2KDOA

Structure of the human shwachman-bodian-diamond syndrome protein, sbds
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
252
structure length
252
Chain Sequence
b'GHMSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome maturation protein SBDS
publication title Structure, dynamics, and RNA interaction analysis of the human SBDS protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 57
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2009-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01172 SBDS Shwachman-Bodian-Diamond syndrome (SBDS) protein
A PF09377 SBDS_C SBDS protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.900 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2kdoA02
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kdoA03
3.30.1250.10 Alpha Beta 2-Layer Sandwich Hypothetical 12.0 Kda Protein In Nam8-gar1 Intergenic Region; Chain: A; Ribosome maturation protein SBDS, N-terminal domain 2kdoA01
1P9QC 1FNMA 1ZM9A 2I0XA 1KTVA 5G4DA 1N0VC 2CVEA 4MYTA 3E3XA 2NPFA 3B78A 1ZM3A 4QR0A 4TNOA 3UI3A 4ES3A 1NYNA 1ZM4A 4M1KA 1ZPWX 2XEXA 3OQ2A 2J7KA 2ZITA 2EFGA 4ES2A 3ZZ0A 3EXCX 4ZCMA 1T95A 3ZZTA 2KDOA 2BV3A 3LH2S 4MYUA 3B8HA 4FN5A 4QR2A 3ZZUA 1VI7A 2I8EA 4QR1A 4ES1A 4ZCIA 4MAKA 2E1RA 2IVYA 4ZCKA 2BM1A 1ZM2A 1N0UA 1U2RA 2WBMA 2BM0A 1ELOA 2L9NA 1DARA 3B82A 4ZCLA
chains in the Genus database with same CATH superfamily
3VVUA 4QU7A 3H5AA 1TTYA 3KP6A 3K2YA 3KMQA 5KCMA 4QR0A 3S14J 3A01A 2RQ4A 4D3GA 5J2PB 4TY9A 1URRA 2YQ0A 5D0HA 4B3SJ 3K2AA 4KB7A 2OMLA 2HQCA 3UDLA 2BW7A 3LSRA 3F73A 1FMWA 4P2FA 5GTIC 4ID5B 2GOMA 4BEHB 1NHUA 2JLFA 1YJVA 3SEOA 1IKVB 4YIIA 3PIOF 1Q8KA 2VDIA 4LFAF 3VYUB 1RT5A 4A3KJ 5D4RA 2ABYA 2GGPA 4NL5A 4PXDA 4XMYA 4NUBA 2GA2A 1VQKI 1O8BA 3W61A 3A3OB 1HHQA 1VQ4S 2EINH 2IY5B 4M74A 1KOHA 4B8XA 2KM8C 1IKXA 5BOXA 1J59A 3FX3A 1WG4A 4JI6J 3J7YJ 3EZ5A 2AP6A 3E6DA 4KHPF 5C5JA 4MLOA 4DLGA 1VBXA 1PJ7A 2FBIA 1DGWY 4MGRA 2MTLA 3D6MB 1HSJA 2H94A 2W25A 2M9HA 3RW7A 1CC8A 1HA8A 2RRNA 1HQUA 2LMDA 3G1MA 4ZVEA 5MAOA 2EFVA 1TMMA 4MYUA 4QIGA 3TBIA 2R2UA 3D3CJ 5HI7A 4BWJA 2F4OB 2MSSA 1W0TA 1G3YA 5LBQA 3AA9A 1LB2A 1BR4A 5HVFA 3FK6A 1TC3C 3OUYA 2P2CB 2P4WA 2BY1A 2X1FA 5JHUA 4KIAA 4CNYA 4FCYA 2RRBA 5DLGA 4OIRF 3M6XA 2L5QA 4CM0A 3KP2A 2FQ4A 3PHEA 4PJNA 1LNQA 2PMHA 4YOEA 4TLQA 2E1AA 1WJFA 4CCLA 5FD1A 1VQ6S 2IRXA 5HP1B 2RGVA 3LQRA 2AZ1A 1PIEA 3IA0A 5KFAA 3SCLE 5CQEA 1U1PA 4LF1A 2EKNA 3F44A 2BJ8A 1RHRB 2R93J 3C14B 5IP6A 2R7FA 1FEEA 5C7PA 2NCKL 4BHCA 1SC4B 3PO3J 3LGNA 3V7SA 1YIJI 2WRMA 1ELOA 2Y0SD 2WONB 3IS9B 1JX4A 3GWZA 2Z8QA 3ADAC 2F2EA 