2KDOA

Structure of the human shwachman-bodian-diamond syndrome protein, sbds
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
252
structure length
252
Chain Sequence
GHMSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Ribosome maturation protein SBDS
publication title Structure, dynamics, and RNA interaction analysis of the human SBDS protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2009-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01172 SBDS Shwachman-Bodian-Diamond syndrome (SBDS) protein
A PF09377 SBDS_C SBDS protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.900 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2kdoA02
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kdoA03
3.30.1250.10 Alpha Beta 2-Layer Sandwich Hypothetical 12.0 Kda Protein In Nam8-gar1 Intergenic Region; Chain: A; Ribosome maturation protein SBDS, N-terminal domain 2kdoA01
1N0VC 4MAKA 4ES2A 1NYNA 3ZZ0A 2BV3A 3ZZUA 2XEXA 1ZM2A 3E3XA 3EXCX 2BM0A 3ZZTA 3B8HA 1ELOA 1VI7A 4MYTA 4ZCLA 5G4DA 4ES1A 4ZCIA 2I8EA 4QR1A 2E1RA 2EFGA 2ZITA 3B78A 1DARA 2WBMA 3B82A 4M1KA 4TNOA 1P9QC 1ZM9A 2NPFA 1U2RA 4ES3A 2J7KA 4ZCMA 4ZCKA 2I0XA 3LH2S 2IVYA 2L9NA 1ZM4A 3OQ2A 1ZPWX 1ZM3A 4MYUA 3UI3A 2BM1A 1KTVA 1FNMA 2CVEA 4FN5A 1T95A 4QR0A 1N0UA 4QR2A 2KDOA
chains in the Genus database with same CATH superfamily
2VD3A 1DJ0A 1EKSA 2RVJA 2JLEA 2HYJA 4W98A 4BUPA 3HULA 4II3A 1U1KA 3TO8A 3K2YA 3DMJA 2VQCA 2HFOA 5F9NA 2DA2A 3NCPA 1TQIA 4JI0J 3QU3A 3OTOF 4HZFA 1B6AA 2NUUG 1BOAA 1HMVB 1Q86T 4Q48A 5B7WA 3VZIA 3T5LA 1IKWB 4FDFA 3JRAA 4N8OA 1TLHB 1FNXH 1YX5A 2BMBA 1NK5A 3I4MJ 1DARA 4AE5A 3CNQP 4KH1B 4XN0A 4LFCJ 2PBIA 2IRUA 1Y10A 3H9GA 3TZXA 2HLUA 2L48A 2G2YA 2Z2LA 2HFVA 2HGNA 2EINH 3V4IA 4XOTA 2KRFA 4C3HJ 2H6CA 4B3SJ 3KP4A 1W25A 3BR0A 5CD4H 4HX8A 3ZOBA 2LXFA 1DFDA 1HNIB 2RILA 2RF2A 4L72B 3ZCOA 1GX6A 3K2AA 1HPZA 3TJ9A 2F5VA 2EK6A 3RTRA 4Y3OA 2QZ8A 2HFUA 1X60A 3TUPA 3OFFA 4WZMA 1TMJA 1ON1A 2JUGA 2DK8A 3BF4A 3M9AA 4OI6A 3GTOJ 1MROA 1IC8A 5K5OA 1FNNA 2CW7A 2X6OA 3A01B 3H0GJ 1KQSR 3OYAA 4USUA 2R5YB 3VYRB 3CJQA 2QA2A 3VSLA 4I02A 4WKYA 2HHXA 4Q47A 2G9OA 4C4WA 2BYCA 2M8HA 2M0CA 1YWXA 3V7RA 3SI8A 1RZMA 4KN4X 1OIAA 2JOQA 4YB7A 2FJAB 3Q2TC 2VPXB 3SSSA 4XKVA 4HDUA 4DCPB 2VKEA 3ZR8X 3DGVA 4IDKA 4WU3A 5FJ8J 3BLYA 5EGOA 2FTRA 5FLVA 1RA6A 3OUYA 1G6BA 4DR5J 3ZZPA 3PG9A 1YRNB 3UCZP 5GAGU 3N0VA 2CPEA 3DRPA 3HOVJ 3BR2A 4HYEA 4Y17A 1IJEB 1G2EA 5GTHC 3FCVA 1PC4A 3BR8A 1OPIA 2VDHA 1PAEX 1LK5A 4CICA 3OYLA 2JLGA 4DUYJ 1C0TA 2DA3A 5A0YB 3SCJE 2KZZA 2VLAA 2XO6A 1NYNA 3G6EI 3Q8VA 3JRCA 1VCTA 1TNTA 1CJVA 3NWRA 2ZHAA 2G1DA 3IRXB 5CD4A 2JNJA 1AFJA 2YX4A 3BQZA 3HFVA 1TVRA 1UWAA 1KVJA 5B1AH 4WJBA 4FETA 4NLDA 5DD4A 4CCMA 2AKWB 2ZXJA 2HRYA 1LXNA 4P10A 3UDLA 1P92A 3DM2A 3I82A 3JSPA 4KKOB 3FK4A 5FKMA 2CPFA 1KEKA 3CMES 4C0HA 1ETWA 1B0VA 3N5FA 1U8BA 2ZUAA 1BC7C 3P7NA 3GXOA 4DXLA 2RKIB 1S76D 2BQRA 1H2UX 4R8HA 1UMJA 4LLNA 4KRWA 4E98A 3AB4B 2HNYB 2XSJB 4CNZA 3OYGA 1RADB 3UE2A 3LWLA 2JK3A 4C30A 3HVAA 4FS2A 2XVCA 3KLGA 4JX4A 2B9YA 3BPDA 3NGTA 3G8TA 3CCVI 3CD6I 1TAQA 4NC8A 1R43A 3F6OA 4OL8A 2GAUA 1X31C 4ZCKA 3MM7A 3O6QA 1QVGR 1URRA 2DNHA 3ZZYA 2ACMA 2ZDOA 1IJFB 4Z6YA 4HQEA 3T5XA 4LLGF 2R5ZB 1W0UA 1ZZFA 3HSZA 3U1KA 1UWBA 1IBCB 3QZ7A 2GS8A 4NLVA 3H2VE 2KJCA 1S0VA 2CG8A 4EEYA 3FZ2A 3U7JA 2HPMA 4LSLA 4RB2C 1PAUB 4O3NA 3MTJA 4NEZA 1L3UA 4V19X 4RNNA 4DPUA 2J76E 1CJUA 3E1SA 2YKOA 3WHIA 5IV4A 3PO5A 3CESA 2RRBA 4AVPA 1E3HA 5DCMB 2AX1A 1QU3A 2R9LA 3EICA 3SYTA 1JKPC 2DHAA 3ILLA 4F4KA 4DS4A 3I56I 2YQ3A 2DMNA 4R0JA 3R61A 1A9NB 2CQHA 2YBVA 1MIJA 3R7NB 3RR7A 2AQ4A 2XBPA 4E7SA 4J9LA 1SKSA 3HHLB 1Z7UA 3Q0VA 2HTSA 4Y00A 3KLHB 1JHFA 2RKHA 1RT6B 2XMKA 1UP1A 1DGWY 4PDKA 4ITVA 3RRKA 2P5LC 3HK2A 4A8MP 3WTUC 3CO7C 4DL4A 1SQGA 1NDCA 3DU5A 4DSJA 2D9PA 4QIWD 2QQBA 3WBZA 1GLNA 2V7FA 1IBMF 1IV8A 1SH2A 4I99C 3H4DA 3C15B 3W64A 2V6AA 4UQGA 2AEFA 3SMZA 2IA6A 1HC8A 3ZP5A 1ZRCA 2GW8A 2DIUA 1KRPA 2P9EA 4JV1A 3NLCA 1A35A 5GMDA 4ZPDA 4R8UB 3MMBB 2DY9A 4KHPF 2X6XA 2ZD1A 3NS6A 3L09A 4BKXA 2NOGA 3HL2A 5IYBJ 3W6KB 1XC5A 2OFHX 2PMWA 2GQ2A 1UHWA 2M87A 2L7KA 2DXDA 1BR4A 4B3TJ 1S6QA 4HOBA 2CIMA 3Q8UA 4ZK7M 4DL7A 5FRMA 5CABA 1T56A 4O0IA 1Y7PA 1MJ9A 4U87A 1EAYC 2ZOFA 1ON2A 2H5IB 3UN5A 3S1MJ 3MEGB 4NMLA 3DLKB 2BANB 4USHA 1SQFA 3LFKA 3P6YC 4DSKA 4K4UA 1VJQA 4DV4J 4PG4A 1T9UA 3MR7A 4JI4F 2OI2A 3W2AA 3OSNA 1GMWD 4V19J 4IXAA 3D66A 1SD4A 1RHKB 5E3AA 3HUGA 2OPRA 2F1FA 2CQDA 1FERA 2WVEA 5HDNA 3KMQA 2IIHA 4R5PA 1WEXA 3KK1B 1N5YA 4ZHRB 1HWKA 3C18A 1BHNA 1B4SA 3NCQA 4TYAA 3MMCA 4OIXA 1ZG5A 1RT5A 5F8HA 1VQLI 2ISYA 2HNHA 2XKPA 5J2QB 2VG7A 4CLZA 3WZ0A 5A8KB 1XMOF 3JSMB 1EARA 4LREA 2BV6A 2OPPB 1XGOA 4NUBA 3CF5Q 1K9MT 1EP4A 1AUSL 3J81K 2L9VA 2IGOA 2HBZB 4I2OA 4K5RA 1AKHA 1TL1A 3A1YA 1VRTA 2ZSHB 4BY1J 5D5UB 3ZZTA 3THVA 1P7JA 3CSKA 1VNDA 5EX0A 3FMBA 2DTZA 3IGVA 1WC1A 2XI2A 3L95X 1YZ7A 1U48A 4WF9Q 2CRGA 3O1LA 2JA8J 3IAS9 1SVMA 1YI2S 2GOXB 2COMA 3GLXA 1H3DA 3EWGA 4CM2A 4DQPA 3UD4P 2A10A 3ENAA 3C2GA 1R1TA 2VIXA 3D5MA 3A8IA 4ZTFA 3M30A 1NB2A 1RWMB 2YPYA 2XHCA 1MN7A 3D6MB 2DCUB 2HW3A 4J00A 3T8RA 1LB2A 2A07F 