2KDOA

Structure of the human shwachman-bodian-diamond syndrome protein, sbds
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
252
structure length
252
Chain Sequence
GHMSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, dynamics, and RNA interaction analysis of the human SBDS protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Ribosome maturation protein SBDS
total genus 57
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2009-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01172 SBDS Shwachman-Bodian-Diamond syndrome (SBDS) protein
A PF09377 SBDS_C SBDS protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.900 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2kdoA02
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kdoA03
3.30.1250.10 Alpha Beta 2-Layer Sandwich Hypothetical 12.0 Kda Protein In Nam8-gar1 Intergenic Region; Chain: A; Ribosome maturation protein SBDS, N-terminal domain 2kdoA01
2L9NA 1ZM4A 1VI7A 3EXCX 4M1KA 1ZM2A 2I0XA 2ZITA 3E3XA 3LH2S 4MYTA 3UI3A 1ZM3A 1P9QC 2BM0A 1ELOA 4QR0A 1KTVA 3ZZTA 2E1RA 3B82A 3B78A 2J7KA 4ZCLA 2CVEA 1N0VC 4MYUA 2KDOA 3ZZ0A 4ES1A 2BV3A 1ZM9A 1U2RA 2WBMA 4ZCIA 5G4DA 4ES2A 2NPFA 4QR2A 4QR1A 1T95A 1ZPWX 2IVYA 4TNOA 3B8HA 1NYNA 2I8EA 4ZCKA 4MAKA 3OQ2A 4ES3A 2XEXA 2BM1A 1N0UA 2EFGA 4ZCMA 3ZZUA 1FNMA 1DARA 4FN5A
chains in the Genus database with same CATH superfamily
4OL8A 2FLOA 3TUJC 5GAHI 4FKXA 1MZBA 2D5VA 3DFEA 3S2DJ 1B99A 2E66A 3DRSB 4ZCLA 2KT5A 4MH8A 1VQMS 3VCDA 3IS9A 2HQNA 3OT9A 3ISZA 1RTDA 4BJ6C 1UW9A 2Y0SA 3KE2A 3DXSX 1F5CA 2O8XA 2Y30A 4DR6F 4NLYA 2AQ4A 3MAHA 3WHIA 3OL7A 2I5UA 5LJ5Y 3ABLH 2LKSA 5I42B 1KKHA 3DWLE 2NOJB 3W2WA 1JUSA 2KISA 3DI6A 2HZDA 2CJAA 1WI9A 4DCOB 1XN9A 3HD1A 3AQOA 1PGZA 3BSCA 2QKMB 2POKA 1U9NA 3SEQA 5DUKA 3G4SS 4Y2MA 3O44A 4ZP6A 1S77D 1RUSA 3T1YF 2KZZA 3HC7A 5KG1A 3RB3A 4X65F 3I0SB 4BEHB 2F7VA 4LSNB 2DOAA 1FK9B 2F5DA 2E2IJ 2EVZA 3OV7A 2IJNA 4QIVA 4FCYA 4Z2XA 3H25A 3OR2B 3UQSA 1P9QC 1M5HA 4JUZA 3AJ1A 2B7BB 2DT6A 2WTEA 2NNYA 2HHWA 4M94A 3SZ2A 3MI7X 5HVGA 2KO1A 2DHAA 4EZ6A 4LIVA 2ADUA 2CV0A 2QQ8A 4NLDA 5A2QK 3M6VA 5A2QU 2L3DA 1SH3A 2FHJA 4IOBA 2OSRA 3PV8A 2NXUA 4CWBA 1VNDA 4KIFA 1T9TA 3KLHB 2Z58B 3I0RB 1FI4A 3J80K 4FYYB 2FQ4A 2GA1A 2HZCA 2FEZA 1IQZA 5GADJ 1O3RA 3OTBA 2M5YA 2K3PA 2HRYA 3QFHA 3KTQA 3Q5FA 1QUPA 3HD2A 2Y1IA 3T1HJ 4IOAF 4YY3J 2KLOA 5EJCA 1HA1A 1P4WA 1S1WA 1H2TZ 4UOGA 3HX9A 3NXZA 4L18B 3ISNC 3TUZC 4BBSJ 5HATA 5IT9Y 5K8OA 4KN7X 2VPLA 3W2VB 2ECBA 4M3GA 3GG0A 1W7PD 1FSEA 2F4FA 4FASD 1FK9A 4F4YA 2EBIA 3PW4A 2PLYA 3K8VA 5I4MA 3K4NA 1FDAA 5DDOC 5KFZA 1P7JA 2LD5A 3HFKA 2GCFA 4DLEA 1KQ9A 4JI6J 3SSRA 2DFIA 4A12A 3QT8A 3V7CA 5H9FK 2HGCA 4DI6A 1A31A 1ZQ3P 1D9AA 2XMAA 1S97A 4PGHA 1NK8A 2UVWA 4ID5A 3PFOA 4F7ZA 1PKUA 3H4BA 1QVFR 2OFGX 1T3NA 4HHJA 2XMMA 3VF0B 4MKVA 3UN3A 5I42A 1MROA 1W1WE 2ZMEB 4JI2F 3N5BA 1K73T 2GHPA 3MAAA 1RAGB 1EKSA 5KFWA 4QWAA 3BYPA 1FOYA 3HK2A 5C4XJ 2HVSA 1F2GA 1WWXA 4Y33A 1KEKA 4D7NA 2OGUA 1NHKL 3MM9B 5CVJA 4J9QA 2JQ7A 4G7HF 3CJ5A 1RBOB 4NYZA 1GX5A 5RUBA 1X5PA 1N33F 3BPXA 1G6NA 1AWCA 3CJ4A 1QU3A 1HNZJ 4ANCA 4Y28C 3FKIJ 2JMWA 3HL2A 1ACMB 3W2WB 1IKYB 2LQJA 2KVQE 2C2NA 4TQRA 2JVRA 2HI3A 1SJ3P 2RQPA 3ABTA 1VLOA 1ETYA 4UVBA 2FLLA 1XMQF 1WUUA 2ZOMA 3Q83A 4BXUA 4E2FB 2V8HA 2C2ZB 3O6QA 5GAEI 4CLKA 2YWGA 4UY8T 1JK9B 3FSXA 4AUXA 4DV1F 2ALZA 4M74A 1R4NB 4W1UA 3DRPB 5KFIA 2HHHF 4P2MA 4PGGA 1HQEB 5KT7A 1V3FA 3ZQQA 3MZHA 3BJAA 2G2ZA 1GV2A 2HAFA 2V9VA 3PVXA 3QRFF 3RB6A 2XCAA 2DAOA 4ZVOB 2HRUA 2HQDA 4YQWA 4NXMJ 4FXWA 1LXJA 4ZVUB 1G2EA 3CE8A 5ETTA 5HN0A 1NHAA 4JK1X 3DEUA 3CCSI 2DNLA 3UVJB 4WCEQ 3T5HA 4F02A 3WU0A 3G4SI 1FX4A 3GU0A 4OX6A 3PUBA 4OZ5A 2XGXA 2ZC4A 5H9EK 1NK7A 4L0YB 1PYVA 4Q7AA 3T1BA 1IKVA 3T9ZA 3F8CA 4J19A 3GJSB 5ETNA 4WFZA 3B4MA 3O1LA 1FRJA 4ZJOA 3NMAA 4KGVB 4I1TA 1G6BA 5HQ8A 3TZXA 4O44B 2LY2A 1ENHA 3LQQA 5F9NA 2EBEA 4DV2F 1LFBA 3E5XA 4DYQA 3D0IE 5GAEU 2YNHA 2XB2D 3CJRB 3QLHA 4NLUA 3AB2B 2G4BA 4U96A 4FX0A 1NH8A 3BQ2A 3S1MJ 4B48A 1U2CA 1Y0UA 1R49A 1X9WA 4DF8A 2W4DA 1MBJA 1QVGR 1D5VA 1H73A 3JQKA 1WELA 5KG2A 1HSTA 2ZBQA 4P71A 2GIRA 1ZPVA 4G6VB 3C1DA 4RR5A 2VQLA 1IDZA 2RQ4A 4GMKA 5FJ4A 1S9FA 3JCUC 5HDNA 1VQ4I 4IYQA 4MIWA 5KAKA 3KXDA 1AHDP 2EW9A 2IRYA 1K6YA 1KDNA 3PNIA 2J6UA 1I1GA 2QEXS 3MMCA 1F4KA 2VICA 3T6JA 2CUJA 4F91B 3FMRA 1H74A 4GO7X 2DVIA 1BN5A 2NXNB 1VRTB 2MG4A 4ED2A 4DUYJ 2DXIA 2VPRA 1JT6A 3CP2A 2HS0A 3M30A 4CZZA 2CA9A 2QX0A 2KMUA 4BHBA 2KU7A 5T7LB 3JTPA 4CDIA 2VB6A 4HSTA 2GLOA 4ED4A 2DEIA 2OPQB 1YZ7A 1U0HB 2VPYB 2DYAA 1W25A 1C0WA 2OUGA 3GX4X 2XSJA 4GO1A 3TAMA 3Q8QB 4DLGA 3MURP 5CYVA 5E0OA 1S8NA 4DGWB 1UEVA 4L9JA 1K7AA 4JOUA 3RB4A 1MMAA 2PJRB 2J9DA 3M8QA 4DV5J 2DNMA 4XRMA 2FZGB 3BC8A 4U95A 2JJ7A 4BEHA 1RAAB 4NA3A 2JFKA 1VQ5S 5D3GA 3BB5A 3KUEA 1IKYA 3LSTA 4XPCA 3AG3H 4AL5A 3D54A 2XF6A 4M9SA 2QWWA 3FIWA 5BS6A 3RYRA 1UJ8A 4O3OA 1AUSL 2MC3A 2QE5A 3DLGB 1C0TA 3K8WA 1RIOH 5IQ6A 2V4QA 4MMOA 1U1LA 1BW5A 1EJ7L 1ZGWA 1FWLA 2RVJA 5FKNA 4OIRF 2X7IA 3D7SB 3NWGA 2ISYA 1HNZF 1ICEB 1NHVA 3HT3A 3HHKA 3T0YA 1K1SA 2IW5A 2O8KA 1HBNB 2BJ7A 2WAQN 1Y1WJ 4DUZJ 4A8WA 4F2SA 2WSFC 4HHHA 