3RPUD 5FLXK 2YWHA 3HVTB 2APOA 2CJJA 3ERED 3RR7A 2BE9B 3CT9A 4WYWA 2Z0GA 4ED0A 5KFJA 4U0YA 2H09A 1OIAA 2XI3A 1U5TC 1X2NA 2OPRA 2Z56B 1VF9A 3K7AJ 3OMYA 1LW0B 4KFBB 1NJZA 5D5WB 2C42A 3AY0A 2H6CA 3BJAA 3KKFA 2HYIB 4UNOA 4YN3B 4P74A 2A2DA 5E3OA 4MH8A 1IN4A 3NQOA 3IWXA 1B9MA 2XSFA 3QIPA 1VHFA 2LXFA 4Y28C 4P9FA 1S7HA 4MEYF 1U02A 1GVDA 2DJNA 3QP5A 2WAQA 4DX6A 2DR6A 3CCUS 1F5TA 3L2RA 4NYZA 1P6RA 3REOA 1TKDA 1R1UA 4ESFA 5A8WB 2DT7B 4G6TB 4ID8A 2LLZA 2DR9A 1FKPB 1WH5A 3G2XA 3AL0B 4QYRA 4UUVA 3ILLA 1M5HA 1X4GA 3I9V9 5A76A 1P4AA 4XKBA 2KRCA 2MH9A 4ZVTB 2QE5A 3FBCA 1U26A 2FNAA 4PJMA 1SV5A 2HYFA 4KTQA 2OJED 2AQEA 1UFWA 2W48A 4MYTA 4KT6A 1I3AA 2EC0A 4O6JA 1NJWA 2HEOA 3M8PB 1EETA 3RTRA 5HBMA 1XCVA 1R8AA 3CDAA 1I94J 3DOKA 3SEQA 1WC0A 2D9OA 2LFBA 2DRAA 1LWCA 2K2PA 3T1BA 1SD4A 2V67A 4JYAJ 5IWAJ 1FBQA 1V5IB 3MZHA 2RRAA 1RWPB 1MH3A 5KT7A 1Q53A 4ICLA 1HBOB 3MR3A 2YKOA 4ECWA 4IH5A 4H4MA 1WEZA 1TVRA 2YH1A 1SFEA 4F4AA 3E7LA 2DYRH 3V7RA 2ZBIA 2CQQA 1KWMA 1VQPS 2W00A 4J9VA 4DL5A 4R5PB 3WHBA 3JCUC 3V81B 2DHAA 1VCTA 4RGSA 1GMWA 2JA6J 3AJ2A 4QSHA 1WNEA 3EZOA 3MM9A 4ZDNA 2D5VA 3MPYA 2JEJA 4ZHRA 3KEQA 3QAEA 4QR1A 1ZG3A 1ON1A 1XWLA 5D3GB 4PEOA 1MNEA 1SL0A 1VFCA 1BI3A 2C3MA 2W9CB 2Y9YA 4MTPA 4Y13A 2K27A 4X1EA 1PILA 1E2XA 2WVCA 3BG5A 2HNYA 4OWRB 3D1HA 3CC2S 4A8WA 3Q22A 3Q8PB 1H3DA 3US5A 2GVDA 4RU9A 3HHGA 3ENWA 3D6TB 3DGPA 2COMA 3HC7A 1LUJB 4FF1A 2XAFA 4PYAA 4NQWA 3MZIA 2HZVA 1AFIA 4OIPF 3BH7B 5K7FA 3LL7A 2ZB9A 1WORA 1D5YA 3JB9k 2XSJB 3TOAA 4LMZA 2B9YA 1B72A 2GAGC 5HN0A 2GQ2A 4ES2A 3RR8A 1T95A 4XLHA 2PI0A 5ADZA 4A3IJ 2LFVA 1OSCA 1D9AA 2CV2A 4CYUA 1TAQA 3O3LA 3ICLA 4WKRA 3I59A 2E9TA 4C2MA 2UUBF 1RWWB 1RU1A 2F8MA 4FYYB 3ZN0A 2AQFA 1U2FA 1TMJA 3MCNA 4BNCA 3MCSA 3LO3A 4I0WA 5FIIA 1R0AA 3GXOA 4FPRA 1WDTA 5KG3A 4IEJA 3MEGB 1DPUA 4ZZDA 3BJ6A 1QNTA 2EFQA 2VV5A 1MN9A 3T5XA 3WTVC 3AB2B 1V5FA 1BD6A 4YRVA 4LMYA 2ZKUA 3AXKA 1G4CA 1UW9A 3COAC 4JI0F 4KHRA 2MQNA 1MG7A 1T9TA 2EFPA 2JVOA 2YQ1A 5E3NA 5E7OB 3AL0C 2I5JA 4ZITA 2G13A 4NDLA 1HBMA 2ESHA 2VFTA 1YVFA 2XMTA 3CUNA 2MHNA 3RW6A 2VQEJ 2HSEB 5L46A 2Q1LA 3FVYA 3KK2A 3E0JB 1S0VA 3ZMUA 3KWMA 1EX8A 1RKIA 1FVSA 4BHBA 3H8YA 2LDIA 4A4JA 3FKJA 1PYOB 4AVPA 3G1LA 3NCRA 4U7UK 4ESJA 1D8ZA 1YJTA 1VC0A 3RRGA 4G65A 2FJAB 4BJ6C 3UO0A 1UAAA 1KDNA 2PI4A 3D0SA 3OFEA 1I1SA 2IVFB 2FA5A 5J8FA 1BQXA 3AOAA 1GQEA 3MEEA 4B9UA 2Y48A 1JGGA 4P2MA 2GCFA 4BXUA 1MWZA 3ASNH 1N6QA 3KX2A 2NUHA 2DODA 3WU0A 2L4MA 3GIIA 2K3IA 4IDKB 2A05A 4I6YA 1X8DA 3S17J 4YFUA 2MD0A 5FB2A 2W4DA 5C42B 2IRFG 2R42A 3A4TA 4CDIA 3VEPA 2BYVE 4CUGA 4QWBA 5DV5A 1ACMB 3HJFA 2C3PA 1XTAA 4DR5J 1MJ9A 4MTEA 2M3AA 5KFOA 