2WSEC 2NVUB 1P8GA 2JWNA 2H1LA 3M8FA 3IL2A 3PR5B 2HK2A 4CDIA 4TNOA 4A3EJ 2KI2A 4TQSA 1DHMA 3TZZA 2UUZA 1ZA2B 2J0SD 2B9EA 1DQUA 3K2ZA 1T38A 1QM9A 2QL5B 3D5SC 1RT1A 4AIJA 3A02A 4JI2J 4QW9A 2R8HA 4OIPF 5EX3A 1TWFJ 2CPIA 3M6WA 1AOYA 5BOXA 3M8QB 2QA4I 2A2CA 1WACA 2QA1A 5G0RA 5ETTA 1WC4A 1FK9B 2XB0X 2OU2A 1R0AA 5B66C 3OYFA 1IN8A 1JUSA 1U5TC 1K4TA 2LEBA 1TELA 3TZWA 1TZ0A 1PJ7A 5KT7A 2MEWA 3M8JA 4A6EA 2PJRB 1YX3A 4MEXF 7FD1A 1PYSB 3PUBA 1QAJA 1DY3A 3AJDA 1S1XB 3G6VA 1IQZA 3BR3A 5CKTA 2B5JA 1ZARA 3EUKL 1WOSA 2HQDA 3QMQA 1P2FA 1WELA 2GIZA 5FDLB 1S9HA 2CNNB 1O57A 1AZSA 1OR7A 4QLCU 1D5YA 2E5IA 2BBEA 3OT9A 3LSRA 2LA4A 2WOMA 1B70B 3LP0A 1F5TA 2Z8QA 3KK2A 3DLLQ 4DCOB 4XLEA 1RHQB 5F8GA 3V6HA 3OIOA 4P75A 5I3QA 1KU3A 4UB6C 3F73A 2PQ8A 5ILSA 3QAHA 5F08A 2QEXI 5KFYA 1KBRA 2ZH3A 3TI0A 2E29A 2W9CA 4WIQA 2HHHF 1JLAB 2GIRA 2F6CA 4D0PA 2HOEA 2MC4A 3TANA 1H8AC 2ZFUA 1S0NA 4KYZA 1RB0A 4BQQA 4P6QA 1BGXT 4JV5F 1NPRA 3D0GE 4ZP7A 5GAGJ 5B5EC 3MEKA 4DQRA 1NLKL 1NNDA 1HLWA 4WBFA 3G8SA 5TRDA 2Z0GA 4EBEA 1KOHA 2W7PA 3U1DA 2W4PA 4E6KG 1HQUA 3JQJA 1Z6TA 2V6CA 5LOQA 3RPUD 3OYMA 2RQ4A 3TA2A 4PJNA 2JSPA 3F72A 3CP8A 4IZZA 2ZEJA 1W7PB 1M5PC 5EZHA 3OIPA 2KU7A 4DV7J 1WC3A 2R7VA 2RMLA 3BDEA 2M34A 1UJ6A 4DJAA 2STWA 1C4CA 1WGXA 1DQ8A 3GLJA 1T03B 1F2GA 2MABA 2GVZA 5D4OA 1H0MA 1S6UA 4RW4A 4CGZA 4CLYA 1DDNA 4ESJA 2QYCA 1K83J 1WKKA 2XM3A 3FEZA 4GVBA 2K86A 2CS3A 2UVUA 2YNGB 2FQQB 5J2MB 3EUHC 3QPTA 4E7KA 1W5TA 1RWPB 1JE8A 2R7DA 1N4LA 1HSTA 3EUNA 2ZOMA 4DQQA 3JAMZ 4JX5A 2HQFA 5CJ9A 4A3DJ 1E6VA 1GT8A 2IVMA 2VJJA 3WHBA 2ZC4A 1QGPA 4F7ZA 1BI2A 1ETOA 2CQGA 4BXUA 5JJBA 3R1HA 3JRGA 3T1AA 3KZYA 3T3FA 3NMAA 5K20B 4NMXA 3HKZN 5KFKA 1RAEB 3DFEA 2BW2A 4QR1A 3RYLA 3QGHA 1ZGAA 4A8YA 2KHDA 3RB6A 2IT0A 4AYBA 4U8VA 2F4VF 1U8WA 2J9EA 3RW7A 2DIVA 1PUFA 3QYBA 2BOPA 4BEHA 2RB7A 4WXHA 4ZOSA 4QYRA 2ELHA 3QOPA 1RT3B 2AMCB 3NY0A 1Q81T 3IH3A 1VBZA 5KFZA 3KIOA 1L3LA 1S1VB 5M5XJ 3KUHA 4IFYA 2UUWA 2DFHA 2ZKZA 1RSCA 2WAQN 2COBA 1ETKA 5KFIA 3NQOA 4IG3A 4RWWA 2I1RA 1TWHJ 2B0GA 3LANA 4ELTA 2LG4A 3J7YI 3JTOA 1S1WA 5IC6B 1BM9A 3W1YC 3GILA 1N5SA 3MCZA 5JVHQ 3ABTA 3MD2A 1BD6A 2JVOA 1SEUA 5C25A 3G6YA 3KDNA 4QWCA 4UB8C 2HDWA 1U0SA 2ZH5A 3AQPA 3SZGA 3PCOB 4F4YA 2I9SA 3NXZA 2DNNA 2KFZA 4XLFA 1Q53A 4JOUA 4UOGA 3NMRA 5D0EA 3A13A 4FKXA 1UA1A 1QSYA 1BJZA 2DAOA 1Q79A 1X7VA 1NXIA 2CADA 4O3RA 1U3EM 1WCMJ 4DZPA 3CCUI 1YLFA 2IA0A 4OFZA 3MM6A 3G9CA 1HMVA 2AF6A 1D1AA 1WUUA 1CULA 2QSHX 2FHJD 2VXDA 3SQGB 3HOSA 1Z77A 2XGXA 1BR2A 1YW8A 4QIFA 2BE2B 2GVDA 1TKDA 1SC6A 4ZYHA 2X85A 4FKYA 4TY8B 3K5LA 1PBUA 2E1MB 1QY7A 1J5OB 4XSXF 2B4PA 1SVDA 4CTAA 2J8SA 5DD8A 1CS4B 3ILOA 4PJMA 3AB2B 4WP8A 5ED4A 1G3OA 4QZVB 3QNWB 1SMYF 1JK9B 3DYAB 3BROA 4UNOA 4DPTA 4ZH4F 3MZYA 1ELOA 2LY2A 1S48A 1HNIA 1SQEA 1IO2A 2BX6A 2XGQA 3ZMTA 1U6BA 4RW8A 3QT8A 1MGTA 5GVQA 3C7JA 5LEKA 3MAQA 3COAC 5C24A 4ANCA 4X4QA 5GPCA 1IXRC 3POTA 4C8NA 3R7BB 5CQEA 4D5FA 4KFBA 1U1NA 1QZEA 2Z2YB 2XIGA 2HQIA 4DUTA 4M71A 1PJ6A 2W2QP 2G0IA 2RU9A 1N5TA 4F50A 1MNDA 1VIXA 1TTHB 5H9EK 4BDZA 4X84A 4OAZA 2W25A 5IT9Z 3S15J 2Y1RI 3QIDA 4TN2A 1GH8A 1NAQA 5M2PA 3K4NA 3PV8A 3DHXA 4RDUA 2GMLA 4X65F 5MLCV 3HSFA 3VAIA 1RUSA 3EM1A 4LJZF 3D0SA 5H9FJ 2Q8KA 2F40A 2B56A 4E8UA 1MDMB 4UVAA 1TQMA 2XEXA 1IBMJ 5KFVA 1FJGF 4HLBA 2OEKA 2C2DA 3LA3A 2ZHBA 4YQWA 2YXLA 3PSIA 4EJWA 3D6FB 3CDHA 3RKXA 1HWLA 2CQ4A 3J80Z 2DGUA 2KZMA 3FHZA 2C22A 4RUAA 2WA0A 4KHPJ 4D3HA 3DI6B 1ZOTA 4MK9A 1VQOS 2XB5A 1NG6A 3MAHA 5EJCA 4EMDA 2WV0A 5A0YA 1T0TV 3CCEI 4K4SA 4ANDA 3F8MA 3KCCA 5KT3A 2LK2A 2YWFA 1SD5A 4Y28C 1RHMB 5L3CA 4IO9F 2K7JA 5EZGA 2ZXWH 2BEFA 3RW6A 1W5CC 5G4DA 2HAIA 1K79A 2P0WA 2V79A 1CLFA 2WW4A 1UELB 4EO8A 1O3SA 2V50A 3OY9A 1RTHB 5KFMA 3TO7A 4DR1F 2NOJB 3OTDA 4E7JA 1ETXA 4NI2B 4BC9A 2ZE2B 3M2RA 2AS5F 3LAMA 1X4FA 1XCVA 2B9SA 4LF7F 1N78A 2NLWA 3IAM2 2KL4A 1NU4A 4J9NA 1IXSB 2ZXHA 2QV6A 4AIHA 1AB8A 2FJDB 3EZOA 2HNYA 3EVOA 2H48B 4N41A 1OYDA 1FPQA 3A3NB 2J5PA 4DR2J 5F27A 4GDFA 4BE0A 3BSCA 3WTZA 1LDDA 4DN0A 3ZZUA 2ID6A 2HYFA 1IKVB 3KLIB 4EV0A 3HOZJ 2DKOB 2DPIA 3N6MA 3OD2A 4TU7A 2B7EA 2DMUA 4F2SA 3JSBA 2X3GA 5FGMA 5ETRA 1RABB 4CCKA 4KMFA 4EEFG 4PWDB 2CPDA 1CQNA 5H6QA 3M8WA 4RNMA 4J91A 1DU0A 2HOTA 3PFYA 2ZDPA 2BW7A 3DTIA 3HX9A 3Q8QB 2CQ1A 2ADBA 4MKBA 4J90A 4J7CA 3BT9A 2B7CB 3K8VA 3LA0A 2G2OA 4IRHA 2C3MA 3MZIA 1KLNA 1HBUB 3T1HJ 2CQIA 4BYYA 1VQ9S 2HHUA 4U9RA 5ILUA 2UUTA 3PVXA 3B02A 3J7Z5 4UOFA 1Y4ZB 2L9RA 1WFXA 2FU4A 4RS8A 1QPIA 2M1BA 3VAMA 2B3TB 1EB0A 1Q1KA 4DV5F 3CQZJ 2DA4A 9RUBA 1NRKA 4O4RA 4CYCB 2FVSA 1N34F 2F48A 3ZMUA 2K7KA 3FBBA 4FVMA 1EJ9A 2CJBA 3VGTA 3R27A 2Y1JA 2VPLA 1BQMB 2CNKB 2XMWA 4LF5F 3QBCA 3TA0A 4AU7A 3D5RC 3RYPA 2BZTA 3QYEA 1CF7A 1MD0A 5F8IA 2P4WA 2DA6A 1RJJA 2OTJS 1JLCB 3VWSA 4B9SA 2GA1A 2CNLB 3H3UA 3CJKB 1UMQA 1FFWB 3WU0A 2M8GX 5DS9A 4P71A 5ADZA 4BXFA 2XUBA 1RUNA 1VMBA 2HQNA 5J2NB 4BU2A 1S29A 1Z21A 3M8PB 2DD8S 3A03A 2XNQA 2BXZA 1LUJB 2YKAA 5CYQB 2LVSA 2Y30A 3G87A 2LDIA 1S9EB 2NXUA 2I2YA 3GYGA 3H5UA 2HNZA 2G0CA 4ENKA 1XD7A 1JTYA 4IYQA 4DV1F 1XGNA 1JJ2R 2HHPA 5F8LA 3WE3A 4URQU 5D5WB 2J6UA 3ABKH 1Q0NA 2ZFWA 3MEGA 3TEDA 4IG0B 4A8SA 3V6DB 4FTHA 5GAEU 4FBUA 4CZCA 1X58A 