2M0CA 3EQLF 1J5OA 4C2UA 1VRTA 3W3CA 3HB9A 2QA2A 3CO0P 1AUDA 2PMHA 3F6OA 1FYMA 4E98A 1S7OA 1D1BA 3ENQA 2Q8KA 3I96A 1GTEA 1U5TC 4MQ9F 2MTLA 4KYZA 5GAHU 2W7OA 1N6QB 1RWUA 1YLFA 4PDKA 2YS9A 3BQYA 1PDNC 2HBYB 3IWLA 5K8NA 3G2XA 2J6SA 2HS5A 1RHQB 4YEJA 3H5UA 2BW7A 3GV8B 2R92J 4ECUA 2H27A 5LBQA 4P2FA 1TWCJ 3D68A 4C3MA 2P81A 2C2OB 5CXTA 4E7ZA 2NXNA 5HVFA 4A3CJ 4BDZA 2VPWB 4J01A 2GO9A 1OFCX 3HPHA 3LP1A 1KQGB 1M5VC 1LNWA 3GEZA 4A2UA 3O5TB 4LJMA 4GYGA 3AAFA 2KI2A 4KO0B 2DGWA 3AODA 3JTOA 2KRHA 3Q8VA 5D5VB 2DI3A 5D4LA 3FXRA 3ENVA 3CJKB 3QRPA 3HEFA 1Q0NA 3TW6A 2VBZA 4RNFA 3HHGA 3OBIA 3EXCX 1XMXA 1UP1A 3SV4A 4ZVTB 2DY1A 1IO2A 4K4UA 5DCMB 4EM1A 2ASYA 3RZOJ 4ZDOA 2QL5B 4DFPA 1UHMA 2ZE2B 4MK8A 1Z21A 3DQVC 1FLIA 4IH5A 3AOBA 5HMWA 4B3MJ 2BJDA 4LLLA 1APLC 3BG5A 1B4AA 2V6CA 1HKQA 2CZVC 2RHQB 2QBYA 2I0XA 5J40A 2VH7A 4X62F 4RJVA 1NH7A 4L5JA 3QYEA 3OYCA 4FNHA 2HAIA 4MNUA 3LWLA 5EN1A 2YPZA 3GIRA 1FJEB 2R8HA 4L9TA 2HHSA 3N05A 2I8EA 4ZMMA 4ECSA 4I0AA 2LNBA 3OL8A 1SUQB 2M2BA 4ECQA 4WU2A 2VQHA 4M5NA 2G0CA 4OLOA 2ACYA 3LANA 4W4MA 3QGHA 2IRUA 1FNNA 5LOQA 4B9SA 5D6EA 1VFJA 3QMQA 2RDDA 3CCVS 4XOPA 3CJKA 3BG7A 5G4DA 4IOCF 2MZRA 1Y5IB 5CKTA 2HXOA 2CS3A 3IAS9 5DZ6A 1BI1A 4F55A 3HZEA 1HDPA 3CF2A 4RS8A 1JLQA 1IXRC 2XNRA 4ZVEA 1YWXA 4IH6A 5U47A 2L9RA 2DGTA 3ULHA 3IRRA 5DETA 3D6MB 2Q79A 2GAHC 3PNYA 2L7KA 3M32B 2AXTC 1VBKA 1IVZA 2BKPA 3J80U 4IL6C 1OMIA 2K2PA 3FMSA 1BIBA 3VB2A 2H5JB 4NLTA 5IC4B 1OQ6A 1VK8A 4QYRA 4JI6F 4P6QA 3KK2A 4O3SA 2B9SA 3L2WA 1TKTA 1HD1A 2K8GA 5EGYA 4BHQA 4TKTA 2PA8D 1Z91A 3VGSA 2W4SA 4B9MA 3EM1A 1JJ6C 5F0FA 3U21A 2DYSH 3HFZB 3I71A 2B9YA 3HFVA 4KKOB 1HQUB 1DURA 4RO0A 3BCBA 4EATA 2P4WA 1U48A 4PJNA 1MGTA 3AAWB 2IS6A 2E1NA 2UVRA 2CPDA 3BJYA 3LUYA 1ZELA 2MZQA 3DRYA 2YWEA 4ZPDA 5JI6A 5CVIA 1M5KC 4JB8B 4PEOA 4OOIA 5L1KA 3BN7A 4P9SA 3E8OA 3CC4S 4A8YA 3B54A 2P8IA 4O23A 3KIOA 5GADI 3LP0A 3BY6A 1FT8A 2BY3A 4ZPAA 5ICCA 4DR5F 3D6TB 1XG1A 3RKQA 1UPPA 5HMZA 4BBYA 4OZ0A 3G1MA 1FKPA 2JUGA 4B43A 5HROB 3PJ9A 4Y6IA 5T14A 5BXIA 1VGYA 2BANA 2R4FA 1YJNI 1TZLA 2XV4S 1Q86T 2R7QA 1D09B 4EU0A 1JNZB 1U47A 4E7SA 3AJ2A 3LF0A 1KS2A 3GIKA 3W9IA 1OR7A 2FXAA 1B8IA 3MEDA 2XO6A 3OVAA 4NZ7A 5C3EJ 4MGRA 5IZHA 4PCQA 3GTPJ 5E3PA 2IXSA 2E5ZA 1MNMC 1LB2A 3H0PA 5B3SH 2EZIA 2XB5A 4GKKJ 4NCAA 1EP4A 3PRDA 3TAQA 4OYAA 4NBQA 2DTJA 2DLLA 2B51A 3HXLA 4J91A 1YX3A 2E1MB 5B0CA 2B4VA 3QSYB 4E7IA 2OFHX 2J5OA 3W3SA 4WFXA 4PQUA 5EX0A 3HRMA 1NSQA 1JKHA 1J5EF 2WBRA 2HYIB 5J1PA 1FP2A 2LFVA 1SJ4P 3SZPA 3BZQA 4F4KA 2L2OA 3SFZA 3J81U 5J3LA 2LEBA 3S2HJ 1BY9A 2DNNA 1NUEA 4L3NA 2HZAA 4AQYJ 3CJNA 2ZEJA 4HRIA 3M1EA 4LB6B 1UWBA 1Y11A 3GCXP 2A1BA 4WX9A 3ELHA 3MKZA 4A47A 3BTLA 5HO4A 2V9PA 2YQ1A 1R3NA 3U1LA 2Y48A 5L9NA 2KFZA 3H36A 4NYOA 1N32J 2OMLA 5F04A 6AT1B 2JWTA 5JVHQ 2CNLB 1GHCA 2LXUA 5JFRA 3U1DA 4QSHA 4NCGB 5ILVA 2E7XA 5E1WA 5KAFC 3KP6A 2UZKA 1Q79A 4IRCA 1P4AA 3MCNA 4JV5F 1JWWA 3N5FA 4CO2A 2D7SA 3OYDA 2AYEA 3ASNH 2A3SA 1H2VZ 3CUQB 4I6WA 1XGSA 2RREA 3OJSA 2GHVC 2UXBJ 2J0XA 1FXDA 2EXUA 1NNDA 2B8QA 4LBIA 1T9VA 2YQ3A 4F0HA 3CJ8A 2DOFA 3PNTA 3KK3B 1YSJA 1W2IA 2FGOA 3TARA 2UUAJ 2OI2A 2A0FB 4EBCA 2JEIA 1Y10A 3GJTB 3B82A 2OKQA 5E7OB 2OPPA 2BXYA 1LQ1A 4RW7A 3OW2R 2EI5A 4HH0A 4UB8C 5DDRC 3ZOBA 1KU2A 2VKZG 2UXXA 3BGRA 4X4UA 3H4DA 1YJVA 1VQNS 3ENAA 3G9CA 4U67Q 3VZHA 4RW9B 3EGZA 5CAAA 4TQSA 2NRAC 3SHFA 4O0IA 2YVSA 4KGXB 2YH0A 5HNFA 2OO4A 3AQPA 1IRZA 1RADB 4BE2A 3MMBB 1NDPA 1QY7A 3IN5A 4RBUA 3D6FB 3A3PB 4ENNA 1VQ8I 3OL6A 1BI2A 4GVLA 1AXQA 1E0EA 1OMSA 2KXHA 1UWAA 1I50J 1RRJA 4EJVA 4J9MA 2AHQA 3SQNA 3IM8A 4ZLNA 1XDUA 4N8NA 4QYZK 4YG2F 1ON2A 5KFGA 1RKIA 3IL2A 4RB1A 1TTYA 5L1IA 2EFOA 5L9XA 4ILMA 3V81A 4X64J 4X2BA 5K20B 2J8AA 4AXIA 3OUYA 4KE5A 2B7CB 2XI3A 4HI1A 3CNQP 4G12A 4U9RA 3O2IA 4GC6A 2R8GA 4NWBA 2CV2A 4X62J 1JUMA 4MTDA 3RCOA 4W90B 3BOQA 1VHFA 3QPSA 3GJQB 2NNNA 5F8NA 4P10A 4LRCA 4IO9F 1J0RA 1K6OA 2VQGA 4XR6A 4USMA 4ABZA 4FF3A 2BRKA 2MKHA 3FFIB 3GIJA 3ZZRA 1CG2A 4V2FA 2YKNB 1S7EA 3DLLQ 4ECZA 2L41A 2HYJA 1F0XA 2CWXA 1WJ5A 2M88A 5JXSA 4I98B 4EV0A 3OVBA 3QZ8A 1H0HB 3IG1A 2VJ4A 3KHRA 4USUA 3KLFB 4PK4A 1FRLA 4Y2IA 3EGWB 1S5ZA 4U7DA 1HI8A 3GFJA 3A1YG 1GT8A 2MHNA 2ZH5A 3RAMA 2ASLA 4ZCKA 1TKXA 3OY9A 2NZCA 3JB9k 2XSJB 2KZMA 1AW0A 2G1DA 3A03A 3T5XA 1YITI 4I2PA 1CPZA 1XC5A 4B02A 3CTRA 3QAHA 4HV6A 1O3TA 3PIOF 2ZOFA 3R2CJ 4PRFA 1IKVB 2JDJA 1RYSA 3CLQA 3I4MJ 4AC0A 5AXKA 1FKOA 3WQPA 2FJXA 3H9QA 2HVIA 5C2GA 4AYBN 1OWXA 2PSZA 1QZYA 2XGEA 2XAUA 3KLHA 2FHKA 4J90A 1MJBA 3M8FA 1WFXA 2A05A 3WX4A 3GTOJ 4HLYA 1L0OC 3CUQC 3G96A 1DAXA 3RBDA 1OQYA 1RWVB 2CNNB 4DFKA 4LT6A 1YRNA 3K7AJ 4KB7A 3H8YA 1VTNC 1T39A 2IGOA 2UUBF 1CS4B 2F65A 4HG2A 1R31A 5AE3A 3GILA 1U1PA 4XRFA 5D5XB 1MLAA 2KHCA 2RS2A 3HHLA 3GWCA 1GXLA 4K5RA 1RWMB 4DZJA 2H8RA 1RKJA 1MJ9A 1KTQA 2R7TA 2GGPA 2V6AA 2V26A 4CYCB 4E7JA 5E3QA 4NLWA 2Q6BA 2XGQA 3PXGa 3VZIA 3CF5F 1SVDA 4R8UB 2VDIA 4I67A 5JHFA 5B5EC 1K4TA 2EFNA 3SFIA 4X84A 3GBGA 4HT7A 1KU3A 2LP0A 3I5AA 4TY8A 4F0KA 4C4WA 1TL4A 1V55H 3CJ2A 1H88C 3OYJA 2EA4A 4O0NA 5ETSA 4O3NA 4QWBA 1JUPA 2KFYA 4DYCA 2XS2A 3FXJA 5AE2A 2A68F 3C14A 3LSIA 4DSFA 1NDLA 4YB7A 1EH6A 1RT7A 3KHGA 2Y9HA 4DPWA 3K4LA 