1J2VA 1K9MT 4KGVB 1HR0F 4BBYA 4BY7J 2GC8A 1H74A 2DT9A 3DPLC 2CNKB 2AU0A 1RHKB 3OTEA 2CQXA 4EBCA 2Y0BB 5DLFA 4RB1A 2CPDA 1BIAA 3ENVA 4WPAA 1X58A 1OR7C 1G4DA 2KKHA 3M07A 1QUPA 3B78A 4YR3A 4FZVA 4X2BA 1TKZA 3DI6A 4F92B 2EK1A 1KNZA 1NB2A 4L9NA 2R9LA 4ANCA 3QLHA 4ZCIA 2MQLA 3JTGA 2BBYA 1ZH5A 3JYTA 4B9LA 3RJMB 1MJAA 4HHUA 4XLCA 2E7VA 3CB4A 4LSZB 4DSKA 4L9TA 5RUBA 3BPXA 1QA6A 3FC9A 4RWWA 4ZLNA 2IMWP 3OR2C 2EZHA 3MM7B 3CJRA 3MECA 1FSEA 1HXDA 4DBQA 3HTUA 3S2DJ 1X7VA 1GMUA 4NEYA 4DL0C 4IHWA 5IT9U 1TUVA 2R7QA 4OIQF 2DT6A 3TQEA 1VHIA 2VJIA 2VC0A 3RTVA 3HLUA 3F8MA 3AOBA 1XMOJ 1NK9A 3CC7S 1TAUA 1BQNA 4Q2LA 4E7HA 2GIZA 2DGSA 3NY0A 3F8FA 2QCOA 2UXNA 3D2WA 1FK9B 4DFPA 5LD2C 4Y0FA 1V5VA 3ELKA 2EWNA 1C1BA 5HAOA 3DLJA 1XMXA 4LIRA 2Y1JA 2I8EA 2NNNA 1U9NA 3GW2A 1OJ4A 4KAIA 2UUBJ 4AUKA 3M6UA 4DV6F 3WGIA 3W9IA 1HOMA 3LFUA 2MKHA 1KTQA 1RT3B 2D69A 3GIJA 4NE9C 4OI2A 5D4PA 2AXTC 2FBHA 3THPA 3I4HX 1YRNB 5GPCA 3CO9A 1P1TA 2OP5A 4B08A 4IG3A 1XN7A 3R4KA 4IFYB 5FLMJ 2JEFA 4CYCB 2VPRA 2F7VA 1QGPA 3K4JA 4B43A 1IXSB 2M7SA 2B6AA 4WFZA 3GR0A 2H3EB 2LQ5A 4Y7NJ 5IV3A 4NA2A 5EF6A 1VQMS 1TU0B 1VRUA 3SSRA 1RHQB 1N32F 3G3ZA 3M4OJ 2YQ3A 3RGIA 2IHR1 2H8RA 1REVA 2DVIA 3M7GA 3GTYX 4U88A 2OPQB 2B9WA 2D45A 2JC0A 1OMIA 3MR2A 4B47A 3IH3A 3W65A 2FOWA 4DCOB 1BC7C 3TEGA 1YITS 1U2WA 1Z0XA 2QL5B 4X0GA 1VMBA 4HDGA 3BR2A 3H4BA 2FHKA 2VOPA 3D9BA 1QRYA 4X4RA 1R1TA 1WI6A 1B3TA 3V8JA 4BQQA 4PR6A 3LSKA 2NZ4A 4DV2F 3DXSX 1PVEA 6FD1A 3M9OB 1FDNA 2LF7A 1S0MA 2BKPA 1S1XA 1XIQA 4NLPA 4RM3A 4KIBA 2W4PA 4G1QA 5EUHA 3A8EA 2CPZA 1YLFA 1S4EA 2GV1A 2X48A 1YW9A 2EA4A 1DTQB 3K5LA 2DPJA 2ZITA 4I68A 2UZKA 2EEYA 2VBXA 3HP6A 4C8ZA 3AG4H 1M5SA 2YU3A 4LRDA 1Q82T 1REGX 2CS3A 4NLYA 2VODA 4KGXB 2I6WA 1X9MA 4EBDA 2OIHA 3SZGA 3KLHA 2DYSH 5I42A 4NI2B 1HNIB 1QVGR 4DCJB 2UXXA 4K59A 2YSRA 2A10A 5B7WA 5CQGA 1KHWA 2VPXB 1YLXA 1L0OC 4JI2F 2VKVA 1IGNA 4RBUA 4DQSA 4CH0S 3FZBA 3S01A 4BE2A 2GIRA 4LR9A 1R6VA 2DXIA 3ZPLA 5F8LA 3B82A 4DPYA 2NREA 1VI0A 5CKTA 2KT0A 4KH0B 3RDIA 3M2RB 1KBRA 2HQ3A 3H36A 2EB7A 1JLBB 1U0HB 2BACA 1S6UA 3LPEA 2NSBA 3J7YU 2AGQA 1WKLA 2W9AA 1RABB 1NJYA 3OR1A 3KP4A 5D5VB 4H0EA 1O0PA 1WSUA 3OTCA 2JRTA 2Y1RI 3AQPA 1AA1B 1G3WA 4FYXB 2J0SD 3DXBA 3BO3A 3S1QJ 2HXIA 1ZG1A 3L7UA 1IWAA 4BBRJ 4DR1F 3MCOA 1VRTA 4HNVA 2G0IA 2KL8A 1HKAA 1KQFB 3HEFA 2Y69H 1X60A 2F9DA 2ZJPQ 2W24A 1CQNA 1B8IB 3GTGJ 4GVBB 3S16J 5BYQA 2MZRA 5KAFC 3ZRGA 2H5JB 1LE8B 2L2OA 1CGPA 1CS4A 5KT6A 2CZ9A 2PA8D 2L41A 1KQ8A 2M0CA 2KHCA 4KGKA 5LGNA 2VJJA 4CT9A 1TWAJ 2BQ3A 2AXLA 4BHPA 2OU2A 1HPZA 3PDNA 4ES3A 5E18F 3IAS9 2O3FA 4FQGA 1IM6A 4BH9A 3M8QA 2LK2A 4XKVA 3NAIA 3ET6A 