1PP7U 1AT1B 5K14B 1HR0F 3AQOA 2ZOGA 4OZLA 5KFAA 3RB3A 5KOWA 1RCOB 3PJWA 3PIOF 1VQMI 3QAEA 1WJ5A 4UV8A 3SJMA 4KGXB 1Y00A 3MVPA 2EEYA 3CJTA 4CCLA 2GJ2A 2CO5A 2GOMA 2HHHJ 5K8OA 3BP8A 2NSBA 1MZBA 1E6YA 3KP2A 5KTQA 5L38A 5LJ5Y 2ASJA 2VG6A 1E3PA 3QRRA 5LMUF 2V4JA 2CQ7A 3NKYA 4M63A 5A8KA 4Y0FA 4TKTA 3JSMA 1X1BA 2WK4A 1RAJA 4MFBA 2OPPA 1HFEL 3JRBA 3CMAI 1WTFA 2ZB9A 1U1PA 2L3DA 1VQ6I 3DRYA 4HV5A 3ZMSA 1SC3B 2G9WA 1S72I 3AXMA 3V8JA 2ZH9A 4IHWA 3DLHA 3O6BB 1X9SA 5KFNA 4JI1F 3A4CA 2A3JA 4B02A 3R97A 2JEIA 4X4TA 5J1EB 1XMQF 4BH9A 4XLPF 3GB0A 4EFAC 4M73A 2YNIB 3FXJA 2R7ZJ 3I53A 4F26A 2BVMA 4CRJA 1YQAA 5GMKa 4OV6A 2JN6A 1KKHA 2RNEA 1UZHA 1SIZA 5E3MA 2VFTA 2VONA 3BGUA 1YJNI 1EH8A 1IVZA 3M2VB 5CLSA 1RHRB 5TISC 4DFPA 3I0TA 1JLBB 1MG7A 4OLOA 2CQQA 2MGZB 3HIFA 4ZPAA 4A2UA 3QGIA 1FSEA 1Y5LB 1XCBA 1NUEA 3BSOA 2YQ0A 5JHFA 4G3IA 1R23A 2MXYA 2ADUA 1UG2A 1TL7B 1ROFA 1OYEA 1YZ6A 2QLJB 4NWBA 4Q0BB 2XZWA 4LIVA 4LF4J 3UD5A 3LGHA 2HBQB 5HDGA 2MH2A 3CJ8A 4TVAB 5L3GA 1S7AA 3UDVA 3L4BC 4RUHA 5C4JJ 4HV6A 5BYQA 3T5KA 2AYBA 4A0XA 4B4CA 2WW8A 2WBMA 2V2VA 2WAEA 4IKAA 4KGZB 3FXLA 5HS7A 2UVWA 4UOCA 2JQ7A 2VH7A 5F1RA 2OBPA 1RISA 2G1HA 3NNCA 5BQTA 3G1LA 1X5OA 3M2UB 2NSCA 2QFJA 4ZJQA 2W7OA 4RM2A 3VODA 3CO0P 4YB6A 3E6DA 5CCLA 1KN6A 3ETMA 2FMYA 4ZVRB 4ZDNA 3GCMA 2KJBA 5FDLA 4AIDA 3FC9A 3WTSC 4RMNA 1RAIB 5IPAA 3PNYA 5ETKA 2BQUA 5D78A 3K89A 2FVCA 3ROUA 2HFZA 1H74A 3X2QH 2FGCA 1SFEA 4JI8F 3T19A 1SJ4P 2BJ7A 4A48A 5CQGA 3IWZA 4JI5F 2KB2A 1PSDA 4HR2A 1Q1VA 4HSRA 4KIGA 3BB5A 2XPUA 1ICEB 2A69F 2F65A 5ETSA 2RQKA 5LBQA 4EGYA 2D9OA 1V4RA 4I6AA 1PGZA 4OIQF 1OCPA 2VUGA 2PX9A 2OJED 5HO4A 2CPYA 1R58A 2E1NA 4X4SA 4OZ1A 1MSFC 2QMWA 1CVJA 1LNWA 4I09A 1RTJB 5HQLA 2HQAA 2OFGX 2A05A 2LA6A 3LGNA 1PP8F 5AE1A 3CCMS 1X1CA 1KHWA 3KFWX 4I69A 2VICA 3KJFB 1RU2A 3OSPA 2EI5A 1ZTTA 4CYUA 2PEXA 5ICEA 3I54A 1FFGB 1IN4A 2ELJA 2V2KA 1YJ9S 1RPWA 2CJQA 2YTCA 4MYUA 1U45A 3DCFA 2JPBA 4AD9A 1LW0B 3UQSA 4XDCA 2Z16A 2JC0A 4YELA 3CUQB 1NPKA 1KU9A 5HL7Q 1JMTA 2LVWA 2D1HA 3ABLH 1T03A 3IC7A 3GP9A 1FRLA 1I5OB 2R3SA 1JLGA 2CUEA 1T6SA 4F91B 1O3QA 4IH7A 3SDBA 1RTDA 1M1HA 3HD1A 4LG3A 2CVEA 3V81A 1RT7B 4LOCA 3NL0A 3AAWB 4A6DA 2IBDA 4JK1X 2K4BA 1RYSA 1JX4A 3MCSA 3FCWA 2V2ZA 5E79C 3S8PA 3FBIB 3QFWA 3BGFA 4YUDA 3VQSA 3LTOA 3IWFA 1RTIB 2B9XA 1PO6A 3Q0UA 1IWAA 4MO7A 5ETNA 2JZ5A 2WTFA 4DEZA 5E3NA 2L7MP 1QRYA 2D45A 3DN9A 4PEOA 3MMYB 4JI7J 5FLXY 1XDSA 2HURA 4QJVA 1FBUA 3I59A 2GLOA 3FMSA 4LMZA 1SV5B 2R92J 1X4CA 4CCHA 1K0VA 1YVFA 5IXUA 2QENA 2R8JA 3K0JA 3FCHA 1HOMA 1U9OA 3RYRA 2QSFA 4K4VA 1RR8C 5KFSA 2DNZA 4AIKA 2BV3A 4LQ3A 4DR7J 3CZ6A 5I3PA 1KU7A 5K8NA 1PYVA 2J9DA 5KFCA 2OD5A 4NLQA 1HNWJ 1Y8QB 1AWCA 2QUFA 1YJRA 1UPMB 4RW9A 4WWSA 2NXJA 1UCNA 2KTQA 5F6FA 3I0RB 3OBIA 4I2PB 1S0OA 2XMVA 2M5WA 1MMAA 2ZKUA 5H2FC 4QPQA 2ZMEA 5A2QY 4UUXA 4DV3F 3QGPA 1S97A 2B8PA 1KQ0A 3CJ0A 3LO3A 2RQQA 3W2VB 3V4GA 3M4XA 5ICCA 3G4SI 2HHSA 3RKYA 2MKCA 3GMGA 2GQQA 5KNLA 1D1BA 2HFHA 2QG9B 3H2LA 3PNTA 3KHRA 1NJWA 2MKJA 1QE1B 1W2IA 2IJLA 3F8CA 3H42A 4L75A 3ITHB 3P3DA 5EF6A 3HFZB 3AA8A 3W60A 2M4KA 3EE3A 2QT7A 4K0KF 2RV8A 2D2WA 2IRYA 4F8RA 1WNEA 2FXAA 4M5LA 2FLOA 2EZHA 5EG0A 4LR9A 4K4ZA 2NXCA 2JA7J 3TP2A 2APOA 4CLTA 3HPHA 1E17A 4RW7B 1HARA 2AEMA 4KGKA 3R5CA 4HVZA 3RZAA 4DL2A 2PT0A 1LJ9A 1OSCA 3FNNA 4NCGB 1VRUA 4ZPCA 1S7OA 3K69A 3GSDA 1H98A 2DFEA 4WFZA 2XY6A 4WZQA 1YHQI 4ZS6A 4G6QA 2WZ1A 3MUVP 2HRUA 4ABZA 1Y39A 3OFEA 4B43A 4BBYA 3RJMB 2Q2EA 2O1PA 2DITA 2QYGA 2OMLA 4QPXA 2RAQA 3ZTRA 4WXWA 2FEZA 3GV7B 1XNQF 2C2RA 4NLGA 3CUOA 3A4TA 3I5UA 1RHUB 4LR8A 4I2QB 4W90B 2DFFA 3LSTA 4ED7A 4B9TA 1RWUA 5EEHA 2J0WA 5CYJA 1FDNA 2KVQE 4IF4A 2HOAA 1GXUA 3IA0A 2UXBF 3RB4A 2DCEA 4M6XA 3TJAA 5JXSA 2DTJA 3IR7B 3KLNA 3CF5F 2EZLA 5F41A 3C16B 5KFEA 3TOAA 1YSJA 4ELUA 3GJRB 2NYIA 4H4MB 4J9QA 4IPAA 3GUDA 3HSJA 4DV5J 4OHWA 2MG4A 3SZPA 1E2XA 1KNZA 1F9FA 3BH6B 4OYAA 1TWGJ 2WBRA 4NYZA 2XSJC 2NYHA 1TT5B 4L18B 4DR6J 2XYGB 1FD2A 1LFPA 2VQEF 3IGNA 4ZVUB 1B1BA 1FBSA 4PGGA 3OVBA 1N6QB 3WTXC 4L6V3 1LQ9A 4JI6F 3ZZOA 3OSFA 2E9TA 3GWZA 1D1CA 1S1UB 4A3LJ 3CF2A 3OW2R 3PUFA 1N52B 1V54H 1EKEA 2VFSA 3B4MA 3ULHA 5DEQA 1YITI 3MURP 1X4HA 3DKWA 3P8BB 2CWEA 5J4VA 3QWPA 3PO2J 1A6LA 3DI6A 4I6WA 3R9LA 4ZLPA 2DPDA 3CDAA 5M2RA 4DX7A 3ZFVA 5AJ3F 3D67A 3BPSP 3GYHX 3HBLA 3BN4A 3RIRA 1ZR4A 4OJHA 2COLA 2POKA 3LFUA 3J7AN 4M6VA 3KNAA 5KG2A 1T95A 5HSPA 4MFEA 1S5ZA 1OQ3A 1XPXA 4OINF 3I4PA 3HHLC 4L9VA 4NOHA 2VASA 3OOPA 1N32J 1RTHA 1U9NA 1VI0A 5ITHA 3IG1B 4ER8A 4Q5SF 1X19A 2ZE2A 3L9FA 4DPYA 4YIFA 2X1AA 2OPQA 2FJEB 1HR0J 4AQYF 1JQGA 2CRLA 5KFTA 4OJGA 4KT6A 4BJTA 1UKUA 2DISA 1FZPB 2HU9A 8RUCA 2R93J 1URNA 1TFWA 1JHHA 1NB7A 3QLHA 3K7AJ 4EYIB 2BHZA 3M8YA 4WP3A 1A31A 2XAQA 2MHEA 2BOLA 2ASLA 1HHTP 4LFBJ 1JLFA 1REVA 4YEJA 1FWKA 4HX7A 2KJWA 3IAS2 3HRMA 4PPZA 1IR2A 2KG0A 1RK8A 2JC1A 1I50J 4A0YA 3KLIA 4S04A 4F3QA 4PXCA 2FJXA 4KA4A 1PCAA 3NGDA 5C2GA 2Q3PA 4C11B 1UW9A 3GIJA 4NYOA 5F0HA 3QT7A 2IRXA 2IGNA 5CH7B 2O3DA 3Q86A 4EJOA 4RW6A 3KP5A 2OA4A 3SQNA 3KG4A 1K47A 4FNIA 2M3DA 1C0WA 1Q8KA 1JLQB 3UVJB 4HHUA 1CC7A 1L3KA 3I5BA 1S12A 1DLOB 2V94A 1SVLA 5DUIA 4BE2A 4JI3F 1AA1B 2M5YA 4JI1J 3OTEA 