3MOZA 3LSKA 2DHHA 1ZM3A 3TVYA 5KFKA 1D8JA 1IN6A 2EWHA 3VAJA 3SSSA 1T6SA 2CXEA 4DF4A 1P7IA 1ZH5A 2XMKA 3LGNA 1N6QA 4QR2A 1U49A 1J27A 4K50A 3SIPB 1DTQB 3P9CA 4A5NA 4WPAA 1OJ4A 5L3BA 3BPSP 3D5RC 3CO9A 1OYDA 5I3UB 1WJAA 4ESJA 2P9EA 2YPRA 4MHGA 3QIPA 5LGTA 2O67A 2DCLA 2X3GA 4PXEA 2KRCA 1N56A 1X4FA 4FTHA 2L7FP 2F4VF 2B4PA 4ZIWA 1X4DA 2HK3A 4PUOB 3BDPA 3NBPB 1C1BA 4V19K 3FGVA 1BBYA 2CWEA 4DZDA 2ZKUA 4USVA 2A5WA 4M5DB 4MT1A 4E8UA 2M0MA 2CW0F 4RB3C 2M7AA 4P73A 4DS4A 2ELHA 4YIIA 1XERA 1IN8A 2VE9A 3M2UA 3KLFA 2WA0A 3KLGA 4IEJA 3KJFB 4I6ZA 4MYTA 4Y7NJ 1KOOA 3HHLD 1T8EA 3LA7A 2FJDB 1YIJS 5KTQA 1RP5A 3CC7I 3GE9A 5FRMA 1WJ9A 1SFOJ 1ZG3A 4UV9A 1TAQA 2ISZA 2H54B 4LRDA 4CA0A 3BSAA 4USKA 2VLAA 4DX5A 2DXEA 2MGZA 3VALA 2QSFX 4I7HA 2LXFA 2VPZB 5IYCJ 3TP0A 4RL1A 4IFVA 3GFMA 3JSRA 5C44J 1NSPA 4KGMA 2H48B 1WKMA 1RT1B 1D8ZA 3EGVA 3K2AA 3ZQFA 3P4UB 5HVQC 4DQRA 1YJNS 2DA3A 3WTSC 3B8HA 4Y3CA 1W4MA 4BNCA 3LAKA 4DEZA 4PJ0C 1DBDA 3CZ6A 1RDRA 2D3UA 2MQOA 1V4RA 4IH7A 2KXNB 1ITPA 4LFBJ 2FF4A 3OR2A 4X4NA 2BACA 4ZP9A 3WTTC 4RW9A 1RAJA 3ECOA 3THTA 4KV8A 3VVUA 1UVMA 3RAQA 2M3DA 4IHVA 1V3ZA 1BQMA 3MEEA 1XMOF 4XDDA 2OJ3A 2RC4A 3CJTA 4WIIA 1A0OB 3G8QA 4M8LA 5IV4A 2J9EA 1G3SA 3ET6B 5GMEA 9RUBA 4HF1A 3LFKA 1LVKA 1B70B 4IJAA 1R89A 3I53A 3JYTA 1O6XA 3OUYB 1R7IA 1S9EB 3ABUA 2TRTA 2DJIA 4RAFA 4LG0A 3K9TA 3D0GE 2CQGA 1YJUA 3CCQI 5FKMA 1Z4UA 2CQ7A 4LSLB 4CCKA 1R4MB 2MYFA 5LJ3Y 3PX4A 1BC8C 1TK0A 4R8HA 1X4AA 3BR8A 2DJWA 4CLYA 1UZHA 1R5ID 3CSKA 4KGKA 1I6HJ 2WCXA 1RU2A 1IM6A 4Y2AA 2AQEA 2DQLA 2HGMA 3HOTA 3PQJA 2C2KB 3PHEA 4KIGA 2QN6B 3K7RA 4NASA 4EBEA 2NAZA 3CDBA 4ZYGA 2ZD1A 4GRIA 3A3NB 3CJTB 1XMBA 4A8FA 3CCVI 2PQ8A 5DQIA 1EB0A 2XGPA 4MIAA 1WHUA 4FPIA 4RUBA 2F3JA 4X4RA 1YJ9S 1JLAB 2LQ9A 4M95A 5L1LA 5F8IA 2DR5A 1T95A 4XIUA 5GMKa 1MNDA 1QDUB 1TU0B 3FQKA 1Y8QB 2FLPA 5DM6Q 4LF9J 2LC2A 3M2RB 2AV5A 1RZ4A 1FJ7A 4HKQA 3RQIA 2YH1A 1OS5A 2KIQA 2MA3A 2AJ1A 3GG1A 4NUBA 1X1CA 3C46A 1I3AA 2BQRA 1U5TB 5BOXA 1SD4A 3L3CA 5HDGA 3OFHA 1X5OA 4ZA1A 2N3LA 2X85A 4Y13A 3IMQJ 2V8VA 4RM2A 2VJVA 2E71A 5JHUA 2A3JA 2RSQA 3MM9A 4DSKA 1RWNB 1TUWA 2Z2YB 1BD6A 3CD0A 1X4CA 2RHSB 1E6YA 4MK9A 5GP9A 3LWFA 5F64A 4KDPA 4YP3A 3CJRA 3TO9A 2KDZA 1HQEA 4BQAA 5BR8J 3KYLA 2CZ4A 4JX4A 1KA8A 4LF7J 3HRUA 2B6AA 2V67A 5JLXA 4U7BA 2ZBPA 3VOEA 2PI4A 2R7RA 3V6JA 2HR3A 3HJFA 2R9LA 2CQBA 5CLSA 1EF4A 1Q8LA 5CH7B 2B43A 1HA8A 2F9DA 5DGAA 4OIPF 4C2TA 1UHSA 5D77A 2QV6A 3I6PA 1SL2A 4N77A 3H0GJ 2PFFB 4ZJQA 3EYYA 3BPVA 3OSFA 4CO4A 3L2UA 4NL5A 3M6WA 1DTTB 3HPGA 4RLQA 4CNYA 4C2MA 3NS6A 2VL1A 5GVQA 3I56I 4LRFA 2J76E 3BN4A 4LFUA 2HKEA 3R5GA 3HGGA 4O3QA 2DOEA 3QP6A 4RWXA 1R0AB 3FK6A 1D0YA 1A36A 2KM8B 3NWSA 2DA1A 3ENWA 4G9YA 3AA8A 1BWVA 1DTQA 3A12A 2FTRA 1H98A 1TP7A 3RB0A 4ZZLA 2OEJA 1PP7U 4USTA 1I3QJ 4L76A 3R61A 3DM2A 5LSLA 3OQ2A 3CJ3A 1NJIT 4XK8C 1HHQA 4Q44A 2HNYA 1TL7B 3RKWA 5FLXK 3AOCA 2A2CA 2BE7D 1TAUA 1RT6A 2B4OA 2KZGA 2DNQA 4P52A 1QSLA 3KDNA 4CCOA 1CF7B 2HZVA 2KTQA 2W4PA 4QTRA 3GMEA 4GKJF 2GJFA 2DDAA 4I6YA 5H9EJ 2VIXA 3CMQA 4LF8J 4BQQA 5ADZA 3DLBA 2CNKB 3ZTPA 3R6LB 2JSCA 4WK3A 2PJPA 3OR1B 3WTVC 2BRLA 2HHQA 3KK2B 4UY8I 2Y8YA 1Q8KA 4J7CA 3PEHA 1IBMF 2UUBJ 1BGXT 3W9HA 5DO2A 3N4MA 2Z3YA 1Y7PA 3RRKA 2XHKA 3PRVA 1T8IA 3WU1B 1UCRA 2VXZA 1TUVA 2BM1A 4FP9A 2N4CA 3PO2J 1Q5VA 2HBRB 3D0HE 4ZLLA 3H98A 2QUFA 1DRZA 1SC7A 3QYYA 4RGXA 2QQ9A 3SYTA 1QPIA 3DU5A 4M9ZA 1FWKA 3KCCA 4Y0FA 2CQNA 2IDLA 1TP4A 4BACA 2WW4A 2XQCA 1HWKA 3EZ5A 3DHXA 1S29A 2HZTA 4S04A 2NCKL 4XK4A 3SQGA 5THWA 1DPUA 2MKCA 3KEQA 1X19A 4UY85 3HPOA 3KUHA 2ZH6A 2PJRA 1XMKA 3M9MB 2JA5J 3DFGA 4LLGF 1XSDA 2DODA 2V34A 2QYCA 2NSBA 4IKAA 3QGGA 3KLEB 3W1YC 5C24A 1IUJA 2RT3A 3F44A 3TW7A 3GR1A 2CQ1A 3MMAA 2ZC2A 1I5ZA 2I2YA 2LQ8A 3SEOA 3TX0A 2RS8A 4LFCF 4B3AA 4HSRA 3ZTQA 1RHKB 1Z1DA 1KP6A 4LFBF 3M8JA 2OEMA 1M1KT 3RDIA 1NG6A 5LD2C 4CM2A 3FXUA 4A8XA 3CB4A 1J75A 2DK2A 3G6XA 3RBZA 2JPCA 4G8XA 2MEWA 5HMYA 1Z6RA 5I3QA 1VQPI 1Q7LB 4GC7A 3EPIA 4USWA 4OV6A 2JFDA 4IG3B 2DMTA 3K0JA 2FB0A 4QJVA 3DYAA 4QPOA 1BW6A 3KNGA 3N28A 2O01C 3FXQA 1W5CC 3OIPA 2AJFE 4YN3B 1TL3B 4G1QB 3HHLB 2X1DA 3LGHA 4XAKA 3RR7A 2XTJP 5IM0B 4S0MA 3IAS2 4QCLA 3RSNA 4B3MF 1C0TB 1SJQA 3UI3A 2HMIA 1WOPA 1FEXA 1R23A 4FETA 1NK4A 1V54H 2KFNA 2ATCB 1IDYA 1FRKA 3MMAB 3KJVA 4XKBA 2D9OA 2HPMA 3DBLB 2V5HG 3B73A 3PJWA 3SXLA 1IUFA 3RPQA 2RJZA 1LKXA 2YY3A 3COAC 4V2GA 1E3OC 5EWFA 1UELB 4R8UA 1KD1T 2A07F 4DSJA 2L9VA 3C14B 4BDPA 3CIZA 1LPQA 2UXBF 3J7YJ 3M8PB 1Q8IA 2O6GE 3DLKA 3OIQA 2HYGD 2RDIA 1OY6A 5FD1A 4ETSA 4F2RA 2W2PP 4PQUB 3WE3A 1G3OA 4JI5J 4KY3A 1CS4A 4IR1A 3ETOA 1HYSA 2V79A 2XZWA 4JV1A 3SDEB 3MMJA 1M1EB 5FIIA 4ZPTR 4X4SA 4CHUA 3HJVA 2DNPA 2WW8A 1PJ5A 1KBRA 4FVCA 1UVIA 2DFFA 3A4CA 4I69A 5IM0A 4BU2A 3U9GA 2ZVIA 3N6MA 1JLCA 5HAOA 1D1CA 4IHTA 2Q3PA 1GXPA 2YU9J 3E2EA 1YS6A 4I4BA 4J00A 1T05A 3OIOA 1GH8A 1HKAA 2CSOA 4M71A 4ZVPB 3ZR8X 1LDDA 2BE2A 1KQKA 5LEJA 4RNMA 1EJ9A 1KU7A 2CYYA 4BBRJ 2CPFA 1RT5B 2Y0BB 1HMVA 2QBYB 2BJ1A 2WC2A 1FE0A 4J9UE 6FD1A 3SEZA 3HVTA 3QYBA 4Q2MA 1WI6A 3HXMA 3HP6A 4NMXA 5KFQA 2HWVA 3WDOA 3QAUA 1YTYA 1NHUA 1B7FA 2B56A 3DYAB 4RAYA 2DB1A 1QAXA 3QQCD 4F8RA 2NXEA 2DPDA 3HVAA 4RU2A 3FCWA 4GVBB 