2N4CA 2X3GA 5JFRA 4L5EA 4KBIA 4G1IA 4Z6YA 3OVAA 3CEDA 4CSWA 3Q83A 1EH8A 4YB5A 2HTJA 3FKBA 3MM5B 2RQMA 5ETNA 2AO9A 2XNRA 3GX4X 1YHQI 3VQTA 1GV2A 1FHTA 3I53A 4X65J 1EB0A 4J9KA 1TK0A 2GWRA 3GG1A 1C1CB 3L7WA 3LSTA 4HX8A 3QGPA 4II3A 1HI8A 2GX8A 1N33F 2JSPA 1ITPA 1OFCX 4KPYA 4ZIVA 4NZ6A 3RKWA 4WFAQ 2GVZB 5J1NA 4XPEA 5IP9J 2UV8A 2IP2A 4L18B 1MMSA 2H5EA 4J9SA 2WZ1A 3RB4A 3SI8A 2D1CA 4DS4A 2GIVA 4PQUA 1BR1A 3S32A 1WJBA 2A6HF 1LWEB 2JOQA 1WQ2A 4JP0A 5FLVA 1QBJA 5L3BA 3HFVA 2O8KA 2XWXA 4D7MA 2OLWA 1EV7A 5CYQA 2WADA 4RM2A 2VJVA 2E5LF 3HXMA 3CVKA 4IHSA 2RS8A 2DNNA 4RJVA 2QFJA 2YPRA 3QT7A 2M0GB 3JSMB 3H5SA 1XPXA 1IUFA 1H9GA 2ZH8A 4M94A 1ZYQA 2HKEA 3BWGA 2M7AA 2H1KA 3OS0A 1B99A 4UF4A 4LRCA 3B73A 3EVOA 2NS0A 4PUSA 1TLHB 3CDWA 4K7QA 2OGUA 3UDEA 1UWBB 4N5SA 5LHGA 3LA7A 4BACA 2ZH2A 2KT3A 5LM7E 5F8GA 4LR7A 3R2DJ 4X62F 3P5JA 4U95A 1FE0A 3BV8A 4A46A 4GMKA 3QSYB 2YNFA 3U1LA 5F8NA 4JI5J 1TL5A 2CKWA 3OS2A 2QLWA 1WC4A 1S77D 2HG4A 2MGQA 4NASA 1JXSA 1B1BA 5KT3A 2ASLA 2J0QD 5K7HA 2UXCJ 2XPVA 4C48A 4FETA 2MSTA 4ASNA 3J7YI 2LKPA 3HOSA 2KI2A 4OYAA 1Y5NB 4PG5A 4J37A 4M5LA 2NVQJ 4DV1J 3F6VA 3BGRB 3VAGA 3S3MA 1XNQF 3FMQA 4ILLA 3DYAA 3S15J 2OQGA 3BG7A 1MW7A 1WJ5A 3PO5A 3TJ8A 2IMOA 3W2AA 4QW9A 3ZMTA 2IJNA 1X5TA 2QMUB 2OBPA 1MWYA 5DD8A 1HWIA 2HFNA 3QFWA 2KYXA 1IBMF 4Y2KA 3OOUA 2GAHC 4Q0BA 4FVCA 4OHZA 1OYEA 3DOLA 3LF0A 2BJ1A 3CJ4A 2NOGA 4DMZA 3MKZA 4A8YA 2LH9A 5EWEA 4BDYA 4R79A 5FROA 5JVTA 2IS4A 3HPGA 2ECCA 4OIOF 2DXEA 2PT0A 5GAEU 1E3HA 2RAEA 3G82B 4KY3A 1N75A 4WE1A 4BQNA 2MZTA 1S9EB 1X4DA 3W3CA 2D3UA 2IM3A 4YQWA 2PN6A 1DU6A 1N0UA 5J4VA 3HPHA 3GV8B 4YG2F 4O5VA 2M3DA 5F8IA 4KMUX 1PAUB 4O3SA 3V8KA 3P9IA 3HI9A 1GMVA 3H9QA 4USIA 5DCMB 3BKFA 1UVLA 2G1DA 1FOWA 4CYDA 4CTAB 1T08B 3J7A1 4USHA 3MGJA 2C6YA 1KYZA 2GOXB 1WG5A 3GTLJ 3PW0A 2CDRB 4LFCF 4USWA 5EGYA 5H9FK 4XBFA 5KG2A 3ZMSA 1JKRC 1IR0A 1HNZF 3MVPA 1VK3A 2FBKA 3IBWA 2Q2EB 3K0JA 4KUMA 3TO6A 3OV8A 4DQIA 1O57A 1U1NA 5HMZA 1RPWA 1FPQA 3VSLA 1NK2P 4RUBA 3OJUA 4ZJLA 3CMES 4N41A 4RNOA 4J90A 2YWGA 3DLEB 1T02A 4OQJA 4PXEA 3I0RA 1YX3A 1GT0C 2W2QP 4F2SA 4FXVA 5DM6F 2O6GE 1KLMA 3MPUB 1OYDA 4DZJA 1I5ZA 2BZ2A 2OEKA 2ZFHA 3UCGA 3CSKA 2HHWA 4L72B 5K14B 4J01A 4ZYAA 5J2QB 2MQMA 3ONQA 3B6CA 4XLFA 4W1UA 4HX7A 3WIVA 1M0SA 1J09A 4PG8A 2NYXA 1N56A 2WB1A 3ML6A 4M71A 2X3DA 3WBZA 4C8NA 6AT1B 5LMUJ 4RW7B 2LDYA 2YKAA 3ZZYA 2OPSB 2QMWA 4XRSA 2HNZB 2UUAF 3RSNA 3MHYA 1YJWS 4PFPA 1NZ8A 4QLCU 2JVGA 3J80U 1MDMB 4NC7A 1YJNS 3LH2S 2E5LJ 3BLYA 3CF5Q 1NLKL 2RQQA 3JRFA 4CO8A 1RWOB 2LKZA 3TX8A 1VQOS 3TP3A 1JK9B 1D1BA 1RB0A 2IAJB 2PBIA 1W7WA 3J7Z5 2W9BB 1VOMA 3BPVA 2MSYA 1MMAA 1IM4A 