1TK0A 2YKNB 2DO4A 4F04B 1YJWI 5CVUA 2ZBIA 3MKYB 3CB4A 3WTWC 4I98B 4CSWA 3O3KA 4M5DB 4LUBA 3GCXP 5T7LB 2Y0SA 2MDAA 5E3QA 2B63J 3N6NA 2F5EA 5IT4A 4CCJA 2J8AA 2VJUA 5DDGA 4CYCA 3C3WA 2LECA 3FMWA 2EQRA 1HNVA 2QA4G 2LR8A 1GMVA 3PJXA 2OH2A 1XN9A 5IQ6A 2BKPA 3LQRA 4FISA 3S3MA 5EWEA 1PJ5A 4R1HA 4FE4A 4PFPA 4BBRJ 2YKQA 4J9MA 1WHUA 2AGPA 3CMMA 3TX0A 2KRHA 1EH6A 1U8SA 4M5JA 1QAYA 1PVEA 4CHUA 1IM6A 3LQQA 4YEAA 3FWEA 3QT6A 1KTVA 3DKDA 1I1SA 3FZBA 1JLCA 4J9SA 1BXNA 4WCGA 4N5SA 4R0EA 4ZVPB 2XAGA 3K6GA 4AC0A 3X1LB 4DOZA 3CJKA 1V3FA 4DZJA 5HANA 2W4CA 4ID5A 5HN0A 2C3UA 4X62F 4UXNA 4BACA 3DV8A 4PK4A 1Z7LA 4GYIA 2XCPA 5J2NA 2ZH7A 1FJLA 2XF5A 3JYTB 2LRDA 3LWMA 2WY8Q 5E33A 1VQ8I 3MZ8A 3DEEA 4URSA 5IWAF 1H2TZ 3VALA 1HI1A 4ILMA 2BJ8A 2MYSA 1UHSA 3DRSB 4Q45A 1IN6A 2FZCB 4FYYB 3K1PA 2KRCA 5FD5A 4ZYGA 2QJ3A 3LP2B 3EPGA 1CPZA 4IOAQ 2XY5A 3W8PA 1O5JA 4DLGA 4XICA 2GIFA 4Q4ZF 3DMJB 3W8GA 3DF8A 3CCSI 1F9HA 1IN5A 1HKTA 2XS5A 3PTWA 2F7VA 1FWLA 2J7UA 4HH0A 2WSFC 1KC8T 2LQJA 4B44A 2QL7B 3ILIA 4HI2A 4DPWA 3TAMB 4LF8J 4LF2A 3B8HA 4AYBD 4UVBA 4P1WA 2X1FA 3NARA 2RQCA 5C2CA 1TUGB 2D69A 1ERDA 3HP6A 4DG1B 2VB6A 1ZN2A 2IC3A 5KT4A 5HP1B 2IS6A 2YQ1A 4DFJA 4B47A 2R42A 3JQMA 3U02A 1ZR2A 1K8AT 4PG8A 5DO2A 3V4IB 2CW8A 2DYSH 2KRRA 2DGVA 1RBOB 2EPFA 9ATCB 3GJTB 3WODF 1DTTA 3TEHB 1IRZA 2RF2B 2RDIA 4KPCA 5K7HA 3MM5A 2D1CA 4M3EA 1IBKJ 2E66A 1A6QA 1W5SA 4EGZA 2ZBCA 3JCUC 3M05A 5KAKA 3DXSX 3GG0A 5F64A 1KWMA 4Z7YA 2EWNA 2FVPA 2WAFA 3R5DA 1X5PA 3C14A 3L2QA 2Q1LA 1I94F 2YWKA 5KFRA 3F6VA 1MROB 1JKOC 2DBBA 3OL8A 2IM2A 1SC4B 5J1EA 4OI0A 1RE1B 4CO0A 1JKHA 1NK9A 2QMUB 5CYMA 4BHQA 3MM9A 1T08B 3F9KA 4XPEA 3CJQB 3K4CA 2XV4S 4MK7A 4AUKA 3KLFA 2YWEA 5LFAA 3AG3H 4KT5C 3S32A 4P72A 3OR1A 3GSIA 1WEZA 2BA9A 2B4OA 2KKHA 4DX8H 4YY3J 1U2FA 1FDBA 1FRXA 4FF4A 1TZLA 2EFVA 2R2TA 3M2VA 2MY8A 3LF0A 3ZZZA 2NVXJ 2JUCA 3H36A 3G82B 3NCRA 2DOAA 1JLBA 1ZREA 4KIAA 1AHDP 4K50A 4DR4F 5DDRC 1U1RA 3NRVA 3J81Z 5EGOB 4KGMA 4JP0A 1FTRA 2EW9A 2IGKA 1MKMA 3D9BA 1LQ1A 4EUVA 1R6RA 3NWSA 3OUYB 1XGMA 1U2CA 3TUJC 1VBYA 4ED1A 4NLXA 2XS2A 1O7FA 4B9MA 3CCQI 2EKNA 3DRPB 5D8LB 3G6ES 4EK2A 2UV1A 3HKZA 4K4XA 3R6LB 4EYHB 1LVAA 1FCAA 1QTNB 1P6RA 3UKGA 1GV2A 1HA8A 5KAIC 1VQYA 5GADI 1C0TB 1E0EA 2LLZA 2ZHOA 1MNEA 1DQ9A 3ADAC 2IW5A 2H8RA 4WX9A 1CJVB 2MKYA 3PRBA 2ZZMA 2ALZA 1TVRB 3BR6A 1GUUA 4FS1A 5I42A 4LMYA 2KRBA 3FEXB 2BDPA 3QPIA 2XAFA 3BKTA 1D8YA 4PSXA 3UR3C 1YW7A 2OSRA 2WAQA 1TT0A 2FSWA 3QWUA 3TOQA 2DHXA 2K06A 1AW0A 3CCJI 1NK6A 2FGOA 4QOTA 1Z1DA 3GTPJ 1FX2A 1WI8A 1X8DA 1SL1A 4BL0B 3VF0B 1OCTC 4DV3J 2KIUA 2CPJA 2P6TA 1ZTRA 4R25A 3AG4H 5A6WA 3WGHA 4XR6A 2CFXA 2W00A 2M8EA 2MJNA 3T41A 1EZZB 4WPAA 4UF4A 3DRRA 4JQFA 1YDLA 3CCVS 3CD6S 4CP5A 2M4MA 2CXEA 4NLRA 1N5VA 4HDVA 3KLGB 3L2VA 3M07A 4ECRA 3I64A 2ME6A 3L2RA 5J1RA 1PYTA 2PO4A 4C8KA 1YO5C 4L9NA 3H25A 4F92B 3ZQQA 3MM7B 2MB0B 1T33A 4BQNA 1VQ4I 1K73T 1X5TA 1ZAOA 4C3LA 2QLFB 2K3IA 3DGPA 2K02A 1KYWA 1UWBB 1LK7A 4DS5A 3OIQA 3MN2A 1RDRA 4HPQA 2Z9OA 4LIUA 2DHHA 2AXLA 4LSLB 1R00A 3HVWA 1CJUB 3UNYA 3FDYA 5J1YA 2AD9A 3PHTA 3I56S 4HACA 2K85A 2ZM6F 2K9QA 1KS2A 1LNQA 1SC1B 4K2XA 2MW8A 2ZC3A 1N56A 4OLPA 4XRFA 3U1LA 5KVRA 3GYNA 1LW0A 3PRDA 2NS1B 2L08A 5CXTA 2LY1A 4JOMA 1KVIA 3HXLA 2DA1A 2HNDA 3KX2A 2GFFA 3CD0A 3HZGA 5LD2C 4B1RA 1FX4A 3R5JB 4DV6F 1TP4A 2Y3YA 5IM0B 2UXBJ 1J2XA 3F23A 3TW0A 3TRGA 2F5GA 1RT7A 4RGXA 3T1YF 4I01A 2EILH 3ECHA 1FMWA 1B4AA 3I5AA 5J8CA 2CQ2A 2EK1A 2AZ1A 5L3FA 5CVIA 4HYKA 1OWXA 3RBXA 3C3LA 4MIMA 2LEPA 2BR0A 2XMAA 5L1JA 4PJ0C 4EJTA 2CNOB 2QYOA 3VAJA 1OCRH 4RBOA 2E1MC 2Q0OA 2JRMA 5KG1A 5B08A 2HZAA 3K7RA 2XWXA 1VQ7I 2DNQA 3DDKA 2VKVA 2UXDJ 4X66F 2ZD1B 1Y6IA 2DNGA 4F3OA 3CC4I 1H38A 1IKXA 4L5IA 1SV5A 4XRSG 3FQLA 4EJUA 4IKFA 2VU5A 4MQ9F 1S6QB 1HI0P 3FXMA 2FF4A 1LV5A 4G1PA 4ILLA 4B3MF 3FXOA 1U6ZA 8AT1B 4RL1A 2DYRH 4IX7A 2FOKA 3O8WA 2DPUA 2CU7A 3HHLD 4UTGA 4U67Q 1UG0A 3LSPA 3HRSA 3MPYA 4K8RA 1R3NA 3KKFA 1F5BA 2GHWA 2UUBF 3JAMY 4BNCA 5BXIA 3N01A 2CJJA 2OCEA 2H94A 2HS0A 1ZLKA 4KQZA 4M9SA 3J7AO 4TYBA 2JVGA 4CCOA 4NASA 3W2VA 5D0RA 2G13A 4OAYA 1G3WA 1QUVA 3RBZA 3HUGB 3B78A 2OPRB 2MQLA 4ZVHA 3CXCR 1W2BR 2Y9YA 1MSWD 2DH9A 4K7QA 1WZ2A 2X1BA 4LK0F 1QE1A 4P73A 1D5VA 2XRLA 3FUYA 3ITHA 2Z56B 1N5YB 4QR0A 2Y1LB 2R7OA 1HD0A 1B8IA 1R1VA 2DI3A 4JUZA 3PW2A 3K5NA 1GAOA 2BM0A 3MMCB 2PD1A 3E97A 2ZITA 3CD7A 2XRNA 1G59A 2QSFX 4B3RF 4RW7A 2KIQA 1DP7P 1EP4B 1BJAA 2IJRA 1DBDA 3IWLA 5GADJ 5BNGA 1AKHB 2V1DA 4NYPA 1VRTB 2FY8A 3Q9VA 2XQCA 2QQAA 4HX4A 2DGSA 1P9QC 3S2DJ 4WWCA 1J09A 2IXSA 4K5SA 1RHJB 2DT9A 4P9UA 5M3FJ 4B3OB 1BLUA 5F3TA 5EHHA 3PYDA 2UP1A 5IYCJ 4DU7A 1X1AA 5LSRA 4I64A 1K1SA 1SVOA 1M0SA 2DFIA 2EZKA 2W1OA 3D28A 3SCLE 3F22A 3HI9A 2QC3A 5GAEI 3HEFA 2GHVC 2N3LA 3W3CA 5AIQA 1UJ8A 3H5AA 3OYHA 3RAMA 4JI3J 5F0CA 1Y9OA 4BE1A 4GKJJ 3SEQA 2CUYA 2PEHA 2OF7A 2H9ZA 4NEYA 4DF8A 2CQ3A 2LKXA 2W4SA 1BWEA 4WKRA 2JJ7A 3HF5A 3RDIA 1OQYA 4F0KA 5D6EA 3BJOA 1MBEA 4IQJA 2NCKL 4UZBA 2MC3A 1N0UA 3ZTPA 2QA4S 1QHGA 1RT1B 2AYGA 1RNLA 4TXSA 1Q5VA 1C0UA 1VIOA 1U49A 2AEJA 3EZUA 3I32A 3ERED 5KG5A 2HQGA 2J6TA 1STZA 2MZJA 1WEYA 1WI6A 4QU7A 3DOLB 3SCIE 3D3BJ 3O8HA 3OJSA 3ZNUA 1ITPA 3R0AA 4D1QA 