2VFSA 1WTBA 5GPAA 1VISA 2J7UA 1S6OA 3V4IA 4U87A 3Q0VA 2W8LA 3M4XA 2H94A 2GVZB 4DV3F 1J5YA 3NGUA 2FBIA 1N33J 3WTXC 1TFYA 5HQMA 1GDTA 4ASNA 3FBFA 2MC4A 3Q89A 3C2PA 4RUCA 3M30B 3U1MA 1FD8A 2Q43A 2R5ZA 1X8DA 4LIUA 3A2KA 4A8OA 4RAZA 3MFKA 1F3FA 3GW2A 5DG9A 2XM3A 3C3WA 5ETVA 1ZPWX 2ADCA 3CCYA 3FM5A 4XORA 1E6VB 4EGYA 4JV5J 4WBFA 1RTHB 3H3UA 3TAMB 1JJ4A 2CADA 1RYRA 5BJRA 1MNEA 4U8VA 1UA1A 3K59A 2BYVE 2GHWA 3OR1A 1J2XA 2ZBIA 3BZCA 4WP9A 2B7EA 2U1AA 3Q23A 1LW2B 3CCTA 1S1XB 1Z3XA 3HSZA 5KOWA 2B4UA 3HMJG 1T2KA 3W5ZA 2E34A 2JC0A 2RKIA 2WTFA 1KLMB 2EC0A 4BQOA 1YKWA 2CU7A 3HZJA 3D3CJ 1VOMA 3DMJB 2J9DE 4AL7A 2A6TA 1CJUA 4AL6A 3TI0A 1XWLA 2NS0A 3THVA 4UVCA 1JQGA 2JWNA 4IRGA 4Q45A 2BQUA 3CXCR 2M9KA 4CLLA 4M5GA 1N75A 3L9FA 2XRLA 5HDKA 4FZVA 2AU0A 2YSRA 4CO8A 1B8IB 3MD3A 3MEDB 3HZGA 3D1NI 4PABA 1T9YA 2EIMH 1OLTA 3JQJA 1Q16B 4WXDA 4A4JA 3K17A 4WZMA 2Q1ZB 3V7SA 3C16B 4DR7J 1NXIA 3JRAA 3L1PA 3A4TA 2GQ2A 3GIIA 3Q0WA 2PMWA 1RTZA 5K14A 2BUNA 5J2PB 1VQ9I 2K85A 3FF5A 4OZLA 4LUBA 3DP7A 1FNXH 2DH9A 4B9VA 1LQ9A 2LKZA 4IHSA 3F73A 3OSNA 3UWTA 1X2MA 3FBEA 3HSRA 4OZJA 2V68A 3VAHA 5GAEJ 1U1RA 2K86A 2GS8A 4G1PA 4NXMF 4YDDB 3IWFA 4BQNA 1ITYA 2XROA 1PYOB 3S01A 3CD5A 2GJ2A 5IYDJ 3F8MA 4HDUA 3T5JA 1S1VA 1B9NA 2IGMA 3UDVA 2R7VA 5ERIA 3ZQLA 1FEHA 1JKQC 1ZS6A 2XUBA 1WEZA 5B08A 2AGPA 4BE0A 2AD9A 3RJMB 1HKTA 3CCRS 2EZKA 2MHEA 3CC2I 2ZM6F 2G9OA 4DR5J 5KFRA 3M9NB 4EFAC 3OL9A 1SFUA 1W26A 3VPRA 3OYIA 2MKJA 3VDXA 1FFSB 4A0YA 5JVGQ 3VGUA 4OJ3A 3UNGC 2KJBA 2V50A 4OJGA 2QTWA 1VS3A 5HBMA 3JAMU 1VQ7I 4F04B 4KA4A 1D5YA 2FQQB 3BG3A 5IP6A 2JA8J 1MBKA 3F8FA 4AD9A 1WORA 5F27A 2HQ3A 3UR0A 2Z8QA 1QNTA 3G1OA 2Y1RI 4ESFA 1KSPA 1VQKS 4M73A 3RG6A 4E4HA 4K0KF 5EDNA 3CCWA 4D0PA 5KFYA 1WHYA 1ZR2A 1QAJA 1UWBB 4NCGA 5LMNJ 5D4RA 3L4BC 4NLSA 3ZZOA 1REGX 4IO1A 3KLNA 2GXBA 1VQ7S 2HMIB 3PQKA 2ZJ2A 2XNQA 5GAGI 1V6HA 1APSA 5KG5A 3Q2TC 1WKLA 4KFBA 3TYTA 2L9DA 3OMYA 3LOUA 3HBLA 5A2QY 4DR2F 2L4AA 1TWHJ 3BT9A 1HWUA 2NQPA 3R6GB 3O3KA 1K9MT 2Z57B 2OPPB 2Y9YA 5D0RA 2QG9B 2DHXA 3VSLA 1RT3A 4JI0J 3M6XA 1S7HA 4NLGA 2R7XA 2LDIA 1H89C 3OFGA 1HQUA 1NJWA 4U0WA 3MECA 4DZ6A 5D8KB 1BL0A 1LW2A 3LSMA 2MB0B 2HQ5A 5DGBA 2VN2A 2JVOA 4KFCA 3LP2A 1JLQB 1XMAA 1B6AA 3CUOA 5KAIC 4Q43A 1REVA 1QBJA 2H09A 2VQCA 2EZLA 2N7YA 3FXLA 1VBYA 2IS1A 4XL9A 4LF4F 4FT8A 2LKPA 1UKUA 5IOZA 4YFNF 3IHUA 5FKOA 3AB4B 4RGRA 1RKWA 1PJ7A 2YKMB 3VV2B 3D6HB 5ILUA 3TJ8A 3QO9B 3TP2A 4CLZA 1JLBB 4KSEB 3MAAB 4ENMA 4B9TA 3ROUA 5J4YA 1U45A 3QRQA 2IPOB 1QLNA 1WF2A 3RKXA 3H0DA 3SYZA 1VC0A 3UDCA 1RACB 2FQ3A 1K8AT 1N88A 3BGOP 4WCGA 2HNDA 5IWAJ 2JX2A 3HUGA 4K4YA 1JKPC 2EB7A 3KZIC 1SJFA 4W92B 1REPC 1VJQA 2CPJA 2BW3A 3MM5A 3D28A 3V4IB 1RESA 3BR9A 1RAHB 2B0GA 3QBCA 3DGPA 4TNOA 4BE1A 2V4RA 2AEJA 4LR7A 4B44A 4Y00A 2CUZA 4XKCA 5CYQB 1NMEB 2H1KA 1UZDA 3HSDA 2VODA 2R8KA 5EX3A 1N77A 3DXBA 3BO2A 3C15B 1UVKA 4NEZA 3MKWB 1RAOA 2QIFA 4DCJB 4HYEA 4HX4A 1ZHFA 2Z16A 2CDQA 4UUSA 3ILOA 2Y31A 4PFPA 5KFBA 2CQ0A 3GQCA 1WSVA 4C8KA 4C8LA 4DV2J 4F4XA 4DV7J 1FT9A 1WEYA 3QPIA 3OHBA 4C97A 4M1KA 4J9LA 1U2WA 3VGVA 2IAIA 1VCTA 4X65J 4BWJA 2DT7B 2JSPA 1EKRA 2XYGB 2GFFA 2IA0A 5EYRA 1FTZA 1G1XA 5LHIA 3FQLA 2K27A 2CPZA 1L3KA 2P5KA 1EARA 2BXJA 3I4PA 3IGVA 1RE1B 1SXLA 1B0PA 2EJRA 2QYOA 1RJJA 5DRKA 2BM0A 1BE4A 2FYXA 2VV5A 1NPRA 2ZUGA 3GFXA 3IR5B 1WGXA 4U0YA 5BPIA 1A6QA 1GTHA 3MR7A 4JV2A 4DL2A 8RUCA 3GZ5A 2ABYA 3BEGB 3GYGA 3I64A 4P2SA 2OPRA 3WHBA 4MFEA 3TP3A 4I2QB 3H2UB 2IIHA 2MYSA 2K9MA 1X1AA 3AFGA 1USSA 2Y1JA 2E1RA 1FOXA 3E5QA 3H5RA 4CYDA 3TKYA 5GPCA 1G4DA 4EZ9A 1LWFA 2JNJA 1N5TA 1YRUA 5BQTA 1M5SA 4KBIA 2DMPA 4C9DA 1X4GA 1ZN2A 1XR7A 1D8YA 3M4OJ 3HHEA 2C3PA 2A6MA 1WI3A 2FMYA 4D5FA 1I94F 4DPUA 2QT7A 1I1SA 4HHUA 5CQEA 1RHUB 3OXGA 2EV5A 3NNCA 2XKOA 2ASDA 1XJWB 4RMNA 3DEEA 3GFIA 2J5PA 2ME0A 1CQNA 1LOUA 5E5NA 1LUJB 1FHTA 2FVCA 4H4KC 1Y3JA 3NGRA 1MWQA 4KQZA 2JJ4D 4ECTA 5KNLA 1CSJA 3QWPA 2CRGA 2PEBA 1S59A 1UFMA 4TU9A 2UXDJ 2VXDA 5H9FJ 2M4GA 3QU3A 1U0HA 2RQCA 1M5OC 5M2RA 2KYXA 3MPYA 1ETQA 4O3RA 2L7MP 1HW1A 2LYCA 3K4BA 3LFUA 3RJPA 3JR9A 4KJIA 5F8HA 1URNA 2KN4A 1U7LA 1BR1A 3PO3J 2M0GB 1ZOTA 3M7GA 3A13A 1AB8A 2WAQD 1H9TA 5HLFB 1P9YA 4H4MB 2VT3A 3DPTA 3BR1A 4HH1A 5DD8A 1HBMA 2H4WB 4DYRA 4KIAA 2W2OP 1SJ1A 2BOLA 1SC1B 3MVPA 4ZPCA 9ANTA 3A0BC 1K78A 4KTQA 4LF4J 4ANDA 2IGNA 3LSHA 2AZ1A 2R93J 3TUPA 2LG4A 4CLFA 1JHHA 1HW9A 3F56A 1CVJA 1MMLA 3U7JA 4MTPA 3KP4A 3BKTA 3QJJA 2XAFA 2A10A 2FJ1A 4ILLA 3AY0A 1LVAA 3UCUP 3KLOA 2A18A 1XGMA 4IRDA 1HBOB 1RT5A 1VQPS 1WH5A 3KK1A 2JHEA 2V69A 5D6FA 3C2BA 1W5TA 3WBZA 2DTRA 1B3TA 2XASA 4AE5A 3KP7A 5C25A 2DT9A 3G71S 5HJYA 3BJOA 1OO0B 2NYIA 2O0YA 3K0LA 4I6AA 4ZOSA 4CP5A 3Q9SA 2CG4A 2L9WA 1Y4ZB 4CYUB 1HD0A 4I2OA 4KITB 4XKVA 2EA2A 2VG6B 1F9HA 5CVUA 1CLFA 3LQRA 1S4FA 2HFZA 2YNIA 3QZ7A 2HS4A 2LLKA 4R5PA 1RAEB 2C22A 2R2RA 1YW8A 4PPZA 3D66A 1HYSB 2EK1A 3MWBA 5EF6A 2RDPA 1MBFA 1VHIA 4RPFA 2D74B 4IUFA 3ZXWA 4FXVA 2ICWG 1UHWA 1RI7A 3S3NA 2PI5A 3A01B 1A04A 5A6PA 2E9RX 1D3YA 1LEOA 4O44A 2LU2A 1Q4RA 4YFUA 2LECA 4PWDA 2ZH2A 1S9HA 4LIRA 5CYQA 2Y3YA 4ZYAA 3I54A 3I5BA 3KZYA 2EH3A 4RB2C 2AHOB 4D3GA 3J7AO 5H1SV 3IRWP 2FBKA 5J1UA 1YG2A 1H72C 3JAMY 5EWGA 