3BZCA 3RZAA 2D45A 3DRXA 4PWDA 2V9KA 2DNGA 2CJYB 4C3IJ 1S9GB 4G65A 5J2MB 1LW0B 3GYHX 3WG9A 2OTJS 2VFSA 1KRPA 2VFRA 1APSA 4PG6A 4U0YA 1PJ5A 5JFRA 3M1EA 2IVMA 1JXEA 5IFMA 3LSTA 3QAEA 1DLOB 4PWWA 1R8HA 3NEUA 3QT7A 2NYXA 1RT4B 2GIRA 4NL5A 2HGNA 2CVIA 3G96A 2WSCC 2BX6A 3G87A 1XNQJ 4PQUA 3UCUP 2CQBA 3KG1A 3T1HF 2ZITA 5LMUJ 2QLFB 1RT7B 1JUSA 3PJRA 4R25A 3KK1A 3UD5A 2YY3A 3IKTA 4DQSA 2ME0A 4QIWD 2ZFHA 5ETTA 2OCEA 3AODA 4TXSA 3EWGA 4F2RA 3G2XA 5GP9A 2VQFF 3KYLA 2XSJA 2XVCA 1LDDA 1GFWB 1UFLA 4B43A 4UB8C 4Z2XA 4F2SA 3EYIA 4LRCA 3M3YJ 4FS1A 4IEJA 3I56S 2B6AA 3J80Y 2GA2A 2BW2A 1O4XA 3S1QJ 5J1PA 2FLPA 5ICGA 2FVQA 4ZH4F 2LU2A 3QFWA 2KIQA 2OQGA 3DI6B 3KLGB 1XB4A 3GO5A 3DCFA 3CUNA 2G2ZA 3VAHA 2C28A 1DTTA 3D5SC 2ZH6A 3HFVA 4KV8B 1BL0A 2OD6A 2ELJA 8AT1B 2Z2SB 1R58A 2F40A 5D8HB 5CVIA 2JSXA 1YGYA 2GZWA 3VVTA 4ZOSA 1QE1A 1K0TA 4Y33A 2BVZA 2B9XA 2W7NA 2H8WA 1ZTRA 2YKMA 1PIEA 1X5OA 4DU8A 1HARA 2KLOA 4ENKA 4CZZA 3BO2A 1I94F 4HKQA 1S6QB 5DGBA 4DI6A 4A46A 2R5ZA 3KCCA 1DU6A 4NLRA 5C42B 3G82A 1FNOA 5E5NA 4V1Ak 2FJBB 1CS4B 2J9DA 1QAIA 3D5LA 2DRDA 2J8SA 3PNYA 3WTXC 4XN0A 3SEQA 2HZCA 1TKXA 4IH5A 3LALA 3CF5F 4YN3B 5JUMA 1B9MA 1WG1A 1XBWA 1KONA 4IOCF 1OLTA 2KZGA 3AL0C 5IOLA 1XMBA 1HMVB 2XS2A 2IXSA 2K4JA 2AWZA 3KEQA 2DXIA 2M1BA 5KT4A 1J0RA 2XMAA 4PK4A 1RBLA 3HM9A 1S97A 3FBEA 3L95X 4C9YA 2HLTA 3BTIA 3CLQA 1KR4A 4J9KA 2MQMA 1PILA 3G2BA 4MH8A 1W2BR 2V63A 2R7FA 4RUCA 2P6SA 2BBEA 2V2KA 3CCMI 4LFAJ 4K4TA 1YITS 1RRJA 4CH7A 4NEYA 3E5XA 2IA2A 3TO6A 3RGIA 2XI3A 2ASDA 4OIXA 5L1IA 2WRMA 1S6UA 5M3FJ 4G94A 3MPDA 1ZLJA 2VONA 1Q95G 4ED7A 3TVYA 1HOMA 1BR1A 1VQ9S 2DPJA 1EZZB 6PAXA 3EZOA 4MFBB 3GZ5A 3AHPA 3TJ8A 3V5RA 4A5MA 4BS9A 1MG7A 3ZZUA 4YS2A 3P9IA 5IT4A 3HPHA 3C6UA 1TQPA 4NRTA 1KBRA 3D6FB 1J59A 3C18A 2KM8C 4XRSA 1ZM2A 3G4SI 2BABA 3K69A 4JI4F 1UWBB 4F4YA 3BJ6A 4WP3A 1V3SA 4JV0A 4DPTA 3KJVA 1EQ0A 4A3GJ 2DMUA 4QYZJ 3LQVA 4USHA 1Z05A 1VFCA 3DKXA 3MR2A 3JAMU 2QG9B 3QNWB 1LWEB 3CIZA 1JLBA 3MMBB 4PG7A 2M4MA 1JKRC 3BQ1A 3JSPA 4QR0A 4IQMA 4K5SA 2EZLA 3OYHA 1FPQA 5KVRA 3IV5A 1WJAA 5C25B 1X58A 2KJWA 2W4DA 4KO0B 2P7CB 2LQ8A 1AZSA 2R7XA 5KG2A 4CO0A 1UMQA 4DLGA 3A01A 1AOYA 2JDJA 2R2SA 1VHFA 4AQYF 3ECOA 1HBMB 3MAHA 5C2CA 2ZVSA 1SJFA 3LSMA 5DDGA 5BMZA 3AG1H 1UPMB 1WOOA 4KH0B 3CJTA 1YJ9I 5HVHA 2DR7A 3PKMA 2ZJPQ 2CG8A 3MM5B 4OAYA 1IBMJ 3JTOA 4XLPF 4Q8FA 4F50A 3MZIA 2MKHA 4IG0A 5THWA 1LWCB 4LSNA 2QKLB 2HQGA 3EVOA 1ZELA 3CO0P 3QRFF 1UVMA 1YJWI 1RWXB 1FP1D 2VUMJ 2IPOB 1YX3A 1ZAXA 4LFUA 2XF6A 3NLCA 4I6AA 4P1WA 1QM9A 4LQ3A 1GXTA 5ILVA 4KMUX 1M5VC 1TP7A 1I3AA 3TZXA 2F4IA 2HOAA 3HJVA 2X4HA 2RQQA 3OXFA 5JVGQ 5CVRA 2HQIA 1RTJA 4UB6C 4UUSB 1VRTB 1UVLA 1NJWA 3CC2I 1S1UA 1XSDA 3KE2A 3AB2B 2HZVA 1L0OC 5JJBA 4I98B 3AQOA 5KG6A 4NXNJ 4NCGA 2W00A 4OJHA 4L0YB 2R7SA 3HGGA 1QZYA 2DNPA 4IZZA 2OBPA 2KRBA 2AXTC 4X4QA 3FXMA 2ZH1A 2HFOA 3DBRB 2PJRB 3GXOA 1YIJS 1T3OA 2FQQB 5HL7Q 1U49A 2GMJA 1HWLA 2XB2D 4BBYA 1AYEA 1AB8A 5KCMA 1EKEA 2M5YA 1JKHB 3ZC4A 5BOXA 2DQLA 5DG7A 3L9ZA 1JX4A 3MMYB 3HPGA 3V6KA 3MKYB 3VVUA 1RWUA 4EJOA 2XS7A 4B3OA 5ED4A 1J75A 3L2QA 4YG2F 2ALYB 3Q0AA 5E7OB 2MQOA 4UUVA 1ZOTA 4NUBA 2ZH8A 1VJQA 4CO3A 2JOQA 2F48A 3DN9A 2QVOA 3VAMA 4GFBA 2CRLA 3OYMA 3K6GA 4A3IJ 4JI8F 2LNBA 1P8GA 1IV6A 4LFCJ 1EHWA 5GAEI 3OYLA 1WEYA 1Y0NA 2KIFA 2D3O1 3Q8UA 4YFXF 4PYDA 1N52B 3ZO7A 2F4VJ 5K5OA 3PO3J 1FP2A 4DV4F 2X6OA 2M3AA 3ETMA 2EFQA 3CJKB 3OD2A 2UVUA 1NPKA 4A3BJ 2NVXJ 3NRVA 1NU4A 4EM2A 1WWHA 2UXNA 3M6XA 3HZEA 1J09A 1R00A 3EDPA 5D4LA 5D4PA 3UE2A 4X4OA 3UR0A 1EJ9A 2OJ3A 2IJNA 4KMFA 1FHTA 3VGTA 