1R0AB 4ICLB 2MFZA 3NRBA 1S1UA 3KTQA 3H0PA 4X4PA 1DQAA 4V2FA 4G12A 3WHCA 3ABUA 1BW6A 3SCKE 1YBUA 1TNSA 4DFMA 4USMA 3RBEA 2E1PA 1OMSA 5BS6A 4CT9A 4ILRA 1WJEA 4X62J 1I39A 3KHLA 4LITA 5LT5A 4G6DA 2MKKA 5B0DA 1P4AA 4ZZLA 3P49B 1RACB 5IT9Y 2HS4A 3E01A 4ZA1A 4KJZA 4PWWA 1I5ZA 3MEEA 3W5XA 1U1MA 1N33F 5B0CA 2HK3A 2L7ZA 2A3SA 2WOMB 3LP0B 4RBVA 2QEXS 2P5KA 5FKNA 3KK2B 3G96A 2V67A 2UU9F 1T9WA 1YTYA 2IFXA 3K0LA 2J5AA 5BMZA 3Q8PB 1V55H 3G6XA 4FYWB 3CJSA 3WGIA 4O0NA 3OVSA 2KZGA 1R7IA 2RT3A 2HVEA 3KZIC 1W36C 6AT1B 1RETA 4X64J 1HF0A 4J01A 2LP4A 4XK4A 4DR3F 4KC5A 2H5EA 3CCYA 4B9UA 3D2WA 3LMMA 2QX0A 2IPOB 2RJZA 2ZC2A 3J80Y 4A8KA 1SANA 2IPQX 3K10A 2W9BA 1RYRA 3MUTP 4DV2J 2OAUA 3RZDJ 2CDQA 2R7FA 2HQRA 1MWZA 1KGSA 3LWFA 3QRPA 1WWXA 2YNFB 2HVHA 4LFAF 1OO0B 1LVKA 1HKQA 2HGMA 1TKZA 2HFNA 2HDDA 2QWWA 1YKWA 2DMPA 3KNGA 2EFGA 2MZRA 3PYEA 4Z2XA 5BJRA 2YS9A 3JS9A 1VLYA 3MD3A 5E41A 2GVZB 2KG1A 4OI1A 3CW2C 4RW4B 1JLQA 3UVJA 4GVBB 4KBIA 3CCRS 5GAHI 3V8LA 2UZKA 4UOHA 4CO3A 4XO0A 1H9GA 4IFVA 2MBFA 5DG8A 3GJSB 2IM1A 2BOAA 3BDDA 4OJ3A 2LMDA 4M3FA 2HG4A 4OYOA 1CBKA 2L9NA 2FBKA 2D3UA 4M5DA 4H4KC 5HS9A 1E6VB 4J19A 5T7LA 1F6TA 4P2MA 3N05A 3RRHA 2JL9A 2XROA 5D77A 2HGCA 3LW5C 4QQBA 1Q7LB 1WC0A 5M2UA 5KFQA 4OHYA 5LHHA 5U47A 3GTYX 4XOPA 3FBNB 3BQ2A 2D74B 1FOYA 1Q8BA 4A93J 2NREA 1X4EA 3W2WB 2O0YA 4JV2A 4BEHB 2QLXA 3QJPA 4DR4J 2LDUA 4AVZA 4O4GA 1UJ5A 4XAKA 4JYAF 2VZ9A 1CGPA 2W48A 4Q2MA 1YYVA 1K6OA 3IMQJ 3EYYA 3OQ2A 1RGVA 4B3XA 3AY0A 1ZAVA 5AE3A 4ITSA 2UUAJ 4IG3B 1AYEA 4LGWA 1TUWA 1B9NA 1SJFA 1HQEB 1NDLA 2I6WA 3ZZ0A 4LBPA 3CDUA 3C6UB 1WORA 3OTBA 4YP3A 3SEZA 4YDXA 3HSDA 5C25B 2CJXB 4KHMA 2K7LA 2HSEB 5C42A 1N88A 1MJBA 3UO0A 3CMYA 3AL0B 1XGSA 2KISA 3CCUS 1FFSB 1IN0A 3P9IA 3IBFB 3LP2A 2KYXA 3QQAA 3BR9A 3BG9A 4LF6F 2P8TA 4DZ6A 1SFKA 4LF1A 1VI7A 2EV5A 2H6BA 3JB9k 3IH4A 3BCAA 4IQXA 1D9DA 2DT6A 4M5KA 2LQ9A 3TKYA 3MM6B 4KH0B 5E3RA 2H54B 1CULB 2CDRB 3HHHA 4ED2A 1FA0A 3TAMA 5JFRA 1OCZH 5C5JA 4DUZF 1TQPA 5SUHA 1BBYA 3MFKA 1SJRA 2GVDB 2D3ZA 2G7HA 1VQPI 1KQFB 4DG1A 3QSYB 1D8ZA 5DTDA 3EMTA 2X6WA 3JRHA 5HP1A 2IVYA 3IV5A 1VFJA 3UD3P 4CTAB 3PR4A 3K58A 4EM1A 4IHSA 3LSHA 2R7TA 2CQBA 1TMMA 1KQ9A 4RAYA 1LWXA 5M5WJ 5E0OA 4ZVFA 2CGPA 2KJVA 3GTGJ 4U95A 1WF2A 1PBAA 3HHEA 1EV7A 3TX8A 3D4JA 1IQTA 3ZN1A 3GX4X 1RTZA 1UEUA 1NJYA 4RW8B 4N56A 4QPOA 5C24B 3T5HA 3POTB 3EXCX 3HJFA 4F0HA 2Q6BA 1FEXA 3QP5A 4KFBB 2LYVA 4NA3A 3PZPA 1CG2A 2FMLA 4QYZJ 2CUJA 5HLTA 2C2OB 4DV0J 2B43A 2KIFA 1Z3YA 1GXLA 2MJUA 1U2WA 1RXOB 2HKEA 2HMIB 2BXJA 3HKWA 2FY1A 2MQMA 2ZH6A 3G2BA 1F36A 1HW2A 1PG5B 2JDJA 3RQIA 3RAXA 2E5LF 2OV7A 2V8DA 2WB1N 4YS2A 3PO3J 3NS7B 1GXPA 5BYSA 3T1YJ 3S1RJ 1IUYA 4OZNA 2LFVA 3G82A 2BVLA 3RB0A 3K9TA 4G7ZF 1RLCL 2VKRA 3I55I 2GO8A 1IG7A 4NE9C 3TAQA 4IHYA 4UHTA 5M3MJ 3PM1A 2JX2A 1KLMA 5M5YJ 2RE1A 4PG7A 1WHYA 5L1KA 3HOUJ 4NLSA 2LF8A 2VV5A 4MT1A 3OLBA 3GFLA 2HLTA 3CJNA 2N82B 5FO5A 1HL6A 4LVNP 4C7QA 2OTLI 1YW9A 2W4DA 3CCES 3OL3A 2LCWA 5K5RA 1PUEE 1TQLA 4B9NA 3HZJA 1R6VA 3T5JA 2SXLA 5H6RA 4CO2A 3RJPA 4MH8A 3VDXA 5E1WA 3KE2A 3D1QA 1G3YA 3CUQC 1BE4A 1RC9A 2HQCA 2DB1A 3PFEA 3NBPA 1KQGB 1SKRA 4PRFA 3QIPA 1IV6A 2QN6B 4DPOA 2KP6A 4G6VB 2MZ1A 4ECVA 4QWDA 2BY1A 1Y3JA 2MMYA 1N36F 3M2RB 3DOMA 2QSGX 4K4YA 1YIOA 3BGRA 4C48A 1R27B 3Q83A 4CO4A 4BHBA 1DRZA 3FKJA 3U1NA 1P6TA 2NRAC 1ZPWX 3AOBA 4DWIA 2LKPA 2DJNA 1XX5A 4ES2A 4RX6A 1N8RT 1XSXA 2B0LA 4XQFA 2FJ1A 2DQRA 3BTLA 4EO6A 3KYCB 2RAEA 2M9HA 4XRSA 5A8RA 2AIRB 2K40A 4FT8A 2EG2A 2HVDA 2GBYA 3U1MA 3W61A 1R9TJ 4N0BA 3G86A 4XORA 4QIEA 4O23A 2LKZA 1ETQA 2DMQA 1B99A 2OPSB 1Z05A 4EATA 4DYQA 4AD6A 4B3RJ 4ANEA 4PAAA 2ESHA 4NXNF 2HHTA 2OTJI 4ZIVA 1RAHB 5HBMB 2Y0MA 3HFKA 4ESFA 1IRGA 2GMJA 1ZYQA 3E6CC 2UVVA 1HNXF 3ZQGA 2VQFF 3DQVC 2F5CA 3MPUB 2HS5A 2GIQA 1HNZF 1FRJA 3DXBA 1RT4B 1JT0A 2P2CB 2XGPA 3GG1A 2LP0A 1XNRF 1ZAWA 2VFVA 2NQPA 2VJVA 4F93B 1QPMA 1DZ5A 2K27A 1KP6A 1T9YA 3IS9B 2E7VA 1V5EA 2FOWA 4JV0A 4KJIA 1R1UA 5ETQA 2DK2A 3DPLC 3ETOA 2PG4A 1T3NA 1VS3A 3H92A 1X4OA 3CPWR 1CEZA 5IM0A 1ZKGA 3SDGA 2DR5A 1QHHD 4C3KA 2ZNZA 4MNUA 4BAYA 3WTYC 1UJ4A 1SD7A 4Y2AA 5C3EJ 1QA6A 1RESA 3V42A 2FBHA 1VLOA 3GU0A 1CF7B 2VBZA 2HHVA 3N4MA 4UW2A 4L3KA 1UA0A 4OX9J 2L02A 3MKLA 2EIMH 2GWRA 2F4MB 1U1QA 3B82A 1RP5A 3KZZA 4QIVA 3MPWA 3MM8B 3WG9A 3UI3A 2UXCJ 4N4NB 2BABA 2HKOA 2DO7A 4HLXA 2FB0A 3CDIA 4XMYA 4WE1A 1TKTA 4O3QA 1P4WA 3DC2A 2IAJA 1ZG1A 2IGMA 2QTWA 3HB9A 2XWYA 4Q8EA 3DTEA 2O67A 2HNZB 3DEUA 3FF5A 1S59A 4EM2A 2NAZA 3GCWP 4K2EA 5D6FA 4FX4A 1KFSA 2HVZA 1KOOA 5HMXA 4IJAA 3RKWA 2F8EX 2A6OA 4ZJOA 2E2HJ 2EPIA 4F36A 5DETA 1JXLA 2M3AA 4C0BA 3K4BA 1VQMS 2K4JA 1LOUA 1W36D 3RRGA 2RD5C 2UXXA 4PKDB 3HVRA 1U47A 3H2UB 4CLUA 4AL5A 3OFHA 3KLEA 1WKLA 8ATCB 3CJTB 3VZHA 4NRTA 3ZQLA 1EF4A 2MKIA 2KL8A 1P7IA 5CVRA 2DT5A 2QQ8A 1E6YB 4RBTA 3HSEA 3I31A 2UUCF 4FX0A 2CV1A 1UB9A 3QRFF 2DNKA 5DCFA 2W57A 3CLQA 3TW6A 3ZTOA 2VG6B 4IOAF 5F8MA 3KG0A 4DJBA 2V4JB 2PI4A 1VQ6S 3UPFA 2CG4A 1QVTA 4RNOA 5AONA 1S9FA 3UCUP 3QO9B 1IGNA 3B54A 2R4GA 2FC8A 5D8KB 4MFBB 1FY7A 1S72S 1G7CB 2OKQA 2P9CA 1EH7A 5KAFC 1N5QA 2V63A 2YUSA 1Z0XA 1FI4A 2ISZA 1T05A 2X1GA 2DXFA 5HNHA 3IR5B 1M5KC 2MQNA 2U1AA 3E3VA 