3E1SA 4QPQA 4LITA 3T8TA 3ZPLA 3WIUA 4QWQA 4XLFA 3TQ1A 1STZA 2P0WA 1FWPA 3H9GA 1YGYA 2VG6A 3IRXB 2VQEF 1YDLA 2M70A 2NS7A 3FXOA 1JE8A 1J09A 4X66J 5ICGA 1JKHB 5E79C 4WU3A 1HPZB 4IG0B 5BYSA 2WONA 3MCSA 4N56A 2RIJA 4UUWA 2NVTJ 3EJMA 2CQ3A 2LDYA 4HOBA 3PW2A 3GTYX 2H3EB 3RQ4A 1A6LA 4OQJA 2CW8A 2XPWA 1E17A 3W60A 3UD3P 2NUHA 2UUCJ 3P9KA 1HLVA 1B0VA 1JIHA 2GNKA 4QIFA 2YU3A 5HP1A 3J7AY 4LIWA 2HVRA 4P5OA 3AH6A 3A1YA 2QGUA 1KOHA 2EPIA 1LWXA 5D15A 3WG9A 4OYMA 1A9NB 3QIPB 1ZG1A 5E3CA 2BABA 1WJFA 1FDDA 1NDKA 3WTUC 2JTVA 3CMAS 1WF1A 1TLHB 2NVUB 2WAFA 2VKDA 4YUDA 4ED7A 3TBIA 3LMMA 3K1MA 2MSYA 5IT9U 1NSKL 1C1CA 1JXEA 3W2VA 1SVMA 2VFVA 1OYIA 1LEBA 4DX7A 2OPSB 4IHYA 2J0SD 4F36A 2V1UA 1GLNA 4A46A 3IWXA 4EMDA 5H6QA 3NAIA 4K4XA 2K3FA 3AHPA 3H90A 2DNRA 1LWCB 1TL1A 1YQHA 4ERDA 1Q81T 3ZZTA 2JN6A 3BROA 2XKPA 3DC2A 4J5OA 1I39A 2F9JA 3LSJA 2FBHA 1WG1A 1Z2ZA 4ENOA 4EQQA 2HVQA 1ETWA 4BJ5C 3BGLA 2JVGA 1RCXB 3HKZD 2OAUA 4IHWA 5LHHA 1NK6A 4TYBA 1DGRM 5D0HA 2W01A 3B4DA 1QGPA 4DIQA 2DA5A 2G7UA 2E60A 1K1QA 1U6FA 4PUOA 1XC9A 5B0BA 4XPEA 2QFJA 2WY7Q 4XLCA 2QC3A 5E3NA 1IN4A 4C9YA 3P6YC 4QW8A 2FOWA 2HU9A 1NRKA 2ZSHB 5HBMB 3KPHA 3FDYA 1S1UB 1Z2LA 3ABKH 5IXUA 1YW7A 4F25A 4OHVA 3RYLA 1DY3A 1WHWA 3BBFA 2W1BA 3KLGB 1UL3A 4ON0A 2KZVA 1MBEA 3ASOH 3PR4A 2UU9F 5A0YA 4KHMA 2QSWA 1SEUA 3R3TA 5CCMA 1KNZA 1HQCA 1WG5A 4L5EA 1N4LA 5C4JJ 3MEKA 3LSGA 1XNRJ 1AROP 3ZTOA 2QFIA 2IEKA 3GF2A 2R7UA 1X4BA 1ZR4A 2LK2A 1P8GA 1EZZB 1HLWA 3FBNB 1KYWA 3CMES 3ISND 5E18F 4CXFA 3OYGA 1X9SA 2L3MA 3IP4B 2A61A 4RW4B 4NOHA 4WTYA 2ZXHA 3I4HX 1KFSA 4DL6A 2QMWA 1CJKB 5F1RA 2QLBB 1N5YA 1FJLA 2P7CB 3CESA 2K9LA 3DOMA 3PTWA 5T41A 3T3FA 4DR7F 1JLBA 1K79A 1NZ8A 2UXDF 1SQFA 3MECB 1RHJB 2QQBA 3TQNA 2Q6CA 2V1XA 5A8RA 1HNWJ 2X1EA 1GT0C 4LF6F 3LA0A 2MBFA 4NC6A 3E3VA 5JMNA 4IDKA 4WFNQ 1I3OB 3RBXA 2ZBKA 5LL6d 4EYIB 1REVB 3CCES 3ZP5A 1R8AA 1SH0A 2BJ9A 2VFTA 5KT5A 1N36J 4YHHJ 2XEXA 5KT2A 3SQOP 2OZ6A 2FD2A 4USJC 1SH2A 2Q66A 2CQXA 5ETRA 3IFEA 1P27B 4HR2A 4M5MA 3MPWA 3LP1B 5M5WJ 3VQTA 1AFIA 2XY6A 5IOLA 2NS8A 3EUAA 1IR0A 2L02A 1UJ5A 4LSZB 4OZ2A 1WJBA 4PXBA 4RGSA 2IBDA 4HI2A 3GFLA 3H20A 2RU3A 3LSRA 4ENJA 3LPEA 4NLXA 3UD5A 2DQRA 1NZAA 2HQAA 4LF7F 2K02A 3MMYB 2DMUA 1RTHA 5C7PA 2WBMA 2E5LJ 3CCJI 2HFNA 1KVIA 3DF8A 4HDGA 2V9WA 2F2EA 5EUHA 3IV5A 2NYHA 2DA4A 3JRFA 2Z2MA 4UQGA 1JXSA 1N5VA 2HWHA 1R1UA 2K3KA 3IRXA 3MDFA 3MZIA 4QWCA 1EA3A 3I3LA 1F9FA 4ZJLA 1UAAA 5C24B 2FVQA 2WVCA 3NY0A 3J7AN 4C3HJ 4OIXA 1VRUB 4P2XA 1CJUB 2D1VA 3LO3A 1VI0A 2H5EA 1H2UX 1EAYC 3HIFA 2FHJD 5EEAA 1G3YA 2J5AA 4PYDA 2Q2EB 1UVJA 2HVDA 1IN5A 1YQAA 4QLCU 4J9RA 2X1CA 2CPIA 1FVSA 1ULRA 2RKHA 3HI9A 2STTA 3JSBA 2ZBRA 2GXGA 5HI7A 4H4KA 3HLUA 3R0AA 5J47A 4YIRX 2ZH8A 3K2YA 1IXSB 3LP0B 4HZFA 4XTTA 1NB7A 4CO3A 2PMZD 1HW2A 1EHWA 3KG1A 1WJEA 1HHSA 3WTZA 4O4RA 2YNGB 1OJLA 1YI2S 2QLFB 2XC9A 2KT2A 2LCWA 1Z77A 2EG1A 5FD5A 3TNVA 2DDBA 3BR3A 4XMYA 1GQEA 2Z2ZA 2EQRA 1FRIA 2BGCA 1RTIB 5K8PA 1KFDA 2LA6A 4FVMA 1MU2B 3DLKB 4MQVA 1J5OB 1NK3P 1QJHA 4RBOA 5BYRA 2CNOB 4NC8A 2HYFA 2RRAA 4WFYA 4DV6J 2K40A 1M90T 3W6JB 1ETXA 2H6BA 2HDDA 5LEKA 2GJIA 2YX7A 3SBMA 4NQWA 1F1ZA 1RT1A 3KYDB 1XB4A 5B0FA 1FXLA 1Q7YT 3SDBA 3S8PA 4J9VA 4FXDA 4HNTA 3LOCA 1AOYA 7FDRA 2RUSA 2NVYJ 1WC1A 3EZUA 2E1OA 2DO7A 2ZKZA 2R7FA 1KVKA 3FRYA 1O7LA 3JYTB 1GX6A 3PSIA 3GO5A 3CUNA 1LW0A 4B09A 4FBTA 5HNHA 5IQQA 3M05A 2KHDA 2V2ZA 4ETXA 4OAZA 3QQAA 3ZQGA 3HYIA 3WGHA 2AEMA 3RYPA 3GR0A 4GGGA 4HNUA 1T05B 1WKJA 3CDLA 2CUEA 4CLPA 4CO0A 3T1YJ 1WQ2A 1P2FA 2AJ4A 1JI8A 1JXVA 2VUMJ 1X0FA 2MDAA 2ZXJA 5FROA 4TYAA 1M5PC 4ESBA 3MXHP 1DLOB 1NB2A 4H4MA 4EI2A 2RKIB 3CDAA 4PG7A 2LP4A 3BSNA 3ZGKA 4KGZB 2R7SA 2XMWA 4A8SA 4CZCA 1K78B 1L3LA 1S6QB 2GOMA 3BO4A 2KRFA 2FJBB 4K2XA 2UUCF 2E5JA 3U02A 1S57A 2YNGA 4UZCA 2OD5A 5CA5A 4L6V3 4LG3A 1Y1VJ 5J1NA 4RU9A 2VDHA 1YJ9I 1HBUA 3REOA 1LXNA 2MZJA 1TQMA 2YNHB 3S3OA 1WZ2A 1W36C 3HHDA 1U5TA 3LQVA 3K4JA 3QWLA 2HBZB 2ADBA 1RA6A 1PG5B 2I38A 5DLGA 5EZHA 1NJXA 3PG9A 3DI6B 2OH2A 4XRSA 3O8WA 3QWUA 2OU2A 2Q1LA 3DLJA 5HS7A 1U6GA 3A3OB 2MQMA 4IR9A 2BX6A 1OKRA 4X1EA 8AT1B 4EUVA 3GSIA 1QTMA 4YR2A 3NG8A 1FEEA 1BR2A 2W9BA 4K4ZA 1T0TV 3FBCA 1Y5NB 3VEPA 3K1NA 2O61A 2M5WA 2AS5F 3OLBA 4JI0F 2V2KA 3PFYA 1WDDA 5ETKA 2XPUA 2DRDA 1EETB 2COMA 4ZZDA 1JLAA 2UXNA 4AVZA 4B3RF 1VQ9S 1FIPA 2VT2A 1ZGAA 3P49B 2HS3A 2HFVA 2CJKA 2J7KA 2L48A 4F4AA 3CCUS 3IH2A 1WVRA 5F0WA 4IG3A 3EUNA 4MEXF 4E7KA 2WAEA 1VR6A 1PSDA 4I7FA 3JRBA 3Q24A 3PO4A 4URGA 4YHHF 3CCLI 1FNOA 3MEGB 4JI1J 1F9EB 1FTTA 2DGUA 3Q8UA 1WKKA 4N9IA 4G1QA 3TZWA 4B3OA 1HWLA 1FRMA 1V5FA 5EEGA 1LK7A 4K0KJ 3TVZA 2JRTA 3IRQA 1S1TA 2AYGA 2BMBA 3Q8YA 2EEYA 5HROA 4RUAA 1T7PA 4WYLA 3DKWA 4JBAA 1FFWB 2BY2A 2GA7A 2AJQA 5IV3A 4B3SJ 2EILH 1JLEB 1PJRA 4PFOA 2KB2A 1H6KX 4DG1A 4KICA 4WXCA 2LEPA 5IPAA 4JX5A 1SL1A 3HT0A 5J2MA 3L2RA 2MSTA 1LE8B 3DV8A 4C0OC 1PUFA 4KMUX 3GFZA 3MPDA 2TCTA 4ELUA 3FEXB 1EP4B 3GSDA 1U8SA 2YKAA 1XDSA 3NGSA 5BR8F 4LF9F 1N34J 3V8JA 3GCWP 3CMYA 1J9IA 1GV5A 4ATNA 2BA9A 2VJ5A 3M8YA 3NOGA 2MH2A 3JS9A 1P4XA 2V1DA 2N7CA 1MWZA 1BQXA 1RT6B 2ROGA 2VA3A 3DPUA 1VQKI 4C8ZA 1S9GA 1UFLA 2ZBCA 2OD4A 2NR0A 3M8WA 2C42A 2QRRA 3F41A 3QIDA 4XRSG 3F6VA 