1YX2A 2HYJA 4ES3A 1N75A 3NEKA 2PEBA 4UUWA 4DR5F 5EJCA 1K61A 1MBGA 3VV2B 4DV3J 1RAIB 1OSCA 3M9MB 2QBYB 1OYDA 3MD3A 3QATA 4TY8A 2OF7A 3M2UA 5LFAA 3S1RJ 2Z9OA 1TUWA 2U1AA 5CCMA 3OYEA 1TKDA 4OIOF 2VA3A 1U1NA 2UUWA 3K4BA 2QT7A 1T02A 1RE1B 2RUSA 4XL9A 2V1NA 1V5VA 4KGZB 3NCPA 2M30A 5I3UB 4C0OC 1R5ID 1GAOA 1F3VA 3KYCB 4Q8EA 4Q7AA 3G6YA 4ECSA 1S5LC 5A2QZ 3WTTC 2JFKA 1SEUA 1V5GA 2WC2A 4DXLA 2VQGA 1BUXA 4BACA 4PZJA 3VAJA 1FRXA 2YQ3A 1Q1KA 3P4UB 1ZHFA 3CJ0A 3QGGA 5ILSA 3WTWC 1KVKA 4AD6A 4LFCF 5HLFA 2E60A 1KWMA 1KHWA 5HROA 2MA3A 3V81B 4ZVPB 2QL5B 4ANJA 2F4VF 3V4GA 3J80K 1QUPA 2N4DA 4ZLPA 5EEAA 2HFVA 3W5ZA 1X1BA 2YNGB 1S59A 4F93B 1YSJA 3MEXA 2YR2A 1X4DA 2E19A 2DOFA 1PVEA 2IRFG 5KFVA 2W7OA 3VYRB 1Z6RA 5IT9Y 3GPAA 1E6YA 2XPVA 2GM4A 3CCSI 3GTMJ 2CQQA 3DPUA 3S3NA 4M9SA 2Z30B 4CTAB 3KFWX 4ETXA 4ZJOA 1GX6A 5D78A 1CVJA 3A02A 1W2IA 4L3NA 3GONA 2VG5B 4L72B 5LOQA 1C2PA 2XY5A 1OQ6A 2CQ0A 1UZCA 2JEGA 3J7ZI 2PA8D 1WORA 2OFGX 1ORKA 3KLHA 3O1LA 4CLTA 1LQ9A 3GTYX 3QIDA 2JX2A 4IKAA 2WHOA 2BQUA 4I01A 2RU3A 2DBBA 3DOMA 5D5UB 1HNZJ 4QIWN 5KHDA 2GX8A 2OFHX 1KQFB 3QPLA 2MD0A 3SQNA 1DQ8A 2HVHA 4NBQA 3GZ6A 5IPAA 3H9QA 2R8JA 3N5BA 4DR2F 4G6QA 3JQMA 1JLCA 4FYDA 3M32A 5FKMA 1QDUB 2ESNA 3U1DA 5HMYA 1H88C 3LPYA 3MM8B 1VBKA 2QLBB 1KNZA 1FBSA 5CABA 1Z67A 4ELVA 5HP1A 4ECWA 2PFBA 1TNSA 2Z16A 1XEZA 5KFBA 2MY8A 5K1YA 1NSKL 1HNWJ 2W57A 4XQFA 1MMSA 2HEKA 2CJKA 1NHVA 1GX5A 4NLXA 2JEJA 2EIKH 3I53A 2GAUA 2PJPA 2ICWG 1C4CA 3DRYA 3OL3A 1PC4A 4RWWA 1O8BA 2IAIA 2XB5A 2QYOA 2LLKA 3PQJA 2Y8WA 4ECUA 1X31C 5FO5A 4N9HA 5KG7A 5J2PA 3GFIA 3JSMA 4M1KA 4KIGA 3RRKA 4NXMF 1CEZA 3IH3A 2YX1A 2R3SA 3AJ2A 5HMZA 4RNHA 3CD6I 2DGSA 3AAFA 1NZAA 2F63A 2GJFA 4USKA 1F2GA 4DN0A 3BGRA 1UHWA 2EG2A 4U96A 2MC3A 3BROA 3HJEA 4PGHA 1LUJB 4DJBA 2WSFC 4X65J 2MZTA 2A18A 3DRSB 3QRPA 3TUJC 3PR5B 2JT1A 3PW7A 2DPIA 4DW6A 3ZQGA 3DPLC 3QQAA 3AG3H 5E8GA 3IXQA 1FK9B 2IMWP 3GIRA 3CDAA 1R4NB 3CCZA 2LTPA 3MD1A 2CGPA 4WCGA 4E7JA 2OH2A 2J7WA 4O3PA 4CT8A 5L3BA 2C2MB 4PJNA 3OIQA 4UOHA 1F0XA 2G0IA 1GUUA 2ALZA 2Z33A 1HSJA 1HNWF 2LQJA 1TT5B 3RQIA 1REVB 1NKCA 4RNFA 3JSBA 2P8TA 1WH7A 2ZXHA 2HHHJ 1P9YA 3DYAB 3UN5A 4DIQA 1NM2A 4LIVA 4MFEA 2UXDF 4DYQA 4OZ3A 1RT5A 3MEGB 2NXUA 2DRBA 1N25A 4IFYB 1JLGB 1IW7F 2KH9A 3ZTPA 4DV5J 2Q1ZB 3ABTA 1NZ8A 3D66A 2HNZA 2Y48A 3BBCA 1Z4UA 1YJNI 2QLZA 5HO4A 1ZYQA 1QQIA 2A3SA 1CC7A 2Y0MA 1K79A 1ZRFA 2LDIA 3EJMA 4DSJA 3KEOA 3QYEA 2AZ1A 1B4AA 3DWLE 4Q2MA 5DETA 1TKTB 5CXTA 3L00A 1KTQA 2DA4A 1NKEA 4M3GA 4ENOA 1YQHA 1RT2A 4OV1A 3T5KA 4XOTA 2NPFA 4NC7A 2CZVC 1UPPA 2O0YA 4ZDPA 2OMLA 4BCAA 1MMLA 1UW4A 1Z7UA 1PJ7A 3PRVA 3F8BA 5EX0A 2C2DA 3CJNA 3LL7A 3M6UA 2FHMA 1KQKA 2DTZA 4BBSJ 1WSVA 4OIRF 4CLLA 1B7YB 2W4SA 1XK8A 4ZVGA 2MHEA 1GVDA 1S6PB 1BI1A 3CP2A 5EWFA 3KKFA 3CMAS 3DOKA 1RA6A 1Y1VJ 4KHMA 4S04A 4U95A 3ML6A 4Y17A 1RKIA 3PL8A 1FOWA 3HSDA 1JHHA 2W1OA 1ROFA 2IAJA 1T9WA 3VTIA 2EBGA 2VPWB 3TW0A 1TFYA 5I42A 4KY3A 3M30B 2PX9A 1YJVA 3OJUA 2V6EA 2IBDA 3S93A 3IWNC 3SXLA 1FDDA 1XWLA 4XSXF 4G7HF 2OHDA 2XPUA 5K8MA 3DU5A 2LP4A 1FCAA 2DXFA 5CVJA 3MAQA 3HULA 1F2HA 3BGFA 3RW6A 4BY1J 5IP9J 3N0VA 4TU9A 4ESFA 3ZMVA 3N05A 2ILYA 1JMTA 2YXLA 5IS2A 1A6LA 3R3TA 3NWGA 4ZCKA 4X4TA 1U5TB 1RUOA 4S05A 2Q79A 1DJ0A 3SDBA 1FDBA 5EN1A 2VBYA 3PYDA 4ECRA 2Z8QA 4H54A 3MUVP 1KKHA 3SV3A 3A0BC 4A3CJ 2MZJA 4RAZA 4E8UA 2MKKA 1MKMA 1QPMA 1VF9A 5KFSA 1KLNA 4I7HA 2AJ0A 2I1RA 3UFCX 4BS2A 2XPWA 2IA1A 3OOPA 4UQTA 2GC8A 4DR6J 2FUG2 3DTEA 5FJ4A 5FLXY 2ZKUA 2K9MA 2ZJQQ 2L7ZA 4G1PA 2GHWA 5E33A 3T9ZA 3R5BA 5D6FA 2BE5F 1MWYA 2HVZA 2AKWB 2KYXA 