2ZE2A 4DPWA 3K9TA 4I2QB 4YELA 2HWTA 1V3SA 1V54H 1FX7A 2IGKA 1PDNC 3CIZA 1VQ7S 2EKYA 1D9FA 5C2CA 1N88A 1AA7A 4X62J 2MJUA 3C6UA 1G6NA 3DMJB 2JFKA 3M8SA 3OS1A 4ILRA 4TV7A 2MJNA 2XB2D 2CW0F 2FJDB 4FP9A 3NWGA 3BCBA 2KRBA 2MYFA 3DRPA 2XO6A 4CH7A 3JAMY 4OYBA 3QPSA 4U7DA 2R5YA 3ZQCA 3SSSA 4ECYA 2KTQA 2DU9A 1FERA 1JTYA 4DF4A 2WSCC 2QQ9A 3BPDA 3W7BA 5EDWA 2DNYA 4P5OA 4O3OA 3EUKL 5GAEI 3JW4A 1XGMA 5CA5A 3FSIA 1EJ9A 3D1QA 5KFBA 1TUWA 3NP5A 5DRKA 1EKSA 3K8WA 1K6YA 4BYYA 4RNHA 1TFYA 3KJVB 2VPLA 4ENJA 3AA8A 4RBTA 1UZDA 4F26A 3KUHA 4JI4F 2MGZA 2V69A 3M05A 2GFFA 3QFHA 5FKLA 3DKWA 6FDRA 5DS9A 2LQ8A 4RA2A 3EDQB 1XTZA 1HW8A 4N77A 4JX6A 3Q2TC 3E51A 4U7BA 2LP0A 1SUQA 4PXBA 3SFGA 2QG9B 1KQ0A 1BJAA 3UI3A 3KTQA 2BEOA 1VIOA 4NXMJ 4DJBA 4OZ5A 2ZXJA 5ITHA 4HV5A 2GZOA 1HYSA 3P45B 1A6IA 1DPRA 1C0WA 3DLKA 3MPWA 1MBGA 3CTAA 3BO2A 1Y8QB 2HQRA 3NBPA 3IG1B 2DYAA 3LOUA 4DR7J 3CJTB 2M2EA 3BDDA 2HS3A 4M3GA 2VL1A 4ZA1A 2A1BA 5A8RA 4LD5A 4WCEQ 1LV5A 3FHNA 2V2VA 2V34A 2COBA 2XMUA 4HR2A 3NGTA 2Z30B 4NOHA 1W2BR 2VPWB 2DNKA 1XSVA 3CCJI 2XULA 1HLVA 2FEZA 2L9RA 2GAUA 4WF2A 1GEHA 2KXHA 1WD6A 1Y1WJ 1RT5B 1FFGB 4AD6A 3CDEA 2H8WA 5J2NB 3W2VB 3VCDA 3L2WA 3RBZA 4ECXA 2ZH1A 4ZYHA 1OS5A 3L1PA 1F1BB 5H9EK 4U96A 5J1PA 4JI7F 4OHVA 4CLWA 3G71S 2FLLA 3CJ5A 1FRHA 4IYQA 1PGZA 2CW8A 3DRSA 1A6QA 5J1YA 4KA4A 1HQUB 2VFVA 1H88C 2CJ9A 3FXUA 3CXCR 2UU9J 3EX7B 1XB4A 3NGKA 4HTIA 4OYIA 4ECUA 2WOMA 2CJAA 2XROA 1OYWA 5FGMA 3OUYB 1UJ8A 1WJCA 3PEJA 3UN3A 4F3OA 5IS2A 1EF4A 1WC6A 3DLGA 3GYXB 3K1PA 2OSQA 3OYCA 5EGOA 3N6LA 2XMJA 3KG4A 4ZN3A 2XLKA 1K83J 2DN0A 1D5VA 2LVWA 4RUHA 1TTHB 4RL1A 3LALA 2QIFA 3I5AA 2GIQA 2MA3A 1EIYB 4M9XA 1BUXA 5IP7J 2CQ4A 1MMGA 1U48A 5LEJA 2GZWA 2CJQA 3KHHA 4KIFA 2M70A 3FXMA 4NC6A 3P4UB 2W2PP 4EZ6A 4URSA 2UUAJ 2RDDA 3ZZOA 1K47A 1NKBA 1UFMA 4YEJA 2RF2A 2DT5A 1DFDA 1TWCJ 4F4YA 2DIUA 2J9DE 2EBGA 3PM9A 2D41A 4B9MA 5LGUA 2QKLB 2OPRB 2WV0A 3OFFA 2EH3A 4Y15A 3C18A 1FFSB 3TDZC 2Y3YA 1H8AC 3GLLA 4DN0A 3ABTA 4RS8A 1RT7A 2F5CA 2D7SA 2HQAA 4RAZA 5HQMA 3QIPB 2HIYA 4LBPA 5FD6A 5DTDA 4WFXA 2LKXA 3A03A 4QPOA 3CLQA 4GKKF 5M3MJ 4YB1P 3F56A 1Y9OA 2NPIA 3WODF 2FIUA 2WHOA 3QRPA 2DRDA 2LY1A 3P5TL 3X3UA 4Q43A 2HNDA 1NSQA 3SCIE 3A3PB 3GFHA 2WW4A 4PAAA 2DHHA 2ME0A 2ZFUA 2OHDA 2JWTA 3VHQA 4WXWA 1W5SA 4MFDA 5KG1A 2DNRA 3PUFA 1SV5B 1T05A 1JUSA 4FNIA 3B6BA 2E1PA 3IR5B 3NARA 5F41A 2DDBA 2OZUA 4G7ZF 4NYPA 1RGVA 4I2PA 1EETB 2FHMA 5HBMB 4C3JJ 3EWGA 3M8ZA 3DOKB 4ETSA 5M5XJ 3QYEA 3LA3A 3TUZC 3IHUA 4DFJA 3NEUA 2ZBQA 1LWCB 1PAEX 1SB6A 3PYDA 3CO7C 2HZTA 2ADBA 2CPHA 2WBRA 1UVNA 2QC3A 4ICLB 5AXNA 1N77A 2GA7A 2E1CA 1ZLJA 4Y4RA 2Z58B 1XJWB 4H4MB 