4AUXA 1UETA 1TKXB 3H1CA 1O51A 1YJVA 4L5EA 3RCOA 2V69A 5HQMA 6FD1A 3DLGB 4NXMJ 4B3OA 2B4VA 3CJ4A 2Y0SN 5AXLA 2Z2MA 2QGUA 2DMTA 3IRWP 2ZCWA 1YJNS 3MCOA 4BGDA 2EXUA 1NJZA 4FYVB 3DEWA 3MEDA 3PYGA 2DO0A 5D4NA 3VQTA 4JI0F 1XEZA 3PW7A 2E7XA 4RAFA 2NZCA 4YB1P 4C9DA 1GMUA 3IR6B 3BJ6A 1VBKA 2DR7A 2OELA 3MZHA 2ROEA 4A46A 1FF2A 4DBQA 3R2CJ 1YX2A 5L9XA 4FQGA 1YFHA 2GNKA 4ZP8A 3C6TA 3PFIA 1RWNB 2V9WA 5H1SV 3Q23A 5C4XJ 2L0KA 1LKXA 2VPYB 2Q79A 5KFOA 4DSEA 4E2FB 1HHQA 5IFMA 4B9VA 3I6PA 1BI3A 2FHMA 3RG6A 1HW8A 3MOZA 2W82A 2OEMA 2HDCA 1J0RA 1N0VC 4KISA 4B3SF 4QIGA 3K4JA 1S7EA 2PMUA 4NC7A 2QRRA 1FYMA 2DNRA 3DOLA 2F4OB 2CPZA 4URGA 4WXDA 1SC7A 4ZYDA 1O0PA 3P45B 4ICLA 4JYAJ 3HRTA 4IL6C 1DGRM 3TMOA 5DDOC 3OOUA 3V4MA 1WI9A 3SDEA 2JEJA 2C42A 2DH7A 3TQNA 1H7XA 3ZPLA 3IO1A 1MW7A 3JTHA 2VFUA 3EGWB 3EDRB 2ZH8A 1VQ5I 2RUGA 4ZYEA 3IKTA 1J5YA 1JI8A 1ZK8A 2H3EB 2LKSA 2AZ3A 3H59A 3J7YU 4UY8T 1ZG3A 2XASA 3Q24A 3BO2A 3FSXA 1L3SA 2VT3A 2O8XA 1LFWA 4B08A 2HI3A 2DVIA 3ZTSA 1NCLA 5JVGQ 4X4RA 2DDBA 1V3ZA 2UV8A 3L2WA 4KB7A 5J2PB 1JGGA 2VPWB 3AT1B 2IS4A 1N25A 3CCLI 3OTOJ 1PKUA 1F3VA 4A3CJ 3IM8A 4U7DA 1AFIA 2IJNA 5I4MA 2XAJA 3ZRGA 4M5IA 5I3UB 3CGIA 3I3LA 3HKZD 3CJ2A 4DUZJ 1V9OA 1NHUA 5KFXA 1DPRA 1TW3A 1IF1A 4CDGA 4HTIA 1KDNA 1OSDA 3GV8B 4W4MA 2ZH2A 4MAKA 2OIHA 4HF0A 5DGBA 2L4AA 3D6TB 2ZJ2A 4JYKA 1RKTA 5B0BA 3TBIA 1DPUA 4PYAA 2BE9B 4Y15A 2YNFA 2L9DA 1D09B 2YKPA 1ENHA 4CYUB 1OMIA 3HD2A 1AXQA 1KVKA 2BW3A 3B6AA 2WAQD 4RB3C 2RGVA 3MR2A 4UUTA 3CE8A 3KP3A 3FBEA 2F9JA 1FE0A 1ZS6A 1XDUA 3BR1A 1UCRA 3HLUA 5DZ7A 4BLGA 5DQGA 2ABYA 2H8WA 2CKWA 3RQ4A 2HKXA 3H4BA 1JJ8C 1POGA 1F2HA 3UW1A 2QIFA 3FXKA 3DTKA 3FISA 3TP0A 1JLGB 3MHYA 4RBUA 1Y11A 3H9JA 3H20A 2BYVE 1RTDB 2HTJA 2CZVC 3GFXA 3EGZA 2HVQA 1U24A 1BQXA 4PXEA 3V81B 1W0TA 2JJ4D 2Z30B 3L7UA 4L5JA 2XYPB 4KV8B 3R6SA 2HQ3A 2AJ4A 1TFYA 5J1UA 4GFBA 2GMHA 2BJ3A 5E5NA 1RLDA 1VK3A 2HEOA 1VGYA 2FD2A 1WKMA 3VAKA 2E5LJ 1M1EB 4DYCA 2G2ZA 5IT3A 2R0QC 1KA8A 1HBNB 3I59B 1PC5A 1VC5A 3OYEA 4XLNF 3ZTQA 1FEHA 3W2WA 1KR4A 1J5EF 4HL9A 2ZH4A 2D7SA 3LPYA 4DYRA 2BHYA 3RR8A 4F7VA 2MQPA 4RB1A 2FLLA 3HOXJ 2ETHA 4N47A 1Z6RA 1S9GA 3VB2A 4ZTJA 2TDXA 2VPRA 1F43A 2Y9ZA 5H20A 4RW9B 4DF4A 4JX6A 1KQ8A 1HQEA 2HS3A 3ZQHA 5DQHA 4P5OA 3HT0A 3JRFA 3C6UA 1YLXA 1UFMA 4L74A 4V19K 2CJKA 2XG8A 2MSTA 5LXYA 2ZMEB 3N6LA 3G4SS 5CVJA 1K78A 4C8OA 2Z58B 1RRJA 1BQNA 2OQRA 2LBFB 5DLGA 3BH7B 1FJEB 1V5FA 1ZHFA 3L7WA 4KICA 4RU9A 2HVSA 1ZAXA 3JRDA 2K3FA 3WDOA 4FPIA 2JH3A 2HGLA 2EFWA 1RAGB 3FK6A 2FE3A 1D8KA 3I5CA 2DRDA 2ZBKA 2N4CA 2ZVSA 1T39A 3GYXB 1T0FA 2J6SA 4B3AA 3CIMA 2ADCA 3CJ3A 1SUQA 2E1OA 2R8KA 1RAFB 1YOVB 5EG0B 2ASYA 3GR0A 2ACJA 2FJBB 1FKOB 4WXCA 3N28A 4O44A 2KLOA 1TL3A 2LNBA 4DGWB 2E35A 1FWPA 1YHQS 3HPGA 3S7RA 4F4XA 5KT6A 2RUSA 2GCFA 1PJRA 3PX4A 2HHQA 5E3CA 1VRUB 2FLNA 3KP6A 2ILYA 4LSNA 1USSA 1R22A 1SL2A 3U9GA 3FHNA 1B72A 4ZVTB 4U8YA 1W1WE 4DQSA 4KN7X 4CUGA 1C4AA 4IRDA 3DWLE 1Y0UA 4B3TF 4FVCA 2HQ5A 2ZH1A 3WX4A 4TLQA 2Q2EB 1FRKA 1WSVA 5ETMA 5AT1B 1WOOA 3BZQA 1MWQA 4NHJA 2JSCA 3HM5A 2DA7A 5IP7J 4NXNJ 4XKCA 2L4MA 1IM4A 1B9MA 2W1BA 2OC6A 4N8NA 4AXIA 1VC6A 3ET6A 2FJWA 4WP9A 2XSFA 3BGOP 3OL9A 3FEYB 4LG0B 3VFZA 2JLFA 3ESWB 3GIIA 2BQ3A 1HSJA 1DTQB 3GMEA 2NZ4A 1R6YA 1XNRJ 3S1TA 2UVRA 4I68A 1WJBA 1QSSA 1LWCB 1S57A 2HMIA 4OYXA 4DI6A 5AXKA 2R7WA 1OPCA 1Z3XA 4MEYF 5HVGA 4A3BJ 2DGXA 4MGRA 1ZQ3P 3GWCA 4B48A 1WPKA 1HYSA 1U0HA 3PW5A 3VAHA 3VGSA 1C1CA 3DFGA 3MFHA 2OQGA 5JLWA 2WHOA 2EFQA 3G1OA 2M8DB 1IDYA 1VR6A 1YITS 4Z7CA 5L1IA 4A8WA 3TJ8A 3TNVA 2PMHA 2GV1A 2HRTA 1NK0A 2OAZA 1WQ2A 4L76A 1NSKL 2Z57B 4PXDA 4LT6A 1TUVA 2DLLA 3R60A 1BI1A 4XLHA 2A6TA 3GW2A 3DP7A 4O3MA 4HBLA 2PC6A 3MPVA 1T11A 3DLBA 2DHSA 3TO9A 3F56A 2AP6A 2ZZNA 2XPWA 3GFMA 1U5TA 2M88A 4DDFA 4OYZA 1R0CB 2MKSA 4OIRF 3RU0A 2ILZA 3OV7A 3G1MA 3CJ5A 5HS8A 2Q1ZB 2GA2A 2EA4A 3H98A 3S1NJ 2F8MA 3R7SB 3RGIA 1MLAA 4BJ6C 1CQMA 2BKOA 4ED4A 4L9JA 4XONA 1RA7A 4J9VA 3BY6A 1UW4A 1EHWA 2KXNB 4XKBA 5IY5H 1N77A 4UVCA 3V6KA 2PN6A 2EV6A 2ATCB 3PXGa 3D1OA 4GMKA 2EBEA 1JWWA 2XMTA 3K1NA 4V1Ak 3KHGA 1R0BG 3MR5A 1TWAJ 2BY0A 5IP9J 1Y1WJ 3AODA 3BM7A 3J81Y 3C2HA 2OPQB 3VGVA 5JLXA 3BJYA 2L9SA 4A3JJ 4I0AA 3GFJA 2AT1B 4JI4J 2MLZA 4ZPBA 3QLHB 1U1OA 2KIMA 4CI0B 4MK8A 4Y6IA 4ZITA 5L1LA 2IYIA 3CC2I 1JLFB 1REVB 3KK3A 1Y0HA 1YE9A 4H0EA 4ECTA 1QLNA 5KG0A 3R5BA 2JZYA 2LYCA 2BEOA 4UY85 2DRBA 3S3NA 1IXKA 2B6AA 4ZLNA 3NGKA 4CH1A 1FVQA 1R49A 2YH1A 3TVYA 3OS2A 3H9QA 2DOEA 2M7SA 3FSIA 1XMOJ 4ZDOA 4Y13A 2OPSA 4F0MA 1ZRDA 4RW6B 4F4AA 2CFOA 4MIBA 4ETXA 4FXVA 3PNIA 3K1MA 3J7YJ 3KOAA 2EFNA 3NAUA 1CJTA 5HBMA 3FRYA 3IHUA 1YJWS 1LWEB 2G7UA 3OPKA 1SAXA 3ICLA 1FO1A 4DSIA 2KHMA 4L3NA 1EQMA 1SPBP 2V4QA 4LFUA 4TY9A 1FNMA 2PMZN 1D3YA 1RT4A 3IKVA 4KO0A 4LK1F 4PYDA 1FYLA 1R8BA 3G3ZA 3HM9A 1QVUA 1ZGWA 1Y8RB 5HMZA 2C3OA 3BQ1A 2LXIA 1YJUA 3EUHA 3IS9A 3F0NA 3QZ8A 1VC0A 1Z67A 2ZSIB 1LEOA 3W9JA 3AFGA 1HNVB 3WQPA 4YMEA 2OUMA 4QSHA 2VDIA 1SFUA 2E2JJ 4XLCA 2R4FA 2CH0A 3FMQA 1NK3P 4PGHA 1XTZA 2CJYB 2W7AA 1U4BA 2XLKA 1HW1A 3EVWA 1GXTA 3CCZA 1MN9A 2QLZA 4C3IJ 3SSRA 2AU0A 2M70A 2W84A 1M1GA 4FYDA 2HR3A 1I6HJ 1GK8A 5B0EA 3OVAA 2NS8A 2GJFA 4PCQA 4KYWA 4IO1A 1VQ8S 