5KFQA 2D3ZA 4D7MA 2HYFA 2JA6J 2VL1A 2OMOA 3NCQA 3PM1A 3BDEA 3FQLA 4BLGA 3PVXA 3L2VA 2PBIA 3FBCA 1VQ9I 3HSJA 4A12A 4NOHA 1JWWA 1GV5A 4LB6B 4ETZA 2LMDA 1VQ6I 1V3RA 2UVVA 2BUNA 2UU9J 2QQ8A 2DMPA 4KISA 3QQCD 2B4VA 4UV9A 1ON1A 4F92B 1D9AA 1JUMA 1RCXB 1QVTA 4LBIA 2DH7A 1U47A 2NVYJ 2IGKA 2HXIA 2ZSIB 2NVUB 4TY9A 4URSA 3DHWC 2OPTA 2HTJA 3A3NB 4M3BA 3KK3A 2XNRA 1L5UA 2R7RA 2BMBA 4HV5A 1HW9A 3POTA 2VPXB 4DL6A 1UEUA 4KFBA 3Q8RB 1RHRB 4P10A 5K14B 5D3GA 2VJ5A 3C46A 4R8UB 2G7UA 4B9SA 3OMYA 2GNKA 5TISC 2GA7A 5DCFA 1O0PA 3RAMA 1QJHA 2L3DA 2QQ9A 4DR6F 2EZKA 2A10A 3ZZTA 1JLQA 3PRBA 3TZZA 2UUBF 2GIFA 2O3FA 3ILJA 1SD5A 2MZRA 3QLHA 3RRHA 3QP6A 3I3LA 5JI6A 4F67A 4AT1B 5J2NA 4W4MA 4IHVA 3DLGA 1S3JA 4C8OA 5IC4B 3R2DJ 2WWYA 5DCMA 1J5YA 3HHKA 2GCFA 2M7AA 5KNLA 4L9TA 1Z3YA 1F9EB 4QWBA 5IT9K 3TKYA 2WVDA 5KFYA 2VUGA 3RBXA 5LRRA 2YNFA 5EUHA 4ZDOA 2UV8G 4XAKA 1MBHA 2Y2ZA 3QODA 5LXYA 2IGMA 1BIBA 1RIOH 4LITA 3T5XA 2CJXB 1FC3A 4Y34A 4BDYA 1FWPA 3W64A 2UV1A 5DYMA 3PYGA 3FXKA 2HS0A 3HSRA 4FE4A 5FKNA 4YIIA 3LSJA 3MPYA 5ICEA 4PUOB 1FX7A 3HZJA 1KOOA 1SJ4P 4IRGA 3D1OA 2DHHA 5DQGA 4DQRA 3K4NA 2VL8A 2KB2A 3PZPA 1TKZA 3NARA 2BANA 3ENAA 5HJYA 2E1PA 4B8XA 2VODA 2I2YA 4UY8T 4NASA 1Q16B 3NP5A 2RREA 3BR0A 4KPYA 2GOXB 4AIKA 1VQ5S 2DYRH 1Z77A 2GMLA 3I64A 4X66J 2IVFB 3CMYA 1USSA 2XF5A 3FEYB 5HBMB 3ILLA 4ZHRB 4YFUA 4RWXA 2UV8A 4KAIA 5DZ6A 1NBEB 2H5IB 2FY1A 1T38A 2R3VA 3C15B 1I1SA 4Y2AA 3KTQA 4G1QB 1WH5A 1IWGA 2VG6A 1YW9A 5F0CA 6FDRA 1LKZA 2JVRA 2D74B 1URNA 2B5JA 3GFHA 1VBYA 4L73A 4XLEA 1HLWA 1XSVA 3RPUD 3AD7C 3NAUA 2ZH7A 1XMXA 2XGQA 1KVIA 1S7HA 3GV7B 5AIQA 4E7LA 1S7IA 2MZQA 2ID3A 2NNNA 3OR2A 4E7SA 5LMNJ 2A2CA 5EHHA 1FYKA 1XCBA 3H1CA 5A0YA 1WEXA 1VRQC 1MIJA 3GTPJ 2QL7B 1KYZA 1EARA 1YW7A 3MEEB 2CJAA 4M8LA 3BGOP 2H27A 3TDZC 3IKVA 3GIJA 3CCQS 2QA2A 2F5DA 1DUXC 3FJ2A 1R6VA 2RE1A 1IZ1A 2AJ2A 4FKYA 4BAYA 3F56A 4PGGA 5KFZA 1MZBA 3RZDJ 3LGMA 1IRXA 3W6VA 1K6OA 5EEHA 2Q6CA 3MKLA 3ZN1A 3SJMA 4R5PA 5A6PA 3PNTA 2YH0A 3QGIA 5D5VB 2DT6A 4X66F 2Z2ZA 1TWFJ 4KR0B 3RAXA 3NGKA 4F8RA 1RHJB 2JRSA 4URQU 2F8EX 5F6FA 4F52A 3ITHA 1KSPA 4I0WA 5C24A 2W85A 1S0NA 5M5YJ 4WK3A 3V6DA 3DEUA 4NYOA 4ELTA 1KU3A 3E6MA 3QIPA 2L01A 1VQLS 3NWSA 4U88A 1S77D 1XR6A 3TX0A 1B7FA 4NLTA 4LF1A 1PP8F 3I32A 4R79A 2JK3A 4PEOA 4LLLA 3EGWB 4BQNA 4JI5F 3LF0A 1D1BA 2E2IJ 2QYCA 4RU9A 1FOYA 2EPFA 2WONB 2B8QA 2AZ3A 1K4TA 5CHCB 1ZGJA 4MEXF 4Y3OA 4Y0FA 2IM3A 1SVLA 2DNKA 4OZJA 1U48A 2CW8A 4JI3J 4W98A 2RHQB 1IDYA 2BVMA 5CKTA 4B17A 1I6HJ 2QSFX 2W84A 4XMYA 2HHPA 2RQ4A 3MI7X 4OI4A 2AMCB 2CDQA 1LWFB 2ZBKA 1X9MA 3HZGA 4ZDLA 3H5SA 2M9HA 2C6YA 3WX8A 5E1WA 2DOAA 1LFWA 2DYSH 2YUSA 1JT6A 3GLXA 1RHKB 2DRAA 1K73T 2EG1A 2IA6A 2ZFUA 3QSYB 4A3EJ 2RMLA 2W9AA 2JSCA 4NLSA 2LEBA 4Y4RA 3QRRA 1RT1B 1GMVA 2R7WA 1TUVA 3D0IE 3N6LA 2OTLI 5B0GA 1V6HA 3W66A 3VAGA 3M9AA 3M9NB 2I5UA 5B08A 4NEZA 3PTWA 1SKSA 2HQRA 5C4JJ 2WVBA 1SJ1A 2A6HF 1LEOA 4HTIA 2BE2B 1OCCH 2O8KA 2H51B 5CYQB 4RW7A 3OVAA 2OD4A 3S17J 3R6SA 5F8MA 1KQ8A 2CQIA 4FZVA 2DPDA 5LL6d 3QGHA 3GFLA 4DX8H 5TJJA 1WFXA 4P96A 4BDPA 4UVCA 2QQAA 3ZXWA 5BR8F 1IQZA 1BQNA 1KOHA 1FEHA 1JT0A 4DV6J 1ZYRF 1XNRJ 3EGNA 1IQTA 3UVJB 1JJ2R 4XKWA 3GTKJ 4X64F 3T5HA 4H4MA 4N77A 3T5JA 1PYSB 2YWFA 5ETRA 4PWDB 2BQ3A 3KLIA 4B02A 5KOXA 2LK2A 1ZM4A 2CNOB 2ZFWA 1DPUA 2CFXA 3P3DA 2DMNA 2H4WB 1WZ2A 2WB4A 3KUGA 2N3LA 2VQLA 4WIIA 2B56A 2R7OA 2KJBA 3QU6A 4I2OA 5IYCJ 3MM6A 2OP5A 4LG0A 3R1LA 1G3WA 4M5LA 2X1DA 2MB0B 3A4CA 4BU2A 2LVWA 4PQUB 3N6NA 5D0GA 4RDUA 2FVSA 2OSQA 2L3MA 1W25A 1VBXA 3ISPA 3FMBA 3KK1B 2VZ9A 1H8AC 