4TKTA 3HKZD 3ITHA 1Q95G 1SJQA 3EPIA 3EJMA 1IBKF 4PJJA 1I51B 3VR1A 3MZYA 3C8YA 3GZ5A 2DGTA 5ICCA 2RH3A 2HTSA 1FCAA 3E01A 2FZGB 2HU9A 1CLFA 3CJKA 1HQ2A 4ZHRB 2P8TA 2MDAA 5FRNA 5KFQA 1QJHA 2IA6A 1YZ7A 1NK0A 4ZYGA 2V2KA 1VQ4I 3J81j 3CD0A 4N4OB 1U45A 1QSSA 2W1OA 3J7AO 1IDZA 3QGIA 3R3TA 2HNYB 4LREA 1RC9A 2V8DA 2XI2A 1H2VZ 3R1LA 3R8YA 4JI7J 1MGTA 1IN5A 3A0HC 2GVDB 2WB1N 3DEEA 2HBZB 3AJDA 5HVHA 3K69A 3DU6A 1CJVB 1HBNA 1RZMA 1YQHA 4UVAA 4NQWB 2K7LA 4K4WA 4HPQA 1BN5A 2QLXA 3JSYA 1Q5VA 3WTXC 1R43A 4WXHA 1B72B 3KLEB 2HAIA 4PCQA 3FGVA 2ACJA 1O5JA 1Y3KA 4C4WA 3E3VA 4OMYA 3DM2A 2M45A 5DDPC 1JLFA 4CYUB 3I55S 3I59B 2CUJA 3N9UC 1T03B 4FNHA 2MFZA 3FJ2A 4A12A 3H9GA 3IM8A 2G0EA 1U7LA 3C2PA 3I9ZA 2JT1A 1B0VA 1S59A 1ORKA 1R0AB 4ED8A 2DPDA 1LOUA 1VQYA 3ZZTA 2B51A 2ZXHA 2M4MA 3G8QA 3KYLA 1U6GA 2HVIA 1JLCA 4MQVA 2JJ7A 2E34A 2MY8A 3D0GE 3RCOA 4YFNF 3F0CA 3HRMA 2FC8A 3BR3A 4H4KC 4N8OA 4B09A 2FJBB 3I4PA 4ECSA 3IFEA 4M5JA 3ZNUA 3BQ2A 4URQU 4NXNJ 3KP3A 2F5FA 2WSEC 2WB4A 2XYGB 5CVRA 2R8KA 1E6YA 3D5MA 4BLGA 4A2UA 2I5JB 3D5SC 4LIVA 3HT3A 3DLBA 3K5PA 1RSCA 2ZUAA 4E8UA 2ILZA 4GCVA 4UZCA 5FJ8J 3H3VK 1FSHA 4QCLA 3HOTA 3GIMA 1X1CA 3OXFA 3FHZA 1KOOA 1VNDA 4H4OB 4PXCA 3BKUA 1NH3A 2KRHA 3UR0A 2K06A 3BR0A 1HI1A 4RW6A 4HI1A 4O3QA 3KNAA 1V9OA 2VJ5A 4DR6J 4AIJA 1AXQA 2J7KA 3FCVA 2AEJA 4ENMA 3TUJC 2PG4A 3I64A 2VFSA 3TWZA 1JQGA 2BJ3A 4X66J 1R71A 1S5ZA 4UB8C 3MEEB 3I56S 3DRYA 1PC5A 5DM7Q 3OSGA 3UR3C 1OY8A 3JSRA 5D6EA 2JZ5A 2VICA 1K6OA 3OYNA 3AHPA 4K0KJ 1E17A 5FDLA 1RHJB 3HHNB 5E3AA 5E41A 2FQ3A 4F25A 1JLEA 4I7FB 4F91B 1AYEA 1OSDA 2YX1A 4IF4A 2N8GA 1WOSA 2J5OA 2I0XA 5TISC 2PSZA 4K2JA 4WJBA 3KK1A 2JTVA 3K5OA 5SZTA 4JI8F 1YK9A 1R4MB 2PIIA 5CZXA 3M2UA 1JGSA 4HW0A 2F40A 4AFFA 1UP1A 1UHWA 5KFPA 5GMDA 1A0OB 4OHYA 1ONVA 3EYYA 4DQ2A 3JTOA 5CYVA 1QSLA 1UZCA 1ZKGA 1UHMA 3A3NB 3RYLA 3ZXSA 3KJNB 4UQTA 2ZVIA 1S1TA 4EV0A 4TNOA 4PUOA 2L48A 4ETZA 3Q0VA 2OTLS 1K7AA 1TKZB 1ZAWA 3DI6B 4HLXA 1EP4A 4AWXB 1IBKJ 2RAQA 2QSGX 3QLHB 2KT5A 4EJTA 2ZH9A 3FFIA 4BXFA 3W5ZA 3IWLA 3JYTB 1ETYA 3CCES 1HW1A 3M30A 2M88A 3RB0A 4DZPA 4A3BJ 3RRHA 1ZTWA 3T3FA 2JDJA 1MH4A 4RU2A 3H90A 2FGCA 4L74A 3ZC4A 2L01A 1MSFC 4YB6A 3BP8A 3MECB 1B0TA 4P9SA 4UY8T 3Q8VA 3L2UA 2NRAC 3MFHA 4FDFA 4DV3F 3LSHA 1QVFR 4OAYA 1DQ8A 1FRLA 1FKAF 3CDLA 2VXDA 4FBTA 2ZHAA 1Q81T 1D8JA 3CPWR 2QYOA 2BXJA 5KFSA 3PX4A 1U4BA 4FTHA 2DA7A 2R3VA 3IGNA 1IKWA 4OMZA 1U2RA 3GVAA 4GYIA 4W4MA 3W6JB 3GZ7A 4L5IA 4ZDOA 1F9NA 3JTHA 2HBRB 1RKWA 3GSDA 4EM1A 3DFEA 1UMJA 1NK8A 2X7IA 1NPKA 1X4PA 3BG9A 5KFLA 1O7FA 3EGWB 3LQVA 1JHFA 4LVOP 1HARA 1LXNA 2IA1A 2VKDA 3LP0A 2EFWA 2YKMA 4LF7J 3K8VA 