3I87A 3MM8A 4ID5B 4DV7F 4HDHA 2K1RB 1NKCA 1JLEA 4O6JA 1VQKI 2VFRA 4DFKA 1U7LA 4GYGA 5D4LA 3SXLA 5DG9A 2VI6A 2ZVIA 5ETOA 5EUHA 1V3SA 4FYXB 4KHRA 1MBJA 2MLGA 2PI0A 3P5BP 3KETA 4ECUA 5RUBA 2WY7Q 3CCSS 3M9NB 4KTQA 3K5OA 1NK7A 4ES3A 1NHAA 1JJHA 1NJXA 4C2UA 5GMEA 1XR6A 3D0IE 4HNTA 3NWTA 3L9ZA 4RUBA 4LVOP 1U78A 1SMTA 1IJWC 3BTCA 2ROGA 3UNGC 4ZVEA 3HTUA 4HEA9 4GC7A 7FDRA 2QBYB 2HHWA 4LF9F 2R8GA 2Y69H 1X1DA 5JR3A 4FZVA 3OXLA 2JWTA 3OTCA 3F8BA 3BPVA 4WF2A 2I5JB 3OFGA 4OZ0A 1A0OB 3HHGA 1UEKA 2IC3B 2ZWOA 1U6FA 3TR5A 1V5IB 4UY8I 4OQJA 1NHKL 4N9HA 1FKAF 1XR5A 2DTRA 5FLXU 3MAAA 4FP9A 4Q8FA 2C2MB 4QW8A 1WVRA 1F5CA 4D7MA 4A3IJ 1YQHA 1DTTB 4JV5J 2H27A 2KPMA 3MM5B 2JRSA 3QO9A 1M90T 4AL7A 3CDLA 2RU3A 1S99A 1UZCA 3FXRA 1LFBA 1P9YA 4OMFG 2GX8A 4RLEA 1X9MA 2F4FA 3CLOA 3AD9C 1NK8A 1J27A 2AGQA 1FOXA 1TKXA 4YOEA 3LAPA 2DNLA 3C14B 3AOAA 2UZAA 4G94A 2DGQA 2VPZB 2XDVA 1SD6A 1B59A 3DLGA 3L1PA 2KVIA 5E3PA 4ZN1A 1JKHB 2P6SA 3BWGA 5H9FK 5KK1A 5A8WA 2GXAA 5CYMB 5IT0A 3MM9B 1OR7C 5A2QU 4BC7A 1UVLA 1FTTA 1FESA 3M1EA 1VHFA 3KLFB 4F02A 3IBWA 1OPZA 1IW7F 3PKMA 3OR1B 3JREA 2F4IA 4DPXA 3ENQA 4YN3B 3FIWA 3AG1H 2ACYA 4PUOA 1Y3KA 2YSRA 1R4NB 3EZ5A 3AOCA 3GFYA 1F1BB 4MQVA 1HDDC 1X3WB 3UN3A 1JXSA 4BCAA 3O2PE 2A1BA 2XULA 5DDQC 2RRAA 1EIYB 3CCQS 1UVKA 1PILA 1J2VA 3ELHA 2V4RA 3K4MA 1LW2A 1NTCA 2WCXA 1MBFA 2JA2A 4Y4RA 5IYDJ 2OHDA 3HOWJ 4DL5A 1D1UA 4EZ9A 1J7KA 2X6YA 2IVFB 5BR8F 4OYPA 1PDNC 2FJVA 4E7IA 1HQCA 1FP2A 1HW5A 4OYIA 2F4VJ 4PZJA 1B3TA 2EKYA 1FKPA 4ANJA 3V7CA 2ESNA 1J5EJ 1D9FA 2M0GB 4ES1A 2QSWA 1O3TA 1X4AA 4OZJA 3BYPA 5D3GA 3K59A 2M2EA 1XJWB 5I42B 4PABA 3CCJS 2RHQB 1D0EA 4ED3A 3BJAA 3MWMA 3MWBA 4V2GA 2O66A 1M5OC 3FZVA 4P2FA 3P9CA 2X1CA 2E5HA 2XPVA 3ZXWA 2NXNB 1JJCB 2YKMA 2E60A 2MHNA 1NEEA 4HA8A 5IC4B 4A47A 5CZVA 1LEAA 4KIFA 2EWHA 3QPSA 2DJIA 2M30A 3OL7A 3ISNC 1SFXA 1RBLA 4DL0C 1UAAA 2H4WB 2YPZA 2LDYA 3DRRB 1WH5A 1HLVA 1U1LA 1D0YA 3S8SA 4C2TA 1ULYA 3AFHA 3FM5A 2AO9A 3P5JA 1VQ4S 5J2PA 4YFXF 4C8MA 1SAUA 1MMLA 3OMYA 1Q16B 3LA7A 2K8GA 1VFCA 3JSOA 4XDDA 5B0GA 1BC6A 3B4DA 4U7CA 5F0WA 4U7UD 5I3UA 3MDFA 1JNRB 4L73A 1OQ6A 1XMAA 3DGPB 3L7PA 1KSPA 3GZ7A 1Q4RA 1MMGA 1MNMC 1PIEA 4EVIA 3FKBA 4I56A 4DZDA 3HOYJ 5GAGI 2NVTJ 4IOCQ 3EDQB 1EJ7L 5BYRA 3FXUA 4ETZA 4BWJA 1MSEC 5HLFA 3GQCA 2I10A 1A04A 4HACB 2O61A 3PJRA 2O03A 4CYDA 1F0XA 1RAOA 1NG7A 2E5JA 2PA3A 1T8IA 2AQFA 1S3JA 2ERRA 2L5QA 3JTPA 2N3OA 1Y1VJ 2EBIA 2HNDB 4HT7A 4HSTA 4K4WA 2BBYA 2A5YB 5EN1A 1WC6A 1EX8A 3AL0C 3OS1A 4DHVA 4I6ZA 4PUSA 4WFBQ 4QCLA 5K8MA 1MU2B 4IQMA 3N9UC 4MIAA 2CZ4A 1WF1A 2NVYJ 4GCVA 2KT3A 4LRCA 1WSRA 3VGUA 3U21A 5LHGA 3ZMVA 1HIYA 4C3JJ 2O6GE 1T0FC 2DPJA 4L9TA 2QM3A 5EDWA 2BKNA 4KV8A 1HD1A 1XR7A 4QIWN 2KFDA 2FQ4A 4DR2F 2XHWA 4P2XA 1VQ7S 3QGGA 2IP2A 3VVUA 3A8EA 3EUAA 3F21A 2MQQA 3CC4S 4X65J 1KTQA 3C1DA 3I0SA 2DW4A 3HGYA 3ML6A 1XS9A 1HBNA 2LMIA 3I96A 1LXJA 1QO0D 2BVZA 3P9KA 2XO7A 1GHCA 2WB1A 1IKXB 2KFNA 2W85A 4IRIA 2VBWA 1R71A 4LR7A 1EETA 1MMNA 2ZWPA 1FJGJ 5EWFA 1TAUA 2R7XA 3OYJA 3KMSA 2LQ5A 3OYBA 2AYEA 5ILVA 4L0YB 2DH8A 4U7UK 3K57A 1ODDA 1WJDA 2V34A 4XIUA 2EA2A 2H1YA 5KFGA 4KIBA 1QSLA 2BY3A 2XF6A 2IM3A 3Q3SA 4E7ZA 3Q0AA 3R5GA 1FWZA 3T1HF 4G6TB 2PFBA 4P9SA 2M52A 3A8KA 4NX9A 1S6PA 2KDOA 5EEGA 3PACA 1BIAA 4G1QA 3R8YA 3WIVA 2YVSA 3F0CA 2WVFA 3Q5FA 2HEKA 2LBFA 3PSFA 3BZCA 3DKXA 2IEKA 4Y52J 2NS0A 3HJEA 3BYRA 2Z33A 5BPDA 1M5HA 3R2DJ 2DNOA 3G71I 1RI7A 1TL5A 3CCWA 4P2SA 5E8IA 1UTAA 1CJKA 5CPRB 3MGJA 2GGPB 1H7WA 5T14A 3L00A 4M5HA 1T9TA 1X3UA 4OHZA 1WJAA 2KKOA 5GTIC 4DR1J 1B8IB 1I3AA 2FVQA 2VKZG 1WHVA 4OX7A 2IS2A 4LF7J 3SXYA 3BO3A 2VG5B 4RAGA 4CH7A 4M9XA 2MZQA 3AAFA 4CNYA 2EZIA 3FSYA 3PNVA 3CDBA 1FIPA 1I1GA 4IHTA 5L39A 2E71A 3BG3A 1WDDA 3S2HJ 4Q44A 1LE8A 1FKOA 1FHTA 1OYIA 1H6KX 5H9EJ 4U6PA 2QGFB 5KFBA 5JI6A 1H73A 1NO8A 2YWHA 4PG5A 4GO7X 3DLJA 2JFDA 1OCCH 2BE7D 1ZM3A 1RBAA 2IBOA 3CDEA 1GVJA 2LY9A 3D3CJ 3U2RA 1Q82T 2E9RX 4NQWB 2YWGA 4P96A 4DCJB 2V6EA 2LU2A 3DPUA 4DU8A 4DSFA 2VA2A 2BGCA 3TW7A 3OR2B 2K9NA 3QOEA 5KHDA 3BCBA 4OX6A 1R8AA 4ZDLA 4EQQA 2FX0A 4LG0A 3ZNJ1 2VE8A 4I7FA 2MTLA 2E5ZA 3EQLF 3DLEA 4C0OC 4FE7A 1DTQA 2YNHB 2HZCA 1B7FA 2XC7A 4I4BA 1LWCA 2C2ZB 5ICGA 2Y9HA 1H89C 5FD6A 4KPYA 2MZSA 2PDAA 1D0ZA 3LPEA 4RLFA 1GX5A 4ESBA 3UDCA 1JNZB 2DCLA 2CW0F 1N34J 1U25A 3OYCA 2LXUA 3A0HC 1VQNI 1RZ4A 1YJTA 1KONA 1C0UB 2GQCA 2RQMA 4PJLA 3IFEA 2HIQA 3ZQIA 3DCAA 1EA3A 1YIJI 3QJJA 3J7ZT 3E6BA 3TO6A 2RC4A 5F8JA 4LF5J 3F41A 1MJAA 2WONA 5E18F 2AHOB 5JUMA 2AJ2A 2WVCA 4KUMA 2AXTC 3CC7I 2M9KA 5A76A 1XSDA 2CAJA 2DDAA 3LAJA 5JHUA 2OD4A 5KFWA 1HWIA 1TV6A 3PW0A 1HDPA 1AA7A 2E19A 2E1AA 3PY8A 3DBRB 4CLFA 1V3RA 2W7NA 3H3VK 3E01B 3PDNA 4J37A 4LLLA 3MEEB 4C98A 4C2MA 5DYMA 1DAXA 3HPOA 2KXHA 1U0JA 1RWVB 3OYDA 2GM4A 4UUVA 4LRFA 5HVHA 5J47A 2J9DE 4RB0A 4I0BA 4DV1J 3BSNA 5DG7A 2O5DA 2ATLA 3ZQ7A 4XN3A 4KITB 2LQ8A 3EYZA 3RAQA 4IEJA 2O9LA 2K2PA 3CCRI 3KYLA 2ZJQQ 1RT2A 2XC9A 1HXDA 2Z3YA 1YJ7A 2LQBA 3AD7C 2XLJA 4NL5A 4LRAA 2JEFA 4U88A 4ZIWA 4XBFA 1NDKA 2WV1A 5D15A 4LF9J 2IDEA 2KM8B 3Q22A 2CV2A 4HHHA 2W9BB 1FRIA 3TEGA 4NPOA 1HA1A 1F9NA 2XZTB 4LF4F 1FJ7A 2H51B 1TWCJ 1LDKB 5GP9A 3E5QA 9ANTA 1F3FA 4LRDA 3D1NI 