2AGOA 3Q5FA 1ETVA 4DOZA 1U78A 2E5HA 4G9YA 4OZ1A 5B1AH 5DJBA 4BEHB 3W3CA 2L0KA 3PR4A 4JYAF 1J5OA 2XSJB 2EEYA 1FRIA 3JRIA 2YWKA 4DR7F 2LFVA 1YI2I 3W2VA 3M8PA 2B6AB 4HNVA 3DLBA 4BBRJ 3JAMZ 2H5EA 4WTOB 2Y31A 4B08A 2J6SA 4NQWA 4MIAA 3D1HA 2VJVA 3BC8A 3F0NA 3OW2R 1J2XA 2UUZA 1DTTB 4OJ1A 3PX4A 3IRQA 5DM7F 1UZDA 4USUA 1IGNA 2GXBA 3V7SA 5GAGJ 3AOBA 3K4LA 4A8SA 4P2MA 1VC5A 3K89A 3BG7A 2DNRA 4ZPVR 4B3TF 3R2CJ 1QE1B 5F27A 3RI4A 4LT6A 1RAOA 2P6TA 5CD4A 5ETPA 1R22A 2YKMB 3C16A 3K1MA 4M72A 3CW2C 3EVWA 2VQHA 2P7VB 4F91B 3CCEI 2NOJB 4PUSA 1WHXA 2ZC3A 3I4NJ 2R5ZB 1RESA 1ZETA 4C30A 3FISA 5FRMA 2K3IA 4XNFA 2XY6A 3G82B 4M5KA 4ASNA 4OJGA 4D3HA 4CLPA 1TL3A 2JA7J 1D3WA 3IRRA 2OUMA 5E17F 5J1NA 1S6OA 3VALA 2EQRA 3ZZRA 5DEQA 3GCMA 1TKXB 1ONVA 1X4AA 2X1FA 1NH7A 2JH3A 5F08A 3E3XA 4HAMA 4A2UA 3UNYA 2DN0A 1VDHA 3QYBA 4B4CA 1K78A 3HMJG 5KFDA 1ZRCA 2QEXS 1H9TA 2EZIA 1L3KA 1F60B 1Y5NB 3MTJA 5LM7E 2K9NA 4A0ZA 1H0HB 4RLQA 2AEJA 1WHUA 1QAYA 5D15A 4IQXA 4P6QA 2AHOB 1ZGWA 4ZIWA 1WJFA 4R0JA 3T6JA 4PFPA 3DKDA 4ZVHA 3O8GA 3CC7S 3VGUA 4S0MA 3JW4A 3OBIA 3GFMA 4CCJA 2F9DA 2PT0A 2UXCF 2RF2A 2XSFA 1TTYA 2YNHA 2NS8A 2F3JA 3IP0A 5GAHJ 2F5FA 4XDDA 4RNMA 3HRMA 3CMAI 4PYAA 4AE5A 4NMLA 2MDAA 4X4SA 3FIWA 2W4CA 3B8HA 1U1LA 3BH7B 1HQCA 2K7KA 4AL5A 1OR7C 4C11A 5AXNA 4TV7A 4NNJA 3HOUJ 3IWLA 3ZQFA 3GQCA 2IT0A 4DUZF 1S57A 2Y9YA 5L3EA 2K85A 5IV4A 3C6UB 4FTHA 2E2HJ 5KAIC 2M8GX 1H89C 3DC2A 2AW0A 3EGZA 2AXLA 1U6BA 3I4PA 3G71I 2CQXA 1V3ZA 3SDGA 3BR1A 4M6XA 5GADI 4G6VB 3KJVB 2E5GA 4USVA 2QCOA 1Y10A 1PYOB 4HF0A 5IV3A 1B9NA 1S1VA 2GQ2A 3S2DJ 1JLBB 4DV2J 2DODA 1MNEA 1SH0A 2XWXA 2I9SA 3MOJB 2KPMA 1PJ6A 3ICLA 3TZWA 1NK9A 4HH0A 1XMKA 3EXCX 4L6V3 5GVQA 3SYTA 1O3TA 4U7UD 4DS5A 4F25A 1AZSB 1KTVA 2PE8A 1Y00A 2HS3A 2ZDOA 4WJBA 3A01B 4LRFA 1FE0A 3P5JA 3M4OJ 1RTIA 3HVRA 1DY3A 4ED6A 3DLEA 1D1UA 2JJ7A 5GAHI 3M8EA 3TGNA 3RUBL 4L9JA 1NNDA 2IM1A 2QSFA 2D1CA 3CUOA 5LJ3Y 4A0YA 2A6TA 4ZP7A 5E8IA 1SKWA 1KQ9A 3CJTB 1GXPA 1VRUA 3M8RA 2A2DA 1PSDA 4U7CA 2W9BA 4C8MA 2VDHA 3TO7A 3WE2A 4YR3A 3PM9A 1G7CB 4C3HJ 4NLQA 1Y3KA 3THVA 4IG0B 9RUBA 1ZR2A 2AEMA 1EH8A 3PNIA 4LSNB 4F7VA 1RZMA 5HNHA 4U7UK 2F5GA 2NPIA 2M3DA 3X1LB 2FJXA 2IYIA 3KWMA 2QIFA 6FD1A 3BDDA 1MBJA 1JJHA 2D9PA 1F9NA 3LWMA 1F43A 4QPOA 5FIIA 1MN9A 4EO8A 3VAFA 3NCRA 2LF8A 1T6SA 4WTYA 3IH2A 4H4KC 3SCJE 4OHYA 1FTCA 1Q7YT 1AWCA 1RTJB 2C2KB 2D5VA 3QFHA 2BY0A 3CJRA 2X6WA 4OZLA 1S1UB 1CG2A 1M5KC 1SH2A 4ZJLA 5CQEA 3WE3A 2LXFA 4NCGB 4LR9A 2OU2A 4P74A 5JXSA 4DL3A 2JZYA 2HYIB 3E51A 4RJVA 1QHGA 3S16J 5AXLA 2V94A 1NEEA 5HDKA 4WF9Q 1Z91A 5JVTA 2HZAA 3BR9A 2EZHA 4LRBA 2ZC4A 2GVZB 2EXUA 2EIMH 1SJRA 5F04A 2FOKA 2ZDPA 3NGUA 3PJ9A 4CYUA 3FGVA 1LVAA 3FKBA 4FF2A 1R6YA 1U1KA 2X1GA 2IA0A 2XO6A 5LJ5Y 5KFJA 4KC5A 2EK6A 1J5EF 3HVTA 4B3OB 2WY7Q 2JVOA 2EH3A 4WZQA 3Q8VA 2QL9B 2DR8A 3SCKE 4QJVA 1RXOB 3HOSA 3GR0A 4WFYA 3SZ2A 4LQ9A 3AAWB 1SL1A 2E5LF 1W0TA 2UUCJ 4AD9A 3T5LA 1MBFA 4CDIA 4Z7CA 1CJKA 1A5JA 1NK5A 1GXLA 2DJNA 1HW5A 2BOLA 1MJBA 3MZHA 5F0WA 4A8YA 1G2EA 3TO9A 1QD1A 3CVKA 4KKOA 1FFWB 1T39A 2QJ3A 3RB6A 1P7JA 2C2OB 3NMRA 2HDDA 2PMHA 3PX0A 5EZHA 3IH4A 1N5VA 5KFAA 4M94A 1VLYA 4FF1A 3CJQB 1KA8A 2ZHBA 5J4YA 1D5VA 1R1VA 2P9GA 3U9GA 2KFZA 3JRDA 5GAEU 5LGUA 1RT3B 2CQ4A 3Q23A 2E1OA 3K7RA 3DPTA 4F0HA 4XIDA 2DR5A 4HX8A 1B3TA 2D7SA 4PDKA 1HDDC 1R8PA 3KK2A 3LSGA 3W7BA 1G6BA 2L9VA 4O6JA 4TY8B 3M2UB 2R2UA 2CH0A 1IV8A 2QC3A 3GJRB 1CF7A 5KG0A 1YBUA 3UNGC 1YRTA 2XMKA 2XZWA 2VKRA 2DITA 3RG6A 4LF9J 1U45A 2ZHOA 4D9JA 1LOUA 2ZHAA 3I87A 3FXRA 2KFYA 1V5EA 2R7UA 3SZGA 1RWMB 4GCVA 3MWMA 