1IRGA 2EILH 2W01A 3MEDA 4V19X 1PYVA 3C2GA 2V68A 3MUMP 2FY1A 4L3NA 1F6TA 1PUFA 3QSIA 1S72I 1KC8T 3H2VE 4ZPTR 3P6YC 3TAMB 1NDCA 4ILMA 4XRSG 3OIOA 1RLCL 4HKQA 2RB7A 2B6AB 2FJVA 2E2HJ 2ZOMA 1X5SA 1YBAA 4TYAA 2D1HA 3BQ1A 1Y8RB 5KOWA 1VRUB 2FJWA 3LP2A 4ED4A 4CT8A 4C2TA 3MAJA 1G7CB 2MEWA 3SDBA 2HYGD 5GMEA 4UVBA 2YPZA 4A47A 2NSCA 2PMZA 3AKZA 4FT8A 3DRRA 1D1AA 5E8GA 2MKKA 4HBLA 2M52A 1SD5A 5IV4A 3UN2A 2IDLA 5F9LA 2YKPA 1WHXA 1DQAA 2LMIA 3ZZZA 3DFGA 3BSAA 3WQPA 2CRLA 3NNHA 1F2GA 2J9EA 4EUVA 2LF8A 4OJGA 2JN6A 3GTPJ 2AF6A 2XPUA 4EWTA 2X1BA 3ENQA 3U1DA 3A0BC 1GXPA 1S6QA 5GMKa 4Y17A 4XONA 1S6PA 2KN4A 2DMNA 2NS8A 4FE4A 1AOYA 5HMXA 2FPHX 4ZVUB 1KKHA 4IOBA 2V2QA 2OKQA 2HRUA 3TUIC 2B7CB 4X4PA 3DEUA 2HURA 4G1QB 2MKJA 2A2CA 4ECRA 1TQLA 3D67A 1SANA 3BG3A 3VTIA 2CWKA 5ED4A 1S29A 2V63A 5EDNA 4J9NA 1KVIA 4IFVA 4USTA 1UA0A 2STTA 4F55A 1ULYA 3ETOA 3RBEA 3PO4A 2B5JA 2Q66A 1NPRA 1JTXA 3Q8QB 5F0FA 1GHCA 3TR5A 3TZXA 2O3DA 3QWLA 1RTDA 2PD1A 4JI8J 3KLHB 4CO3A 5I42B 1SMTA 3L3CA 4CZZA 4KPCA 2OAUA 2DIVA 3HSZA 2N3OA 3DC2A 1HNWF 1TUGB 4TXSA 1YZ6A 2HPUA 2R92J 2AJ1A 4YB7A 1J9IA 1X2MA 2VG7A 5B0BA 1VQLS 5ETMA 1T11A 4WZQA 3TW6A 3ILJA 2Y1LB 1EKEA 3M9MB 3HMJG 5JMNA 2V6EA 2LREA 2NYHA 3BCAA 2PX9A 3B8HA 1X4EA 4DUZF 5HS7A 2PFFB 1T94A 3OR1B 2Z4PA 5B1BH 5BR8F 2FX0A 2DNZA 1RCOB 3ESWB 1RDRA 3D54A 3MTKA 1O4XA 5KAKA 3M2VA 3A13A 4OYWA 4C0HA 3ZR8X 3OYHA 3K89A 2F3JA 1H0HB 3NXZA 3MN2A 1NSKL 3R61A 3BSOA 2GQQA 4CXFA 2IA0A 1SL1A 1VRTB 2M5WA 4ED1A 3CC7I 2ASDA 3RAMA 4NLRA 3PKMA 2XUBA 2UVUA 4L3KA 3OL8A 3S7RA 4KJZA 2AYEA 1WKJA 2V9KA 2HAFA 5B66C 2X6OA 4MK9A 3NOGA 2EJRA 4LF9J 3W66A 1CS4B 4WXOA 3BBFA 5LEKA 1RUNA 5IT9Y 1YG2A 4X4VA 1KFDA 4DF8A 1RAFB 1TQMA 4RW8A 1HPZB 4NMLA 3OTBA 2DMPA 3E6MA 1JXEA 3M8QB 3TAPA 2DITA 2CFOA 3ET6B 3CCSS 2VBYA 1QTMA 5HATA 4PG7A 1N5VA 1FJLA 1RA7A 5AE3A 3OSFA 2W57A 1NDPA 2LA4A 4F04B 3K2ZA 2V0NA 4KYWA 2ZZNA 1L3LA 5I3UA 4LF8F 4B9SA 4CLSA 2H51B 2UXBJ 1B59A 2W2MP 4UHTA 4DR2F 4CZCA 2Z9OA 4OFZA 1R31A 3F41A 1JNRB 3SEZA 2WTFA 2R7RA 1S76D 1VQMI 2KRFA 2E19A 2KLOA 2IVMA 3VGVA 4PQUB 4LOCA 5F6FA 1SBRA 5H2FC 4IVNA 1K1QA 4WTYA 2XQCA 1ZOTA 4KHMA 5TGTA 5CYQB 1FT8A 2LY9A 3AG3H 4HYEA 3PVXA 3W2WA 5EYRA 2RQCA 4KO0A 4JX4A 2ME6A 2ESNA 3M1CA 3HOWJ 3PX0A 3IBCB 1PCAA 2VJ4A 1LDDA 1IO2A 4A3LJ 3IKVA 5F08A 4NLQA 3MMYB 4J9RA 1H7WA 1G59A 1U25A 2P9EA 4DPTA 3CDIA 4U0VA 2ZZMA 4NC8A 3OT9A 2AV5A 1S1WB 1F5CA 3RKQA 2E9ZA 2YNFB 1T3NA 1UJ4A 1Y5IB 4OX9F 1T0TV 5CD4A 3QWUA 2HFZA 1HWLA 3HFZB 2HGLA 2ROEA 1FJ7A 5AT1B 2QJ3A 1BR2A 3A8IA 1VC6A 3CDHA 4ED7A 2V9WA 1LFWA 2HZCA 2QRRA 1ENHA 3H92A 3LSGA 1W2IA 4LIUA 4WP9A 1X1PA 1IR2A 3GU0A 4B3TF 3WZ0A 