3S14J 1WC5A 3FFIA 5JVGF 1UZDA 2DGOA 1OY6A 5LMUJ 1TKZB 3IN5A 3MKZA 1N54B 4W1UA 3HC7A 4AM3A 4Q2LA 1B0TA 1M5SA 1XERA 4USIA 2W8LA 1WSUA 2HZDA 2DK5A 5JVTA 1GQEA 4PFOA 2KHCA 1TP7A 3W6JB 5HODA 4A4JA 1GVDA 3HXMA 1NKBA 2HZVA 3M1VA 1R4MB 5L9NA 3KXDA 4HW0A 1LWEA 5DM6Q 4TU9A 4YHHF 2M7AA 4GRIA 2X1EA 4WYWA 4IFVB 1AUDA 4RPFA 5K8PA 3S2WA 2JSXA 3HDDA 1VHIA 4AXJA 3BTIA 2X9DA 1XMQJ 1XIQA 3H35A 3KP7A 2EV0A 2W2OP 5HVQC 3LAKA 4UV9A 1LDJA 1HQ2A 2IRFG 3M8ZA 4ED0A 1GDTA 1YRTA 1JUMA 6FDRA 4EU0A 5FFXA 3QRQA 1V6HA 2FLPA 2O7OA 5CVVA 3SSQA 1CC8A 2H65B 2OD6A 2OZUA 3WGGA 1Q8LA 3TZYA 3WC0A 3I9V9 2P81A 1IKWA 3R5AA 4ZKAA 1RU1A 1B0PA 2D41A 1Z91A 2E2IJ 4NCBA 4M5NA 3W7BA 4O4GB 4MFDA 2V4JC 1WF0A 1HKSA 1IUFA 2X7IA 4G9YA 3JW4A 1Y5IB 2N8GA 2L3MA 3DBLB 2JFKA 2BJEA 4OYBA 2W01A 4E70A 5BR8J 4HI1A 3QU6A 4X6AJ 2AWZA 2K1RA 4QTRA 2FPHX 3MI7X 3NG8A 3B6CA 5GADU 3BBFA 1GXQA 1WJ9A 2FVRA 4H54A 3QP6A 5C42B 3GJQB 4ZVSB 3R0JA 3BGLA 2HFSA 4N7TA 4J9UE 1P27B 3ISND 4DX6A 2LTPA 3D5LA 2EC0A 1Z9CA 1W4MA 4UT4A 3FBCA 3H5XA 2FHOB 2OEJA 5AXNA 3CT9A 2HOSA 2I0XA 1EQ0A 2GAHC 2G4BA 5AIPA 3CULA 1TK5A 3A01A 4TQRA 4ELVA 4M3BA 2XAHA 1VQPS 2R5YA 3PQKA 4HF1A 2C2KB 5LRSA 2QBYA 4YR2A 2LFBA 4YR0A 4JI8J 1HBMB 4OOIA 4RUCA 3OSGA 1UL3A 2BACA 4JI7F 4JI5J 2I5JA 5E1XA 2RHSB 4NLUA 2HWTA 1E3OC 5MAOA 4OHXA 1HI8A 5KFUA 1U8RA 4HNUA 3H40A 2HWIA 3K5MA 1P1LA 4KAIA 2VJ4A 5AE2A 5LSLA 2XMJA 3CIZA 4NB5A 3ECOA 1K6YA 3M6XA 2ME0A 2HXOA 2YU9J 2EJRA 1WJCA 1U02A 1RQ0A 2CQCA 4YIIA 1X9WA 4DR7F 2FZGB 1NH3A 3WU2C 1IAWA 3LNQA 3ILJA 1HNWF 4R79A 3ULQB 1YRNA 3OV8A 4U96A 4OYMA 2Z2ZA 3REOA 1IRXA 5F8NA 3EX7B 4N9IA 1K61A 2CUZA 2KT2A 1FNOA 1H0HB 4BQOA 3A0BC 3O2IA 3VAGA 3DNCA 3TWZA 4LIWA 4G65A 5FLXK 3ENWA 2L01A 1OKRA 1I3OB 4CZZA 4OYWA 3IRXA 2WADA 3SYZA 3JAMU 1Q5YA 3ONQA 1QZZA 2WWYA 4HTJA 1QJHA 2GHPA 3FK7A 1ZZNA 2DRAA 4KKOA 1JB0C 3TOBA 1AU7A 4DSLA 3BQYA 2NNYA 3W66A 1SKWA 3I55S 4FF3A 3PHEA 4FNHA 1Q7YT 1N75A 2HWHA 3A8JA 4ZVOB 2RKIA 2WTEA 4NC6A 3IWXA 1ZTWA 2QLWA 2XKOA 4G7HF 3CMEI 1UVJA 1S1TB 2XSJA 2BE5F 2HBYB 5HLGA 1KLMB 3ZGKA 4PG6A 2VQLA 3F3XA 2HBRB 2OTLS 5A2QK 1SI9A 1ZM2A 1O7LA 2R7RA 3TP3A 4S05A 3MFIA 1APLC 3OJUA 3DXJF 2AW0A 4FASD 1FTZA 2BRLA 2QLBB 3C2PA 4HH1A 2R5ZA 3W6VA 3JXOA 1FT9A 3PL8A 4BJ5C 1SCJB 4U0WA 2C28A 1OYWA 1SBRA 5K7ZA 1NDPA 1T02A 3Q8YA 1JTXA 3CO6C 2M0MA 2HVRA 3MECB 2LREA 4G8XA 2VL8A 1V5VA 3DRXA 3BKUA 2F2EA 4O3OA 3OYNA 4LRBA 3QODA 3T9ZA 5LGTA 3UDEA 3NBPB 3IRRA 5DCMA 1USTA 1NMEB 2XF7A 3QIPB 3BN7A 4MJKA 2NXNA 3KWMA 2E36A 2W9AA 2RNJA 1Z2LA 1CSJA 3LL7A 5IOZA 2VBXA 3DOMB 4NZ7A 2ECCA 3BGRB 1S5LC 2B7BB 5F9LA 1IBLF 3PM9A 4D9JA 2MQOA 3HHLA 4D7NA 3SZTA 4P74A 5ETVA 3KLHA 1NK2P 1HHSA 4JBAA 2O3FA 4FN5A 4ZN3A 1RT6A 3KG1A 4A8XA 4C8ZA 4I1TA 2YWWA 4DR6F 4E0DA 5HK4A 2E1CA 2W8KA 1S4EA 3WIUA 1GTEA 2OMOA 2ZBPA 3MMJA 3GTLJ 4KDPA 5D4PA 3LA2A 3C15A 5A8RB 2DR8A 1XMKA 4DX5A 5KT5A 4K0KJ 3HG9A 1XK8A 4HDGA 4YR3A 3V6JA 3EGNA 2LLKA 2MA3A 4CM0A 1X2NA 2KMUA 5BPIA 2Y8WA 4Y33A 2OJ3A 2H4YB 2Y75A 2J7KA 3FMRA 1A6IA 4R8UA 3MMBA 5L3DA 3HVTB 1C1BB 3K17A 2N7CA 3AHPA 4OI2A 2JVHA 3ZMZA 5L3BA 4DN9A 1FSHA 1IKYB 4WIIA 1P1TA 1VDHA 1K0TA 4GC6A 2ZMEC 5F04A 3VAFA 5IT9U 5E3OA 5F0UA 2VBYA 4P9FA 1TC3C 3LSGA 2H1KA 1NH7A 1XNQJ 2F5DA 4OIOF 1REPC 5LL6d 1N32F 1BWVA 3DLKA 4CQ1A 1IR1A 2BANA 1L5UA 3VVTA 2YU3A 2RS8A 1MU2A 2FHKA 1ZGJA 4LD5A 2RVCA 1EKRA 5FB2A 4ZJZA 5KG4A 1BI0A 2ICWG 2NNNA 3RPQA 2J5OA 4CIOA 4LFBF 2MQ8A 5DJBA 3N79A 3J80U 2IMOA 3KK1A 1GV5A 3T8TA 3U27A 4ZHRA 5E7OB 3AD8C 2VUMJ 4XK8C 2VQEJ 1Z1ZA 3L7OA 3GPAA 2XZDB 4Z37A 3GZNB 4IUFA 2DHGA 3RI4A 4GO5X 4CH0S 3GO5A 5J2QA 3TYTA 4WE1B 3DDIA 1TKTB 3GF2A 4JI6J 1U6GA 2IAJB 4BY7J 4DL6A 5L3EA 2E5GA 4FHTA 4JBCA 2C3PA 1MWYA 3J7AY 1H2VZ 3PKYA 3TARA 2AJ1A 2XI3A 5ERIA 3GTMJ 5TGTA 4IHVA 3J7ZI 3BOQA 1ZBTA 3M7VA 5CA5A 2FIUA 3QT5A 2JVRA 4CO5A 2QKLB 1Q8IA 3HDSA 5DM7Q 3GTQJ 4NLPA 4M72A 5AJ3J 1UEVA 3D1HA 2EB7A 3RUBL 1QD1A 4E7LA 4RWXA 3MR3A 2BRKA 3NGRA 3S17J 5LSOA 2BJDA 3KLEB 2RH3A 4ZCIA 3PIPQ 1LWFB 3LP1B 2GGPA 5K5QA 1YI2I 3ENVA 3FJ2A 4ZVQB 3K4KA 1VQLS 4HHJA 1YBTA 2VQGA 3HHDA 2QE5A 2MSYA 3THPA 2CPXA 2NYXA 4RGSA 3DDNA 2VG5A 3WTVC 3LOUA 4AQYJ 3PX0A 1MMSA 4NLOA 2D1VA 1FDAA 2IA1A 1F9EB 3ASNH 2ZFHA 2Z99A 2R7UA 2V2QA 3SFGA 1I6JA 1DUXC 3FKIJ 1FXDA 3VR1A 1T05B 1T7PA 1BOBA 4CO8A 4F55A 1WH7A 4NLTA 4OX8A 5HMWA 2JRTA 1S10A 2P7CB 3M8QA 3WTTC 1S0MA 2RNGA 4Y2CA 4MHGA 2VHGA 1FK9A 1JJ4A 2JA5J 3SFIA 2OSQA 5L46A 1OY9A 3KPHA 1D9AA 4ZMMA 4USVA 1RWWB 2FUG9 4NQWA 3MKWB 2PJRA 4KE5A 2W2PP 1Q78A 4CCNA 1ONVA 3ZMDA 3MEDB 1XG1A 2PEBA 1S1XA 2Y8YA 3TGNA 2Q66A 3KJQB 3GV5B 3OR2A 3GLLA 2XS7A 3GONA 3JSRA 2P7VB 2IYGA 2XGCA 5K1YA 3BQ0A 4YHHJ 4WTOB 1M5VC 3O5TB 4LB5A 5GAHU 1ZYRF 1F5AA 1IWGA 4M5MA 4LF8F 1F4KA 2DA5A 2ID3A 4A3KJ 1KHVA 2J9CA 2GZWA 2J7WA 1RR7A 2HAFA 1IXCA 5LMNF 1TU0B 2YNHA 2PMZA 3C6TB 2GXBA 2DGWA 3AG2H 1TR0A 1NHVA 5THWA 4ENNA 5KG3A 3O44A 4AL6A 4F4ZA 2GXGA 3LOCA 1JLAA 2M45A 4PXBA 2HPUA 2RS2A 2BUNA 4ENJA 3RKQA 3KEOA 2PA8D 4BHCA 2E1RA 1S77D 4DL3A 2GJIA 5LLQA 1FJCA 2KFYA 1IBKF 5FFZA 2KT0A 1KQKA 2XCAA 4X4UA 2E9ZA 5HJXA 4A0ZA 3OL6A 3M9MB 2H5JB 3SDEB 1VQ5S 3S93A 3DOKB 5TJJA 2HXIA 4HEA2 1TBXA 3GE9A 4Y3CA 1MBGA 2QO3A 3L3CA 3PEHA 5D0GA 3HYIA