4ZJQA 1U1OA 4RLEA 2FDNA 4IG3A 3W63A 1ZZFA 1EIYB 1MMGA 3CLOA 2ZZTA 1X4FA 2H8RA 1B72A 3U1MA 1RZ4A 1RNLA 4LFBF 5HLFB 3O6QA 3FZVA 5H20A 4A8OA 4EEYA 4Z7YA 1TTHB 3CCQI 5D0RA 3KDOA 5KFFA 4XONA 3H36A 4QSHA 2RHSB 3G6VA 4JX4A 2XRNA 1F3FA 2CU7A 1ZA2B 2R7VA 4G6TB 4MIWA 3MVPA 1R71A 4KH1B 3J81Z 3K2ZA 3OL4A 2BR0A 1BY9A 3WBZA 3W60A 1E6YB 2CPHA 1AHDP 2DI3A 1EJ7L 2MLXA 2DNOA 2A6OA 2APOA 1B8IB 4FISA 4QW9A 1OQYA 3THTA 2KIMA 1TMMA 4ZZDA 3U27A 4DFKA 5FKKA 2FJAB 2WW4A 2RGVA 4FETA 3PSIA 1G4CA 3KLHB 2JFDA 5IWAF 1VQLI 2OD5A 4NCBA 2CQ2A 2YKOA 4PWUA 3DOMB 1EB0A 2ZOGA 4ETSA 3MWBA 2ELHA 2OQRA 1D09B 3FKJA 4ZVRB 1U2RA 1Y7PA 2FGCA 2A68F 4C98A 1C1CA 2VICA 1JLCB 1GT8A 3M32B 2Y9HA 3ELHA 2LP0A 1T0FA 4RBOA 1FLIA 2GJ2A 3FZBA 4PG5A 1NK7A 2MQLA 1DP3A 4GKJF 5J6XA 5HP1B 1Z2LA 3M4XA 1MSWD 3WDOA 3KEYA 2CWEA 3DLKA 4AWXB 4XKCA 4B3MF 4GRIA 5AE3A 4P2FA 2GWRA 2R8IA 2MD5A 1UHMA 1OCTC 3BPXA 4L5JA 3HVWA 4C8YA 2NXCA 3JRBA 3H9JA 3OFGA 3GFJA 5J2PB 2LECA 3JSMB 4NX9A 4NLPA 1RAFB 2F1FA 1XG1A 1CJTA 2HK3A 1O57A 3MCOA 3T41A 4DNCA 2D1HA 2DA7A 1XJWB 3I6PA 3P7NA 3BGRB 5B66C 4V19X 4OYIA 3ISND 2DH8A 1MSEC 2RJZA 2VQCA 1Y6IA 2OPSA 2ZD1A 3CD7A 1B6AA 1TLHB 4LSLA 5LBQA 2HW3A 1U1PA 5D6GA 9ANTA 2L54A 2MQPA 1E0EA 3A1YG 4KN7X 5AE2A 4O3MA 4HQEA 1H9GA 2ZNYA 4DV1F 5CYVA 1MU2A 2K2PA 5KG5A 2NXNA 3OPKA 4UTGA 1VQMS 3ROUA 1YE9A 3NKYA 2V67A 1R8BA 4C97A 2Z0GA 2ZZMA 2DLLA 3UQSA 3LOCA 3JQKA 3RCOA 4RUBA 5FDLA 4KN4X 4XK4A 2BM0A 5A8RA 2LXIA 3DV8A 2DNHA 1WG5A 4OHWA 1WC0A 4ES1A 5IYDJ 1FKPA 3TP0A 1RT5B 3GCWP 4RB3C 2Y0SD 4Q44A 2C1EB 4XN3A 2MSYA 4J9VA 2HWVA 2H9ZA 3GFZA 1S7EA 1GMWD 1Y0UA 4MGRA 2B9EA 2HNZB 5KFEA 4X6AJ 1DU0A 5FFXA 2ID6A 4K4XA 4WYWA 3A1YA 2HHQA 3ZQHA 3FKIJ 3RKQA 1FXRA 1SC4B 4L74A 2GO8A 5M2UA 4DZJA 4B44A 5DM7Q 3OFHA 3T9NA 1OCPA 1ZS6A 2H6CA 3D6MB 2IJRA 2DH9A 1HW1A 3F72A 1R1UA 2JA8J 3FK7A 2XSDC 4C8KA 1RT2B 1XS9A 1A31A 3PNVA 3ZQQA 1WEZA 2CQ3A 4YHHJ 2QMUB 1TR0A 5FROA 4HDUA 3H5NA 1GLNA 4KDPA 3GILA 2V8DA 3HD1A 3ET6A 2AYBA 2CNLB 5A2QU 2F4MB 2ROEA 2ME6A 4FBTA 1YRUA 1RWVB 3DOKB 3CIMA 4AL6A 3GSDA 1HCRA 1UFWA 1JNRB 2M4GA 1TAQA 4ZVSB 1QVUA 3BZ6A 2IAJB 2BJEA 5I42B 4K0KJ 1YWXA 3MGJA 3F6VA 1YS7A 1H74A 3FMWA 1S0MA 4L3KA 3NY0A 2XKPA 1S0OA 4BY7J 3M9OB 4LF7F 2BJ7A 3CJ3A 5HSPA 2BW3A 2IPQX 1SV5A 1Y8QB 2HQNA 4GC7A 5LT5A 1NTCA 2EBIA 3OHBA 1IBCB 2DDBA 2FEZA 5IXUA 3V42A 1U26A 2XDVA 1RR7A 1JJ8C 1V3FA 2WB1A 2H94A 4ECVA 2FE3A 2QGFB 3BKTA 2V9PA 4HX7A 2NR0A 1VIXA 4EGLA 1RYSA 2MBFA 2W1BA 3JAMK 4QYRA 2TRTA 3G1OA 1ZN2A 4W92B 1W36D 3B6CA 3HSEA 2KRRA 2CQ7A 2EW9A 1YKWA 1S1TA 4FQGA 1J27A 1T0TV 4MFDA 1RUSA 2LBFA 3E0JB 5DM6Q 3I55S 2KZVA 5DD8A 5J1RA 2WADA 2W24A 4YY3F 1VFJA 2RS8A 2GMHA 5KFHA 2MTLA 2OGUA 1RLCL 4IHWA 2VD3A 3O44A 4A69C 2Y30A 1HBNA 1MROA 2CPIA 1W5CC 2OPRA 3KXDA 5K8PA 4CYCA 4ERDA 4X4NA 2MMYA 3UR3C 4Q45A 2K1RA 3MPWA 8ATCB 1VI0A 3VZIA 4X4UA 2LVSA 2B3TB 5HOOA 2XC9A 2F9JA 2M52A 2VE8A 1FE4A 2B4PA 2RUGA 2RDPA 4IHTA 1RTDA 3NQOA 1N6QA 2PGCA 3RKYA 2OJED 1NK8A 1N5SA 3MZYA 4OYWA 5HVGA 1ETXA 4WFXA 4ED2A 1DRZA 3BR6A 4ZP6A 1FY7A 5D4OA 4B3RJ 4YRVA 1UJ6A 1G8XA 3IMQJ 3GFYA 3KUHA 4P9UA 4K4WA 5DLGA 1PGZA 2VJIA 1VQ7S 3R5DA 3OUYA 3KK3B 1H7WA 3DLHA 3Q86A 2XMUA 2MGQA 1SKUB 4LF5F 1CULA 2DNNA 3POTB 3AG2H 4KFBB 3G4SS 2R5YA 2JEIA 5D3GB 4J19A 4O3SA 2CWXA 1RWPB 2DYAA 2YWWA 1CGPA 1CLFA 4ZS6A 1F5TA 2VBZA 1T2KA 3EUHA 5LHHA 4XRMA 4U0WA 1X1AA 4RNOA 2X0LA 4CLFA 2PEHA 3QLHB 3Q8YA 3F8NA 1N33F 2UUAJ 1WTFA 4MTEA 5J2NB 3D4JA 3DLGB 3BR8A 1U1QA 3OR1A 3CCJI 3TVKA 5DCMB 2V8PA 4DPOA 1UMJA 2HIYA 3IS9A 4JI2F 3HOVJ 1NJYA 1NHKL 4N7TA 2N7CA 1U9OA 2J6TA 