4L9VA 1YITS 3TWZA 3MKLA 1UZCA 4WFAQ 4Q5SF 1HCRA 3ML6A 1ZZNA 2RH3A 2GIVA 3ZTRA 1SQEA 1XK8A 2XHWA 4BL0B 4IQJA 2Z30B 1QUVA 5E8IA 2VJUA 5KOXA 4H0EA 3CDWA 1FBQA 1X58A 1MMGA 3K4KA 3SXYA 1AKHA 1JNRB 4ZH4F 5KFSA 1C0UA 1LWCA 1TL1B 2UUAF 1R8HA 3SI8A 2VBYA 3TOBA 1R9TJ 4Y15A 5E2QA 1IBCB 1N48A 1HI0P 3F8BA 2OC6A 1P6TA 1IRFA 2RE1A 3HSEA 4LF5F 1JMTA 4OJ1A 3EUHA 4I7FB 1XNQJ 1I94J 5AXMA 4MTEA 2Z5UA 2GVZA 2JOQA 2M7SA 2RRBA 1Q8BA 1MH4A 4MFBB 7AT1B 2M45A 2OTLS 5DCFA 2VPXB 2DCUB 2JSXA 1X31C 4X66F 2AMCB 2EKYA 5C2CA 1CGPA 2IAJB 3H2VE 1TT0A 4G65A 4N76A 1O0PA 4LFAF 1R6VA 3OYLA 3F22A 2RV8A 2QKLB 5I3PA 3Q8PB 2LQ5A 4B9NA 2XMJA 3RAXA 1RT4A 3G87A 1EH7A 2EG2A 3DLAA 3BR6A 3IUOA 1S72I 3MFIA 2D3ZA 3VSKA 3VYTB 1MWYA 1KQSR 3H35A 1TQLA 3C19A 4ED1A 1DFDA 2NYXA 2K7KA 2H1LA 1NBEB 2FZCB 2QLXA 1MN9A 4NZ0A 3OR2C 1MMSA 5D5UB 2VUGA 3MF5A 4OHYA 2DGXA 2HG4A 2VKRA 1NU4A 1S1VB 3S15J 4JOMA 1S10A 2UWMA 3O2PE 4B1RA 4IQXA 2PEXA 5FLXY 2VFUA 3E51A 4HF2A 5K5QA 1DUXC 1SVOA 1X60A 4FS2A 5KFOA 3HRSA 2KPMA 3I87A 5E3MA 1KC8T 2YXLA 2Z2LA 1L3TA 3ZZUA 5K14B 5J2PA 1ETVA 1WRJA 1BQNA 4CLTA 2HHPA 3RW7A 3MAJA 3P96A 4ZVQB 2O3DA 2GAUA 2MZTA 4C8NA 4DUZF 1R58A 1HSJA 1Q1HA 2OV7A 3ZMVA 3S17J 1YX5A 2QLWA 3JQMA 2OMOA 1Y9OA 1Z9CA 1YFHA 2J6TA 3PM1A 3OOPA 4JP8A 1M1HA 1HW5A 1VJWA 4PG6A 1IBKJ 3L7PA 3BQ0A 3IH3A 1FDNA 4EO8A 1T11A 4N4NB 4FN5A 3ERED 2E9ZA 1D0ZA 3OYEA 2FOKA 2PX9A 3FBIB 3JSMB 2GQQA 3X1LB 2MGZB 1TWGJ 5FKLA 1IF1A 1UAWA 2WOMB 3OL4A 2V63A 2JPBA 2DPUA 1BUXA 5KCMA 4CUGA 1AT1B 2RAQA 4Q2LA 2ZB9A 3F8NA 4CH1A 1ZLKA 4PYAA 1ZK8A 3VFZA 1BQMB 3PKMA 5F8JA 2RDJA 4I2PB 4IRKA 2XAHA 4LSLA 4H4OB 4NB5A 1UMJA 4ZYHA 1DQ9A 2PMZA 4KH1B 4K59A 2QF7A 2OAZA 2R5YB 3BP8A 2XSDC 3H5AA 1OCCH 3EVMA 3BDDA 3OYNA 4Y2CA 3POTB 1HARA 3DOKB 3MCMA 4ZN1A 5FDLB 4ID8A 3TMOA 4K8RA 5IT9Z 3CPWR 4OHWA 2XSJC 4U0VA 4ZN3A 5IWAF 2EFWA 5J1YA 5A8KA 3ZTSA 4RX6A 4UHTA 2XGDA 4MO7A 2MLZA 5LM7E 2DFHA 2UVVA 3D4JA 4NNJA 3I55S 4LF5J 3EWGA 1E6VA 1U4BA 3VWSA 2BKNA 1JGSA 4ETZA 4KFBB 2X3DA 3A8JA 3BR0A 2LVSA 2NREA 1VC6A 5EEHA 4DL0C 1KQ8A 2GIFA 3KK1B 2KYZA 2JZ5A 2CDRB 2FZKB 4ZC3A 1PO6A 4EJTA 3VR1A 3T5KA 4U7UK 4IQ4A 2Y0SD 2DNOA 4ZCIA 5IFMA 1IUYA 3EXYA 1PC4A 4FHTA 2U2FA 1FZPB 5B66C 1T3OA 3QFWA 4F3OA 1YRTA 4ZJZA 2W85A 1XN7A 5D8HB 3OV8A 2K9QA 4X4OA 5E1ZB 4F67A 3CCUI 1UEUA 1SC6A 4CCHA 3HHNB 2ZD1B 3PZPA 3HDDA 1LJ9A 4G94A 4LF2A 2HIQA 4ZVHA 2ZUAA 3KEYA 1V5VA 2O9LA 1N0UA 5FLXU 1F36A 1QE1B 2HRTA 2YKQA 1RTIA 1ZM2A 5HLHA 3I9V2 4LMYA 1ZTTA 3IBFB 2XLKA 3KETA 3G73A 1MU2A 4MEYF 2PDAA 4A48A 5K5RA 2XHCA 2WV0A 3IAM9 3PDNA 2W24A 1MDMA 3U2RA 1U0SA 3OYFA 1NM2A 4ITSA 3OWTA 5KFFA 1U6BA 4ED3A 3RRHA 4UUXA 1IQTA 2D41A 2Z4PA 2GA2A 2QA4G 2VONA 4DL4A 4LK0F 1MKMA 3BKFA 4KT5C 3OD2A 1LFWA 3CDEA 3QSIA 2YKOA 1Z7UA 2W57A 3S2WA 1ZAXA 3BBCA 1NKBA 3S1NJ 2DA6A 4I2QA 2UUZA 1X2NA 1N52B 3PUFA 3W5XA 4OX9J 1DQAA 4XLPF 4HV5A 1T94A 3BBBA 1ZBTA 3DBHB 3PIPF 2C1EB 3UW1A 3W65A 3P5TL 1L3UA 1R8PA 2F6CA 3CMMA 3GLJA 3V6KA 1FOWA 1XGOA 3US5A 4ZPBA 3FX3A 5LXRA 4ITVA 2AIRB 2FIUA 4CLSA 4CLUA 1BMQB 3PO5A 1GK8A 2C3YA 2I5JB 1R27B 1QA6A 2K3IA 5TRDA 1W7PA 2C2RA 1CJVA 2H4YB 1FBSA 2FA5A 3C66A 2NPFA 3T8RA 2F8EX 4Q4ZF 3RTVA 2ROPA 1FDBA 3T9NA 4TY9A 5KK1A 2L54A 5HLTA 5BMZA 5FFZA 4DNCA 2OPRB 4O4GB 4CGZA 2CQKA 3BO3A 4NRTA 2QVOA 1PCAA 4DSLA 4GFBA 2BZTA 3HTUA 5E3RA 2E5HA 1OCPA 4JQFA 2ESHA 2NVXJ 1MH3A 4IZZA 3R7NB 4ES2A 1B72A 2JEGA 2BHYA 4C98A 1YZ6A 4JI4J 1OYYA 2PMZN 2APOA 4RW8B 1NKCA 2MLYA 2KRBA 2ZKTA 4XNFA 4E70A 3R7BB 2KG1A 3ZC4A 4YDXA 5FKKA 4OI4A 3MCOA 2BANB 5ED4A 5JUMA 5A8WA 3M6UA 5F3ZA 3DLGA 4CICA 4BC7A 4HACA 4DPYA 1RPWA 4QU7A 2HGNA 4F4WA 1TL8A 3JTNA 4DPTA 1SJRA 3A8KA 3F0NA 4Y3OA 4ZS6A 1NAQA 4A3IJ 3FCVA 1OPZA 4AM3A 1DZ5A 1AZSB 3EDQB 1PUEE 4QIWN 5LLQA 1RWKB 5BYQA 2C3UA 1B0TA 4OIOF 3NNHA 2XYHB 3BSOA 3ILJA 2MJUA 2NZ4A 4YMEA 2BY1A 2IFXA 1Y5LB 1FWZA 6FDRA 5FFXA 1IKXB 2VQEJ 2G0JA 2HK2A 4B9LA 2HVHA 4YIFA 4OFZA 3QT7A 1JKOC 3ELKA 3M8SA 5SZTA 1QSYA 2UU9J 3PRBA 1URRA 2ZH9A 5GAHJ 4N5SA 3AA9A 3DBRB 4AT1B 2L9SA 1EX8A 4P96A 1V3RA 5FB2A 1IAWA 2R2SA 5KFJA 3T1HF 4K5SA 3TEGA 4MKAA 3VODA 1NYNA 4ED6A 1S0NA 4XDCA 4JV0A 3BH7B 3FKBA 2RN7A 5A8WB 1Y0NA 1IW7F 4C3IJ 3WX8A 4TU7A 1VQ5I 2ECCA 2N4DA 4X0GA 3K70C 2AGOA 2QL7B 2D2WA 1GFWB 2X0LA 4QPTA 1TR0A 5J2MB 2IM3A 4USIA 2VBWA 3G3ZA 5ICFA 3I0RA 2ZITA 1Y56A 1UTAA 4RAGA 2QA1A 5A0YB 4DG1B 4EEFG 3HCXA 1W36D 3FNNA 1IKWB 2HEKA 2OLWA 2VQFF 2GOXB 2XZDB 3GFHA 3KMQA 4DR1F 1I6XA 1PUFB 1USTA 2WB4A 3ZQCA 4P9FA 2G9WA 1HBXG 4EO6A 3BDEA 1QHGA 2MZ1A 3DDNA 4AIDA 3O3LA 3VQSA 2Y2ZA 1RLCL 1KQ0A 2ZC3A 2V4JC 2DH7A 3V81B 1Z3YA 4M9XA 5IC6B 3MD2A 3ZQHA 2DGSA 3HF5A 1GVJA 2XF7A 3DKXA 2Y75A 2F5GA 2IMOA 2OCCH 3PX6A 2X1AA 2CQIA 2LLZA 1TV6B 4IVNA 4NLQA 3S3MA 3OXFA 5KFDA 2IBKA 1DARA 2WZ1A 4F26A 3PIOQ 1Z05A 4NXNF 2IAJA 3BS9A 4LLNA 4NLPA 1K61A 3Q2SC 1SI9A 2CUFA 3B78A 1VFCA 1ERDA 1U09A 3HGYA 2MKSA 2HPUA 1OYWA 1WPKA 3QOPA 3QATA 3DU6A 2COLA 3UPFA 3IA0A 1RK8A 3V6DB 1IC8A 1VLYA 1MIJA 2DNYA 4WWSA 5CABA 2D69A 2IP2A 3P5JA 4Y4RA 3MPVA 3EYZA 3HKZA 1TELA 2JA2A 1IN7A 2WB1D 3FISA 1R5HA 4O3MA 1A7GE 2LH9A 4RA2A 2ZDPA 2EK6A 4E7LA 1U1MA 2KQRA 3NWRA 1RTJB 4C3KA 2XVCA 4M5JA 1I5OB 5DM7Q 4BHPA 3OYHA 4ZVSB 4DXLA 1X4OA 