2YNFB 4IFVA 4ECZA 1UAWA 1Q5VA 3NNAA 2N82B 3BSOA 4DQIA 1RAAB 2CPZA 1FD2A 5SUHA 5L1JA 4GDFA 3B54A 1BI3A 4EM0B 3I71A 2D1VA 1MBKA 1QGPA 4Q5SF 1UG0A 4WFZA 5U47A 2XMMA 4DFMA 5BQTA 1QBJA 1WDDA 3ZXSA 5JLWA 4AXJA 4QR1A 1X2MA 3C3LA 2CO5A 4I4BA 4Y65A 1L3TA 1HI8A 3R1HA 1VI7A 1RI7A 1N54B 4YR0A 1YJWS 4A3LJ 3CDWA 4TU7A 4C7QA 1TKZB 2BANB 2PIIA 3KG4A 3M8SA 3WTYC 3MFKA 1UW9A 4J91A 2ZUGA 4V19J 4D0PA 2LY1A 2RKIA 2IS4A 2MJNA 2FSWA 2IEKA 4CNZA 3P9KA 4EJVA 1LDJA 1C4AA 5EF6A 1RABB 1OQ3A 3KP6A 3D2WA 2OAZA 4N56A 4DSKA 2EV5A 2XBPA 2FIUA 4OX9F 5C2GA 2DB1A 2FNPA 4ZCIA 3LA2A 2VG6B 2R4FA 1P4AA 1BIAA 3BN7A 3JXOA 1MDMA 2HTSA 2B5JB 3TEHB 1NHUA 3S8PA 3W65A 4XTTA 1FRMA 3FSIA 4M3EA 3S1MJ 3PIOQ 1LQ1A 4LF8F 4Z2YA 4DSEA 1ZLKA 4C3JJ 2PDAA 1WGXA 3S15J 2ZZNA 3I54A 2DEIA 1RTZA 3DLLF 3OR2B 4KSEB 4RBVA 1D0YA 3P5BP 4RB1A 2AYGA 5J3LA 2GJIA 4Y28C 5A0YB 3Q24A 2AQ4A 2WVCA 2I8DA 3HX9A 3T6BA 1EX8A 1WI8A 5M2PA 1REPC 5LD2C 4FCYA 1D8JA 3WG7H 3RTRA 1ACIA 4MKBA 5J8FA 3C2HA 3J7ZT 3N01A 2FJVA 5HK4A 1WC4A 1N4LA 2MH2A 2EWNA 2HVIA 3RW7A 2VOOA 1N0VC 1FX2A 3F8MA 3IHUA 1DGRM 3OL8A 2XGXA 2UWMA 1V5IB 3M8QA 4UQGA 2YWGA 1XMOJ 2DKOB 3PW5A 5DUKA 1T98A 4R5PB 1JQGA 1HBXG 1XD7A 4F4XA 1TAUA 3K4CA 4YB6A 4B48A 1T9TA 1DPRA 4C3KA 4CCMA 1S72I 3ITHB 5FLMJ 5B0DA 1YW8A 2YX4A 5C24B 3A3PB 2HPUA 2M5WA 2L2OA 2LA4A 4I7FA 2QMXA 1USTA 5G0RA 3EUHC 3QIPB 2PMWA 1UJ4A 3KOAA 3TR5A 4XRFA 3ZZ0A 3H20A 2GA1A 2H54B 4WZMA 3H40A 4QLCU 2X1EA 1DP7P 4P7VA 1RKJA 5D4NA 2XNQA 1OYEA 4DYCA 2CMPA 2Z99A 1WTBA 2EBEA 4IRHA 3HRUA 1JXSA 4DEZA 1IUFA 3HBLA 4P71A 1ZKGA 1YDLA 4LUBA 3R61A 4HH1A 1XMQJ 4ATNA 3J7AN 2ZB9A 4O44A 4HV6A 1TUGB 3EGVA 3E01A 4JV1A 4JBCA 2JVHA 1SFOJ 2JWTA 1TV6A 2L9WA 3RBZA 2POKA 5EZGA 2DHGA 2L48A 3WIUA 2JJ4D 3W3SA 1LB2A 3C8YA 2XLJA 3NOGA 1QRYA 3D54A 3KJFB 5D77A 4B3SJ 3DMJA 1U8RA 4OV6A 2ZH3A 5DUIA 1OFCX 4ZP8A 2DMQA 1NDKA 2VT3A 4IO1A 1ZTTA 4KHPF 3C6TA 3D5MA 3S2HJ 2JNJA 3ZTQA 3MR6A 4XLCA 1BMQB 5BPDA 1NKBA 2Y0SA 3P9CA 1SFXA 5B0EA 2IFXA 3MEDA 4CH1A 1GMWA 1BJZA 3KHRA 2YKQA 4G6DA 1N32J 2Y0SN 1D0ZA 3CCRS 4EATA 1G6NA 4FVCA 4ZPDA 4RW7B 4E98A 5L3CA 4CYDA 1IXRC 3R5JB 3CCSS 2I38A 2DGOA 2JHEA 3L2WA 2F2EA 2FQ3A 2LKPA 3EPZA 3HHLA 3PW2A 3EDRB 1LFUP 1X0FA 3BDPA 2KVIA 5J8CA 2DFIA 3TA1A 5AXKA 2RS2A 4W97A 3LPEA 2A05A 3D5RC 2X7IA 1BQNB 4A93J 1SMTA 2VG7A 3RB4A 4DSLA 3OIOA 4M6YA 2HGCA 4WP8A 3W2WA 1AA1B 1NAQA 4H4MB 2DQRA 2OSRA 4IYQA 4ER8A 2CKWA 4ZYAA 2VJJA 4N8NA 3KLIB 4DJAA 2Z5UA 2M9KA 4Y2CA 1Y5LB 3C66A 2VB6A 3IR7B 3VGVA 1DZ5A 4EMDA 3V7CA 2RQMA 3SSSA 2CYYA 1ZR4A 2PN6A 5CAAA 4WWCA 4Z37A 3DXJF 3RPQA 2J9DE 2XTJP 2F8HA 3MM6B 3EX7B 3OYGA 4LG0B 4XORA 2GQCA 3H59A 1C0TA 1SUQA 2ZJRF 1LNQA 2RRNA 2F5EA 4DL2A 3A12A 5E3QA 1RQ0A 4F3QA 5GTIC 2ADBA 2FZGB 1X0PA 3SHFA 4ED0A 4K2EA 3HDDA 2ATCB 1JB0C 3J7AO 2WAQA 3T1AA 2CQKA 1UEVA 1IKWA 2D2WA 1J5OB 3G1LA 3PFIA 3F44A 3G8TA 1T94A 4F4ZA 1GMUA 4RLFA 3M8PB 3W2VB 3HSFA 1WF2A 5AJ3F 3CD6S 2CJJA 3GTQJ 3T1HJ 4IHXA 2GO9A 4X84A 4OWRB 5K7FA 1KU7A 4AC0A 3DDNA 2ACJA 4IRIA 3GZNB 5K5MA 3PRDA 3ZZYA 1R0BG 4RM3A 4A8MP 3BSAA 4NQWB 2N8GA 1S12A 5JR3A 2IHR1 1U24A 3QGPA 1LK5A 1DQ9A 3ABMH 2C2RA 1LFBA 4CLWA 2N7YA 4DQ2A 3HF5A 1FSHA 2VQFJ 5F8JA 3CMMA 2ROGA 3W6KB 3CD5A 2HMIA 4YFKF 2XWYA 4NPOA 3F6OA 3QJJA 2CS3A 2XGPA 4QPXA 2G7HA 4YIFA 5M5WJ 4FBUA 3E5QA 3M2RA 3FDYA 3GYNA 3LP2A 4BWMA 4EV0A 3C16B 4QW8A 1O3QA 4ECXA 2HFNA 1N0UA 3WZ0A 1W7PD 3CWJA 4HF1A 1FRJA 1N34J 2XAHA 2PI0A 3R7SB 2VKZG 2RC4A 4J9OA 1TL3B 2B43A 1UHSA 3BBBA 1LJ9A 2PMZD 2KT0A 1SC3B 1LWEA 3KJNB 1ZK8A 2F65A 4DUYF 4OIPF 3O8WA 1FJEB 3GLJA 1ITYA 1Q1VA 2AD9A 2KIUA 1K78B 