4QIEA 1RTDB 4B3TJ 2IS4A 1JLFA 2KVIA 3D3BJ 1CQMA 1AA1B 5KFCA 3K4MA 1XSVA 2LU1A 3NRBA 1BOBA 1CULA 3MOJB 3SCLE 4OI3A 2JEJA 3H59A 2FMLA 4GDFA 1IM4A 4OI2A 2WVDA 1FPQA 2UV1A 1UVLA 2GVDB 2W7PA 3N6LA 4ENKA 1F6TA 1U8WA 3SCIE 1HOMA 4O3PA 2N8GA 2V6EA 4DPXA 1IRXA 3TL4X 2EWNA 4E6KG 3S1QJ 3RR8A 5K9FA 2CFOA 1FC3A 3WC2A 2CJ9A 2G2OA 2K4BA 3N9UC 2WV1A 3HM5A 2QMUB 3MR2A 3FSYA 1WACA 2BEOA 2DNHA 1DHMA 1R6YA 2ELJA 4C48A 4UOHA 3I58A 4BKXA 4PJMA 1RR8C 2IVYA 2R7DA 4P7VA 2PD1A 1IKWA 2HLTA 2M8GX 1S12A 3S6EA 3TUIC 3GPAA 1TMMA 1EIYB 2YNIB 2XS5A 1Z1ZA 4A3BJ 4ZK7M 4CYUA 1U9OA 2DT5A 1FX2A 3EE3A 4G7ZF 4PUSA 4M6XA 1IXKA 3BV8A 4ZIVA 3CO6C 1VQYA 1N78A 3HDSA 3ILLA 1MD0A 2IY5B 3K6GA 3JSMA 2F5FA 1XCVA 2JUCA 4M3EA 1VF9A 1P1TA 2ROEA 4WWCA 1LE8A 2LY9A 2ID6A 5DM6F 2BXZA 5KG4A 3MR5A 1LK5A 1YLXA 2BV3A 3J81j 1PIEA 1HF0A 2DGOA 1TKDA 3ABMH 1KN6A 4N4OB 2JZYA 4OWRB 3UVJA 3FRZA 3PYFA 3PJXA 5AJ3J 1NH3A 2R7ZJ 3IBCB 3WGIA 3BZKA 1D0EA 3A02A 1JB0C 2KJWA 4Z2YA 4NC7A 4G7OF 2MKYA 2NVQJ 2Z2SB 4HF0A 5LMUF 2HW3A 4OX9F 3TA1A 1L3VA 3RZAA 1EQ0A 5DG8A 2IS2A 1RISA 4PAAA 3P9IA 2BVZA 4UVAA 2F1FA 4OYBA 3M8ZA 3UCGA 1YHQS 1NK2P 3Q22A 4OZ3A 4A8MP 3PYEA 3RZDJ 2MXYA 1T0FA 2W00A 3OFFA 3C2HA 1YOVB 2WB1A 2E36A 1TK8A 4M5HA 2VKVA 4I76A 1N32F 3WTWC 1YW9A 5B1BH 4NLOA 4BC9A 2P9GA 1BOAA 4DSIA 1U24A 1KR4A 3HSFA 1H38A 5DQHA 2OTLI 5LXYA 4OI1A 1HC8A 1N0VC 3ZZ0A 4QWDA 2VQFJ 1I27A 2PBIA 3DRRB 2E7VA 4U7CA 3MMCB 3OYAA 1VYAA 4A5MA 4AU7A 1WSRA 2X1BA 4PR6A 2IPQX 2ETHA 2EFVA 5AJ3F 1SVLA 4KN4X 3QT6A 1TMJA 1Q53A 4C11A 3LWMA 1JLCB 2RF2A 3S32A 5J2QB 4FYDA 1H3DA 4FYWB 5IT4A 2XI2A 2E1AA 1OYEA 2FRHA 4HX7A 4ED8A 1RAIB 2M52A 5LRRA 2ZNYA 1GEHA 3W7BA 2R3SA 2YKNA 3HSJA 4B3RJ 4EVIA 3MMBA 4IOAQ 2QA4S 2M87A 2LF8A 4DQ2A 4ANJA 2EFPA 5F8MA 4XLEA 2DPIA 1DPRA 2ZM6J 3QRRA 1VQLS 3KG4A 5IP9J 3LALA 2M8EA 3MUMP 4F92B 2LFBA 5D78A 1RBLA 2J9CA 2QEXI 3L7OA 2W7AA 3THPA 4URSA 5KG7A 1Z7LA 1FRHA 3CF5Q 2FNAA 1XBWA 1RSCA 2XMUA 1JKRC 4TXSA 1B59A 2YR2A 4A3FJ 3KFWX 1R5GA 4RB0A 1WSUA 4EJOA 2CQ2A 4WK8F 4FF4A 4DDFA 5M3MJ 2P2CB 3FHZA 3SQGB 3RBEA 2XCPA 3F3XA 5CHCB 3QYFA 2CJXB 1VI7A 2RD5C 2IM1A 4YFXF 1HQ2A 3IP0A 1S1TB 4OMZA 1RT4B 1NG7A 1K47A 4R79A 2LVWA 3D67A 3DTIA 1S6UA 4EK2A 4CCJA 3KDOA 2Z56B 1M0SA 3OTDA 4ES3A 4U8YA 2HVEA 1TL5A 2QENA 2M34A 3D2WA 2UP1A 4CT9A 2DNGA 4G1IA 1Z67A 1O3QA 3WG7H 2CPHA 2I6WA 4LVOP 1UG2A 4EGLA 1BJZA 2XBPA 4B3TF 2KJCA 4ELTA 5M5YJ 2NOGA 1B4SA 1WD6A 3BQZA 1QQIA 1TTHB 1MDMB 3MTJA 2HQFA 4I0BA 1TK5A 1T98A 3AOAA 5IT0A 1XTZA 2QZ8A 3BR2A 3BR5A 3QO9A 1DJ0A 4DMZA 3DKYA 1ONVA 2ZXWH 3TDUC 3TOAA 2BW2A 2E19A 5CQGA 3NS7B 3ETMA 4A3GJ 3QLHB 3WTYC 3RRGA 1YK9A 4HTJA 1JTXA 1JTYA 5LGUA 4JYAF 5IY5H 1HXDA 2DIUA 1SUQA 2AF6A 1DP3A 1FJCA 3C2GA 1NDCA 4CH7A 3PY8A 3HRTA 3CCLS 2C3OA 1RT3B 4MIBA 2PGCA 3BZ6A 2A6HF 2ASJA 1SKWA 3D1QA 1CJTA 1O7FA 4DR3F 3C6UB 3UNYA 1S9GB 3MR3A 1Q82T 4YB5A 2HNZA 4UUSB 4P7TA 4KUMA 3WC0A 3CCEI 3FZ2A 1CJKA 3I9ZA 3DLHA 2JRMA 4P9UA 4ZCMA 1S0VA 2DITA 4IFYB 3H3VK 2W7NA 1UJ4A 3AD9C 1OR7C 1XGNA 3K5OA 2YKMA 2B9XA 2X51A 5KFMA 1MBHA 1GMVA 3TR5A 1OCRH 2PFDA 2PG4A 5FDLA 3FHNA 2GIZA 3MM5B 1PBAA 5A6WA 1C0UB 2R7OA 3MUTP 3U27A 5KFLA 1T33A 5B0DA 2ZXIA 1AA7A 3ZXSA 1B1BA 2CZ9A 3DLEA 5M5XJ 3FXKA 3CMEI 1DGWY 1S72S 4O4GA 2R42A 3A0HC 2BV6A 3JRIA 2LREA 1RNLA 1SFKA 4DV7F 4USHA 4DS5A 4GO5X 2E2HJ 2J0QD 1SD7A 3C6UA 5CYMA 3QP5A 3HO1A 4EJUA 1U2FA 1D0XA 3SSQA 2DFEA 1Q1VA 5HMXA 2X6WA 2F5EA 1ROFA 3M1VB 2D1CA 3M1CA 1OCZH 4I01A 3GLLA 1T9XA 3Q0UA 2HBQB 3M2VB 3VYSB 5F8GA 1RUNA 1G59A 1OSCA 3OTEA 1KYZA 1XD7A 1PYTA 3BREA 4HX8A 4IKFA 4L75A 1TKTB 3HKWA 3NCRA 3PSFA 4Z6YA 1KONA 2WVBA 2PIIA 1FXRA 4PSXA 5KFTA 1FX7A 1NJZA 2ZMEA 4GKKF 3MM8B 4UTGA 3IG1B 2M4MA 4OZNA 3MZYA 4NI2A 1ODDA 5AT1B 1QD1A 3TAPA 1FESA 2CPXA 4JI3F 3AL0B 4RKUC 3KHHA 5D5WB 1KQFB 3S14J 3NARA 2GX8A 5FO5A 1X4EA 2AX0A 2OA4A 2ID3A 2XULA 3KUGA 4CQ1A 3CO7C 2FVSA 1IG7A 2JL9A 4A3KJ 2W9AA 1R6RA 4OI6A 2DD8S 4RW6B 4XN3A 1IJEB 1I6JA 2XYPB 2FHMA 2L9NA 3CVKA 1K0TA 3E3XA 2A6EF 4XSXF 3NCPA 3LGMA 3G8TA 2VZ9A 4K4VA 2ZZTA 4C0BA 4OHXA 2K1RA 2Q0OA 3PNVA 2CIMA 4PWWA 5EZGA 3J7Z5 4DL3A 2OP5A 2EIJH 4M5LA 5DM7F 4JI8J 3H9JA 2LSOA 4BY7J 3RGIA 3ISPA 2ZH7A 2G2YA 1LKZA 3CJQA 2HSEB 2CJBA 4Y34A 3J81Y 4YEAA 3T19A 1OPIA 3ZZPA 4I02A 3KYCB 2MPUA 5L39A 4M5KA 3G86A 5K5MA 4DR2J 2YPYA 2DISA 4NX9A 3KLVA 1RR7A 5IP7J 4F0MA 1VC5A 1Y3KA 3MEXA 3HVWA 4ZLJA 2FJAB 2IA6A 3KHLA 1OIAA 5J1EA 1E3PA 1HMVB 3I0SA 3MQ0A 4A93J 1IR2A 4ZP8A 5HODA 3GTQJ 1S1UA 5JJBA 3R5JB 1DU6A 3D0SA 1U8RA 1YI2I 3V8KA 3KX2A 4X4TA 3VTIA 1RXOB 3DCAA 3J7YU 1HBMB 2N82B 3H2LA 1A6IA 2K5CA 4IRHA 3DLLF 4N47A 4BWMA 3CQZJ 3DMJA 2MMYA 4J37A 4WZQA 3LNQA 1IJFB 5KVRA 3T41A 4FKYA 2V8PA 1FERA 2PA3A 1XX5A 4WTOB 2ZCWA 2DKOB 3L95X 2XRNA 3Q9VA 3VAGA 1FF2A 3QGPA 5A76A 4L3KA 4F52A 1XTAA 2MH9A 3IS9B 5LT5A 3ZMSA 3PYGA 4HT5A 2HURA 1Y39A 3R5DA 1V9OA 5L3DA 3CC7S 1HKSA 2ZJRQ 4WK1A 5D4NA 2HHHJ 1ETKA 2ZZNA 2V8GA 2R2TA 3ZMTA 4UOCA 1QZEA 1D9DA 3IR7B 5KFVA 3C7JA 3TJ9A 5DG7A 4LRBA 4YY3F 3QAEA 1HI1A 2GMLA 5C25B 5TJJA 4A6EA 3M2UB 5LSRA 3IAM2 4A3MJ 3KJVB 2DY9A 2LOOA 4RGUA 1YG0A 3W8PA 3OJUA 3GTJJ 3OYMA 2OHDA 1HR0F 2DW4A 1YYVA 3MM7B 3LAPA 3LW5C 4XLHA 4GYIA 1PYSB 2J0WA 2IA2A 4H4OA 3N6NA 