2XY7A 1I94J 2VOPA 4UW2A 5RUBA 1SD4A 2QLWA 4HHJA 1YJNS 5L3GA 3KMSA 4ZN3A 1CC8A 1H73A 4JB8B 2DCEA 1TK8A 3LP1B 4PG8A 1JGGA 3PFYA 2NOGA 3SYZA 4LBPA 5KFPA 4P7TA 4LMYA 3HHLC 2HPIA 4IR9A 1SAUA 1S8NA 3G73A 3A8KA 3PO2J 4KJIA 4Y7NJ 2IRUA 2RF2B 2BQRA 2B7CB 5DDRC 2CADA 3GTJJ 2EINH 2YNHB 4RUHA 4TKTA 3ASOH 4LJMA 3D0SA 1Z9CA 4P52A 4DG1A 5CA5A 4OX8A 2YSRA 3L4BC 2KXNB 2QQBA 4KGMA 1BN5A 3F22A 4ECQA 2KJVA 2XGDA 3UDLA 3OSNA 5F9NA 2CQNA 2IJLA 4HG2A 1T33A 2VE9A 1G1XA 4C11B 1ZREA 3L1PA 1R8CA 3MMCA 4CWBA 1N34F 2V2QA 1MMNA 5B7WA 4UOFA 4UZCA 1BE4A 3Q0WA 1LE8A 4MEYF 4M9ZA 1FNNA 4O0NA 1MLAA 2J7UA 2FXAA 3MR3A 1S49A 2CJ9A 3V7RA 1H0MA 4WCEQ 3K5NA 3DF8A 3JYTA 3ZPLA 1RBAA 2OEJA 1S1VB 2E9ZA 2IIHA 4ITSA 3L7OA 4B9LA 3H3VK 2H48B 3R0AA 2R8GA 4ED4A 5HVQC 1FTZA 2JUCA 3UCGA 1F5AA 5GADU 4CLKA 1IJEB 3MZ8A 4R1HA 5L1KA 3F9KA 4JI4J 1MW7A 3KP4A 1B1BA 2YKNA 4E7ZA 1T9UA 4HQMA 4NMXA 3FQKA 5L9XA 3I55I 2RV8A 5HMXA 1HSTA 1LW2A 3DU6A 1RTIB 4J90A 1HWIA 4N41A 3DLEB 4XRSG 3Q8SB 1XERA 3VHQA 1WHYA 3WX4A 3FC9A 4PPDA 1UELB 1PC5A 2DA6A 1W5SA 4MYTA 3TOBA 5DG9A 3DOLA 1VRUB 3I4MJ 1ERDA 3I9ZA 1HR0F 2W9BB 4K2JA 1T7PA 5GAHU 3GWZA 1OPIA 2X51A 2KN4A 1BW5A 4C6AA 1BOAA 4OMZA 1SB6A 2GBYA 3JSRA 3CP8A 4KQZA 3CDLA 2DNYA 2JVGA 4U9RA 4IO9F 3FBIB 1TWGJ 1K0VA 2L9RA 2MFZA 2GFFA 2UZAA 1WD6A 4R0EA 3HT3A 3R5CA 4AQYJ 3OOUA 1AXQA 1L3LA 3IAS9 1D0EA 5J40A 2Y3YA 3RB3A 1N8RT 3K7AJ 3HXMA 1HYSA 2XAFA 1M90T 4ZIVA 1VQ6S 2DISA 2W7AA 3KLEA 2MGZA 3Q2SC 2ERRA 5B3SH 1VQ7I 3Q8PB 2ZMEA 2FVRA 2C2EA 4I09A 1IRFA 4OZ2A 3D67A 5D4SA 4FPRA 1YHQS 1HC8A 3PG9A 3CJRB 2GLOA 1ZPWX 1JJ6C 5B09A 2CPJA 1AUDA 4DR4F 5K7HA 1BI0A 2DMTA 4NLOA 1SL0A 1K4SA 1T08B 3GZ7A 1JJ4A 3KDNA 2W82A 1WNEA 1K47A 3I0RA 2WW8A 3DLJA 4XM3A 2BE7D 1R49A 3ILOA 2RNJA 2DGQA 5KTQA 4OFZA 1ZH5A 1N36J 4UHTA 2L4AA 4RA2A 3S7RA 3H90A 1R3NA 4HHUA 2V4RA 2HR3A 1OY8A 3K70D 2YWHA 2V68A 3DGPA 4LIRA 4M5DA 2XSJC 4CYUB 4K4YA 3OLAA 3ZTSA 1YS6A 5F8IA 2KT5A 2WBRA 3HVTB 3US5A 1SC1B 5KFUA 4DV7F 1UKUA 3HRSA 3TAMA 3GG1A 4BNCA 1NHAA 3V81A 3T0YA 1FJGF 2VU5A 4CO4A 5KAFC 1CJKB 2Z58B 3W62A 1RU2A 3MKWB 3PUFA 3D9BA 2AT1B 3DM2A 2R7ZJ 4CXFA 4WF2A 4KKOB 1EETA 5IC6B 3SSRA 1DBDA 2CPDA 5TRDA 3BZKA 3MM7A 4CCLA 5L38A 1T95A 4WBFA 1YG0A 2VC0A 2I0XA 2BBYA 1H98A 2KO1A 2HZTA 1NB2A 5IQQA 4N9IA 1JI8A 1FVQA 2HKOA 3GSIA 3VQTA 4M63A 2FBHA 1X1CA 4JI8J 1VIOA 4DCOB 1X19A 2CJQA 4RGUA 1AFJA 2A61A 3R97A 1SC7A 2YVSA 1EH6A 3KK2B 5J4VA 1YJ7A 3IFEA 3PKYA 1N36F 5H9FK 4KIBA 4K2XA 3BJYA 4DV4J 1FWZA 1OS5A 3WGGA 4DR1F 3AG4H 4MK8A 1SVDA 1Q86T 4P72A 3OL6A 3I5AA 1HBUA 4USIA 4A8FA 1CF7B 2BJ8A 1NK0A 4CHUA 1GQEA 1LK7A 2CPFA 2DTJA 1X5TA 3F3XA 3UO0A 2BY1A 1DQAA 1MD0A 3BF4A 3MECA 1BOBA 3IRWP 2J0SD 4HI1A 2XAUA 2IM2A 4DR5J 2E1CA 4IG3B 3I0SA 3HCXA 4A48A 1D9DA 1VLOA 4OU0A 1HQUA 1TQLA 4OYBA 4QPTA 5F1RA 1SFUA 5CZXA 1NMEB 4BKXA 4GYGA 1B72B 2W25A 2ZWOA 3QT6A 2XYPB 1E6VB 3PW4A 4UY85 5F1JA 3BPDA 2UXBF 4FYWB 1GV2A 2ADCA 3WODF 4DDFA 4J9MA 1MJ9A 2P0WA 1K44A 2M7SA 4NYZA 3KP2A 2DDAA 1I5ZA 3MMAA 1EP4A 1ACMB 1R8AA 2G0CA 4QIEA 3QPTA 4BYYA 1O5JA 2IGOA 1NH3A 4AFFA 2EILH 5C4XJ 1NJZA 5KFGA 1BA5A 3H2UB 2XV4S 1AU7A 4G1IA 4MK7A 4PPZA 3N5FA 2MHNA 5L3DA 2QSHX 2LEAA 3RB0A 3ZMSA 1WQ2A 4PJ0C 1OY9A 4Q0BA 5T41A 1LNWA 3D3BJ 4RW9A 4L5IA 2CZ9A 1L3VA 2GXAA 1FBQA 2V2VA 5J2QA 1TBXA 3KP7A 1IBLF 2X48A 2M70A 1TW3A 3JCUC 4WK1A 1QLNA 2LOOA 1S1WB 1JKPC 3K5MA 5D6EA 1U6FA 1BR4A 4IX7A 4LR8A 5J1EA 5FLVA 3CPWR 3M8JA 4X62F 1YO5C 1VQ8I 4ZVQB 1S7AA 4LBHA 4XR6A 5HVFA 1CQMA 2LU1A 1WRJA 2I5JA 2HOTA 4WE1A 1R27B 2XKOA 1WKMA 3IR6B 2QX0A 2KT3A 1D8KA 3IUOA 4B47A 1QAJA 