1W0UA 3T5LA 4J9PA 2XG8A 3BGUA 4L73A 2ZNZA 2V8DA 1SB6A 2VF3A 3BGRB 3ZNJ1 1DP7P 1K44A 2A2DA 1R1VA 1R43A 4IFYA 3DHWC 1IJWC 2HDWA 4WXOA 2HKXA 3VAKA 4XQFA 4DL5A 1SAUA 1VQSA 2W2NP 4CCMA 5D8LB 1HWJA 3G71I 2R5YA 1N54B 2Z0GA 2R2UA 3MUVP 4LFCJ 3TQEA 3UN2A 1A35A 2UUTA 3CDIA 1HL6A 3K5MA 2D3OR 4KHRA 2DR9A 5HL7Q 3UDEA 4FF2A 1RT2B 2GIQA 1HPZA 3K5NA 5JLWA 5D6GA 1FMWA 2JLGA 4N0BA 2DRBA 3E01B 1QRYA 3CJQB 5CPRB 1ZA2B 1SANA 1Q78A 3KOAA 2EINH 4B8XA 4A8KA 3CJSA 4WXHA 3PFEA 1GXUA 2GZWA 4LF1A 5GAGU 3CD6I 1WG4A 4PG8A 3D9BA 1E3HA 1XSXA 1H9GA 4I56A 3VHQA 2WWYA 4M6YA 5D0EA 2V94A 3OYKA 4OINF 4ZYDA 4DV4J 3MKYB 3SDEA 2HVZA 2Y69H 2RQMA 3R5AA 1F9NA 1IWGA 5KFNA 3WU2C 5F6FA 3J80Y 4M3DA 2O66A 3DKDA 1TWFJ 4O6JA 2M7BA 4JI7F 3KEOA 3MHYA 2FE3A 4E7HA 2CPYA 5F9LA 2JLFA 3R0JA 1FCAA 4IX7A 4ZVFA 1Z6TA 4B3XA 3U1NA 1U3EM 1K83J 2HQCA 4FNIA 3GUDA 4D9JA 2VOPA 2AWZA 1FYLA 5B0GA 4KH0B 1JJCB 3W62A 3PKYA 1PAEX 1TW2A 3I55I 4X4VA 4C11B 3LPYA 2MKIA 1WC5A 3B6AA 1ZETA 1TT5B 1UB9A 3R97A 4QW9A 1R36A 3E6CC 5H20A 2C3MA 2OSQA 2V1NA 1YBTA 4A3DJ 3S1TA 4FE7A 2ZE2A 2NXCA 1WHXA 3QPTA 1Y6IA 2E29A 3MEGA 4DR1J 3S7RA 2B5JA 3E01A 1Q1KA 2OBPA 2SXLA 5DLFA 3Q86A 1BWEA 2ILYA 1G7CB 2XY7A 3ZO7A 2BOPA 4ZDNA 4WYWA 4ZTFA 2RRNA 3M9OB 1F5TA 1S0OA 4MK7A 3W2AA 4AUKA 3F72A 2AXLA 2E1CA 2AYBA 2E5GA 2RF2B 3ESWB 2BW3B 1CBKA 1S6LA 3UD4P 3PX0A 5AONA 3MPUB 4NCBA 3GYNA 3KLIA 3DCFA 1XR5A 2ZFWA 3PIPQ 2CQHA 3FXMA 2IGKA 4CO5A 3GTMJ 2ZSIB 5C42B 4Q8FA 2LBFA 4ZKAA 3QODA 3ZFVA 5EDWA 5HQLA 3BWGA 2HEOA 1N5QA 2IA1A 4Q5VA 3TANA 2BOAA 3MN2A 1S7AA 1ZKGA 2HTJA 3BM7A 4RNHA 4R5PB 1RT2A 3IC1A 2IYIA 3MAQA 3S1RJ 1FE4A 1HW8A 4BUPA 1H7XA 3OLAA 2DBBA 4CM0A 3GJRB 1W2BR 4DFMA 2DK5A 3HUGB 2UXCF 4N8OA 4G6TB 4XIDA 1P6RA 4AD6A 5CD4A 3K89A 3G82A 3ILIA 2KH9A 2KJVA 3JXOA 1R71A 3FK7A 2CH0A 4P72A 3HTSB 3DGPB 2ZO4A 3R1LA 5KG3A 2DJNA 3KK3A 3K57A 4RW6A 2RAEA 4OYOA 3M8QB 5FGMA 5B7WA 1PILA 2KP6A 1S4EA 4CSWA 3HOYJ 3G6ES 1EV7A 2G1HA 3FUYA 4RLFA 2LMIA 3CCMS 1KZHA 3VWBA 1ACIA 4OZ1A 2Z9OA 1D1AA 2P5VA 2VFRA 3LSPA 3MM6A 2X9DA 1TQPA 5ETOA 1SCJB 4D1QA 1QSSA 4NA2A 2W1OA 2B0LA 1XNQF 4PXDA 4CDGA 3TVKA 2G7HA 1FTCA 1RETA 1PC5A 1GXQA 4K4TA 1YRXA 1R7JA 1S3JA 1MJAA 1N34F 2BJ8A 5F8LA 4PQAA 2F4IA 2I9SA 3E0JB 1VQ6S 2ZFUA 1RQ0A 2ZJPQ 3P7NA 4HQMA 3I59A 2Y8WA 4BXXJ 2HXIA 1POGA 1RBAA 4HNVA 1UG0A 2QMXA 4DV4F 1G4CA 2VL8A 2HNYB 2IJFA 2ZJPF 3KG0A 1F60B 5T7LA 3D5MA 1F3VA 5K5OA 1ULYA 4PZVA 2MGQA 3CDHA 3F21A 2KIFA 3K1PA 2P9CA 2COBA 3SFUA 4HQEA 2E5IA 2ZDOA 5J1EB 4ANEA 1XCBA 4A6DA 1MSEC 1TFWA 2JA6J 2HFUA 2E35A 4F3QA 4OU0A 2GXAA 4EBDA 4CIOA 3D1OA 2BE5F 2HLUA 1TVRB 2PO4A 2WHOA 2CKWA 4URQU 1RHMB 2XPVA 3MFHA 1TQIA 5TGTA 1BA5A 5J4VA 2C6YA 3VAIA 4DR6J 1IXCA 4AIHA 5AE1A 3PL8A 4QYZJ 2X6OA 4ILRA 4TLRA 2M1BA 3N97A 3R9LA 2I8DA 4RDUA 2G13A 4WF9Q 2QJ3A 1VQMI 2W2QP 4OX8A 3NLCA 4S0HB 4LREA 1OCOH 2MSSA 3TW0A 1RAFB 2A69F 2FU4A 4K4SA 4GXOA 5F0CA 1P92A 2B63J 1Y8RB 4HDHA 1HNXJ 2MQQA 3RKYA 1WWHA 3WODF 3C8YA 3LAJA 2FC9A 5IYBJ 2Q2EA 3WHCA 1O57A 1IBKF 4BHCA 2W9BB 4S05A 2J7WA 4I09A 5KFHA 4M63A 1RU1A 3J81Z 3I5UA 3JREA 3A8EA 4EM0B 4JP0A 4P1WA 2FNPA 2UVUA 3I31A 1KGSA 2CQDA 4DUTA 3GCMA 1K0VA 3QJLA 2IVMA 4MAKA 3J7ZT 4L5IA 1SIZA 4ZLPA 4O5VA 2M3AA 3I4NJ 3EYIA 5LSOA 2W8KA 2JRSA 1X4PA 4UW2A 1BJAA 1JJ2R 2BBEA 2P6TA 1ZRCA 4FE4A 3ZQIA 3HOVJ 3KZZA 3BKUA 1G8XA 5JR3A 4ALZA 1QO0D 2K06A 1KRPA 3ZMUA 3V42A 1GAOA 4F50A 3P5BP 2DYRH 5GMDA 4LF8F 1VQOI 4AFFA 2W25A 3HM9A 4IPAA 3IWNC 3OXLA 1HBOA 5KFPA 1LFPA 2V2VA 1SPBP 3MM8A 2HGLA 2W2MP 2H1YA 3BPDA 2ZHAA 2BDPA 3OL3A 4LSNA 5LRSA 3MD1A 1S0MA 3PM9A 3H92A 3BG6A 4II3A 4N9HA 3HHLC 4BXFA 2QLZA 4WKRA 3EDPA 4HYKA 1QAIA 2CJQA 4NMLA 1TVRA 4IO9Q 3CCJS 2VJJA 4WKYA 2B8PA 3ZZYA 5CCLA 4JI7J 3S16J 5MLCV 2L0KA 3LA2A 2BR0A 4NDLA 3FJ2A 3M1VA 3VYRB 4BH9A 2ATLA 2XC7A 2X1GA 3SDGA 4FYXB 5L1JA 3I59B 3B6CA 1SMTA 2Z33A 4PG5A 5A8RB 2RILA 2XY5A 2HOSA 5J8FA 9ATCB 1T03B 1KLMA 4EWTA 2WY8Q 2E5NA 2HWTA 1QHHD 2F4MB 1D8KA 2EZHA 1T9UA 1YX2A 4CTAB 1RHRB 2HNDB 2WOMA 1UEKA 4RW4A 3LA3A 2RNGA 5I3UA 4HACB 3VYUB 5KT3A 3W61A 2NSCA 3FSIA 4HA8A 4FQGA 1R1TA 2ZJQQ 2AZ3A 4Y52J 4OMFG 2DTZA 2FJWA 1ZAOA 4K2EA 2E1PA 2JEFA 1TL3A 4KPYA 2UXCJ 4KT0C 1ZTRA 1GMUA 3BTJA 1DU0A 2CV1A 1FNMA 2R7WA 5GADU 2YNFA 3ITHA 2P6SA 2QSFA 2BVMA 2EV6A 4QR0A 5EHHA 4XONA 4QU6A 3AG1H 4NHJA 4I68A 3OYBA 3PW0A 1BIAA 3HOWJ 1X0PA 4CRJA 2FLNA 2LR8A 2RVCA 3TO7A 2MD0A 2UV8A 3DPLC 4XOTA 1J59A 3NOCA 2BE2B 4DQSA 2ACJA 2JH3A 2DEJA 5KT4A 2VC0A 2L7ZA 1FJGF 4EM2A 3V8LA 4ED5A 3DNCA 4QIWD 1YIJI 4PJJA 3AT1B 2Y1LB 4GVBA 3CULA 4NEYA 3BTCA 1JT0A 4V19J 1YE9A 2K7JA 4BS9A 2AJ2A 3EX7B 5H6RA 3C3LA 3TGNA 1C1CB 4XKWA 1HNIB 3SMZA 3O6BB 5ILSA 3FMBA 4KT6A 3RI4A 3W66A 2V0NA 3C6TB 4KJZA 4XSZF 1U8BA 4QIGA 2LEAA 2CPEA 2KM8C 2ALYB 3N01A 1HBNA 3LAMA 3NGKA 1VQ4S 1LDJA 1JJHA 2HOAA 3GTKJ 5GTHC 4UUTA 1VK3A 1FKOB 2J8SA 2DMQA 3DN9A 4ECRA 4DN9A 5KFUA 1F5AA 4TN2A 5J2QA 2FC8A 1VRQC 1TUGB 4XLAA 4BGDA 4ER8A 2FVRA 3K5LA 3KP5A 4Q8EA 1CEZA 2OQRA 1F5BA 3D5LA 3HKZN 2R4GA 1VRUA 3KNAA 3HULA 4DQIA 2GGPB 2FSWA 3DRRA 1MG7A 4YOEA 2ZOGA 1IRGA 2IM2A 2L4MA 4AWXB 3NP5A 3KLEA 2QA4I 4IF4A 1RCOB 1WC0A 3QU6A 2IJLA 2VC1A 3GVAA 5CD4H 1XQIA 3I32A 3CIMA 2B9WA 1Z0XA 1SFEA 1D3WA 2CMPA 3CMAI