4HI2A 3VSLA 1BI2A 1VHIA 3MPVA 2DT5A 1WHVA 2JC0A 4IPAA 3S3MA 2PFDA 4JI7F 3MR7A 5FLXU 2F5CA 2EPIA 2HFHA 3DLKB 3Q22A 1WF0A 3VB2A 2IYGA 3GMGA 3IGNA 4DPYA 3BO3A 1UL3A 1TZLA 3CTAA 1U8WA 4DR2J 4CGZA 5KFXA 3BG6A 1P6RA 4OI6A 1UTAA 2D9OA 2R7TA 5ETLA 3OVBA 1W7PA 2L02A 3ABKH 4E70A 3ZZOA 3Q0VA 5IZHA 3G8SA 2WA0A 1CJTB 1VMBA 2DR6A 4HT5A 3Q89A 5D4RA 2ZSHB 2W2OP 1IKVB 1FKOA 5GMDA 4WKYA 3CCRI 2LYCA 2E5JA 3OTBA 1T05A 4LF4F 1M1GA 5GPCA 3KETA 2FLLA 2RQKA 2PMZN 5DS9A 3BR2A 4QZVB 2OTLS 4NA1A 2OPSB 2ZD1B 4L9VA 4DLEA 2DGVA 3RDIA 4LSLB 4EFAC 1KN6A 3QWLA 4NXMJ 1M5HA 4MJKA 3CCVS 5GTHC 2HQ3A 3WGHA 1HBOA 3OXLA 4OL8A 1CPZA 1Q79A 3ABLH 1MU2B 1G4DA 4U7BA 1BD6A 1WJDA 2NXNB 2EJRA 5HLHA 3F41A 4OZ5A 2KISA 2DY9A 2JC1A 3OT9A 1FWLA 3JRAA 2O3DA 1I51B 4OZNA 2KP6A 1X4OA 3K9TA 4FHTA 5CZVA 3JSYA 2HOSA 5FDLB 5HJXA 3VAIA 2XASA 3P8BB 3JTNA 5A8RB 2WZ1A 2HNHA 3H5YA 4XIUA 2GHVC 2K9LA 4HACA 2HAFA 1UCRA 1FKPB 3B78A 4OYZA 5F64A 2V1UA 2DA1A 5J47A 1D0XA 1JIHA 1HNIA 2KI2A 3SSQA 3LSRA 2WTFA 5HN0A 5F8GA 4KHRA 2HWIA 4ELUA 1FVSA 2X9DA 2Y8YA 3TP3A 1X5PA 1Q82T 4MTDA 5HODA 4PAAA 1N5QA 3DEWA 1FTRA 2R93J 1OMSA 1O3RA 4D1QA 3CJ5A 3I96A 2UXDJ 2EVZA 1X4CA 2J5AA 4CO1A 4N0BA 1NJIT 2GAHC 1X1DA 3U1LA 3FM5A 4M74A 4O4GA 3Q9SA 1BQMA 4ZKAA 1RB0A 2TCTA 3WIVA 2LR8A 2FGOA 2FPHX 1G3YA 3NNHA 4QBUA 1IUJA 4A6DA 5AXMA 1U02A 2ZH9A 2W2PP 3K5OA 4HBLA 1LKXA 3ET6B 1YI2S 4ZCLA 2MC4A 2JN6A 3JSOA 5HLGA 1BXNA 4QTRA 2IBKA 1TWHJ 1FD8A 1F9FA 4NA2A 2ZOMA 1FRLA 1IN8A 3TNVA 1Q1HA 5E3AA 3OTOF 1F1BB 4OAZA 1IN7A 1N88A 2AQEA 2EFPA 5EDWA 3K57A 4N8OA 2XF7A 1VTNC 3C3WA 1FMVA 3DGVA 1TL1A 2DK8A 4TYBA 2ACMA 1KU9A 2BW3B 3J81U 4A3FJ 4Y00A 2L7KA 1SV5B 5EGOA 3R60A 4DPXA 3BJOA 4ANEA 3ULHA 1JLFA 2JRTA 1TK0A 4LIWA 4C2MA 5F9LA 2A3JA 4FKXA 5CD4H 1L3SA 4DR3F 2FU4A 2ZJPF 2CFOA 3EPIA 4E7KA 5CYJA 3CCES 5HS7A 3DFGA 1AA7A 3KG0A 3HKZD 1UZHA 1WC6A 5HS9A 3PEHA 2Q1LA 2Z3YA 2K86A 4C2MJ 2RAQA 3BGUA 2G9OA 2E1MC 1PAEX 1FESA 4DZPA 4HDVA 4C0BA 3AB4B 1S1TB 4KNYA 4F55A 1R9TJ 2LBFB 3BSNA 1XTZA 4UXNA 3E8OA 3FSXA 1TMJA 2GW8A 5JVGF 1EKRA 3WHBA 3BT9A 2AIRB 2UXXA 3UN2A 1HBNB 2H1LA 3N4MA 1MROB 2CUFA 2JA2A 3GJSB 1FYMA 2OPRB 1XX5A 4CYCB 5LSRA 4PJJA 1URRA 5K8OA 2K1RB 2M4KA 1M5OC 3NNCA 3KLFA 3HOWJ 4WKRA 1Y8RB 3ABUA 4O23A 2NQPA 3LMMA 2MKIA 3W9JA 1B0VA 3OVSA 4NZ0A 1BQXA 4P55A 2AJ4A 2HFSA 3TRGA 2MSSA 1RTDB 3DKYA 4JI6F 1N6QB 4F3OA 2V4JA 2HQDA 4GGGA 4HOBA 3RYPA 3CF5Q 4L0ZB 3NS5A 3OYJA 3LSIA 2O01C 4HEA9 4BC7A 2COMA 1FKAF 4IOCQ 2HS4A 1SQEA 1OCOH 2VC1A 1OISA 1G3OA 1EAYC 1Z7LA 2WCXA 3HC7A 3OYDA 4U7DA 2TDXA 1WKJA 5EDNA 1QU3A 3HHNB 2N4CA 2R8HA 3FHZA 3WGIA 3SFGA 3OUYB 3EUKL 5F3ZA 5A2QY 3BQ2A 3EXYA 2UVRA 3CMEI 2PEXA 2QA1A 2WV1A 1CULB 4GXOA 4C8ZA 4DZ6A 2VJ4A 2R5YB 2DIVA 5H9FJ 2VKDA 1H2UX 4ZYGA 2EFGA 1FRHA 5M3MJ 2G0JA 1VQNI 3G71S 4RW6A 1NSQA 2DFEA 2MJUA 5L46A 2E7VA 1R36A 5ETOA 1XC9A 1QA6A 4I0BA 1TVRA 4EBDA 4MIBA 2V9WA 1HWJA 3BOQA 4CCKA 1PG5B 1P4WA 4OYXA 1RHUB 3BTCA 1VQPI 2DA2A 1YBTA 3EUNA 3ERMA 3HL2A 3F73A 2NS1B 4ZVOB 4DFPA 4FT8A 3MURP 1X4BA 3OR1B 2BE9B 3E3VA 4B3XA 3BP8A 3KZIC 2QRRA 2JL9A 2DO4A 4CLZA 2OPPA 2B8PA 4AVZA 3O5TB 1R0AA 3IS9B 1NK2P 4CSWA 2YU9J 1HI0P 4IFVB 3L7PA 3A13A 2HKEA 3CDUA 2UUBJ 2RQPA 4EJUA 1R89A 2BACA 5KT6A 1HQ2A 2XULA 2HNDA 2P2CB 2P5KA 2ZBCA 3BYRA 4NLYA 3N9UC 2MPUA 3CD0A 2XYHB 2Q3PA 4DX7A 3PO4A 1Z6TA 2P8IA 2ZEJA 2OEMA 4MLOA 3G8QA 4P75A 2RDJA 4GO7X 4UZBA 2H65B 4GVBA 4LIUA 4PSWA 2ZVIA 4UF4A 1Z3XA 3H98A 3HVAA 4G3IA 3BR5A 1U4BA 3W9HA 5ETQA 3PACA 4WXOA 5ETKA 4EJTA 3MF5A 3LWFA 1JXVA 4PKDB 1UVJA 4DV0F 4YEJA 3C2PA 1RAJA 3TL4X 2FQ4A 3I82A 1X1PA 2FA5A