3CD7A 5J40A 1N36F 1IN8A 2HLUA 3FBEA 4AT1B 4JBCA 1RTHA 5D5UB 1ZRFA 3MI7X 1K78B 5ETLA 1SJRA 4QYZK 1VJWA 1XNRF 4XSXF 3B54A 3ENAA 5L1LA 4PFOA 5F9NA 2MG4A 2BOAA 1C2PA 4GO1A 2ZC4A 2VA3A 1U1RA 2GQCA 4MFBA 3I58A 1ZTRA 1HNWJ 1ZRCA 1FTRA 3SSQA 3K58A 3SYZA 4F7VA 3KLGB 2NUUG 1FF2A 4AL6A 4Q0BB 4WZMA 2V79A 3GCMA 3NCPA 4I1TA 3DOLB 2XLJA 1R8HA 4XN3A 3QRRA 4ZDLA 1O3RA 4BS9A 3X1LB 4JB8B 2P5VA 2QQ8A 5KVRA 2E5NA 3W9HA 3PUBA 4DL6A 1OLTA 4NYOA 2ZOGA 3DBHB 5E17F 2F8HA 4DNCA 1L3KA 2DGXA 1XMQF 2FJ1A 2EFNA 5BR8J 4WE1B 3OLBA 2A18A 3DGVA 1HDPA 3KE2A 2BABA 5F3TA 5KAIC 1PYSB 2CNNB 3RI4A 1QAJA 4N0BA 2BX6A 3LGMA 2JVHA 3E6CC 3K4KA 4A8MP 3EQLF 1SIZA 3NG8A 3ZQLA 4NLVA 1C4CA 4I67A 2OELA 3PRVA 4FXDA 3K1MA 1RRJA 3MMBB 2I5UA 2C2NA 4A8XA 2MKYA 2HQ5A 5J2MA 4ON0A 5T41A 3MTJA 1TK8A 4AYBD 5CJ9A 1QTNB 2CIMA 3LMMA 1CJKA 2V50A 1QZEA 3IO1A 2X6YA 2HOSA 1MNMC 3I0RB 3F9KA 4P7VA 1NDKA 3Q8YA 2FY8A 4F7ZA 4ZC3A 2HEKA 5DDRC 3LFKA 5EWGA 3FNNA 3T1YF 3POTB 3OTOJ 3BREA 3BR6A 5E3QA 3PIOQ 2V8HA 1TL8A 2HVQA 2XMKA 4CLZA 4X64F 1RCXB 1ZG5A 1KVKA 2VQLA 3IWFA 3LUYA 4K4SA 2MLKA 4O44B 2FDNA 1PG5B 2PE8A 1QAIA 1RETA 4B1RA 2LTPA 4A8FA 4FS2A 5DG8A 4LF8J 1J5EJ 2PI5A 3ERMA 3FQLA 2QGUA 3KZZA 4L9JA 3FIWA 3M32B 1P2FA 3HM5A 2D74B 4PYDA 4RBVA 4UVCA 3D0HE 2V4JA 1R00A 1ZAXA 2R7DA 4HV6A 5DQHA 5M3FJ 1YJ9I 1BW6A 2BXZA 2O66A 4EYHB 2E35A 1P27B 4EK2A 3H5NA 4DV5J 4RW4A 2OD4A 2AJ4A 4YR0A 5L39A 5KFTA 3C15A 3TX0A 2H1YA 2ZE2B 2RS2A 2Z57B 1BL0A 1QE1B 5C24A 2DA4A 5EZGA 2CQGA 2J9DA 2W82A 4UZBA 1QQIA 4IJAA 3EYZA 2MZ1A 2JA5J 1W7PA 3KK3A 2DGQA 4I64A 3GUDA 5IY5H 4X4UA 1FIPA 1RWVB 4O0NA 2ATCB 2H48B 2R8HA 2MQPA 2FVPA 1S49A 4AIKA 3DRPB 4DL7A 3CTRA 1CJUA 2R5YB 1FA0A 3NS5A 4LF4F 3KHRA 4KGMA 5LSOA 1RXOB 3IXQA 1YIJS 4ZP9A 1FBSA 2W84A 4JX5A 5F1RA 2HS0A 1JHHA 3MDFA 3L2QA 1J5YA 1VQNI 1BOAA 3HJEA 3AODA 3TI0A 1RAIB 4I76A 4V19K 2RC4A 3T9ZA 1ICEB 4J9LA 4QWEA 3CCMI 4F4WA 1UA1A 3CQZJ 5LXRA 3R5CA 1N36J 2B9SA 3OW2R 3AG1H 4F67A 2RNJA 4OMFG 4DXLA 1S99A 1RUOA 2OSRA 4CO2A 2GO8A 2MGZB 3FXOA 2E1NA 3VVTA 3DTKA 2LD5A 1FWPA 4M95A 3SFIA 3OYDA 3H1CA 3J7ZI 2CQ1A 3ECHA 1FYLA 4V1Ak 5F0CA 4JK1X 1SUQB 1A9NB 1Y4ZB 1VIXA 1NAQA 4DW6A 2XHCA 1HYSB 4XM3A 3B4MA 3VAMA 2MQQA 3DLKB 3T1HF 5LFAA 2E9RX 2DY1A 1BY9A 4RO0A 3LP1A 3HPOA 1AWCA 4LF6F 5A8RB 2BANA 1U5TA 4MKAA 1RYSA 1FJGF 1Z67A 2V6AA 2V1UA 2FC9A 2W4CA 2UUCF 1NKCA 4R0EA 4M9SA 3OV7A 1KQ9A 1T2KA 1RBAA 1HW9A 5EX0A 4IRHA 1JNZB 2CJBA 1VQ8S 1S5LC 3HVWA 3QT6A 4C6AA 3KLNA 2JSXA 4CCMA 4AIHA 4MT1A 3MPVA 3O6BB 4QIFA 2YWKA 2QLZA 3ZQQA 2E1MB 4I6ZA 1R27B 4ZS6A 3BGUA 3NEKA 1NG7A 1JUMA 4DL3A 1SI9A 5ERIA 1FRJA 2IVYA 3HL2A 1V6HA 3ILOA 2UV1A 3N4MA 5CCLA 2GMLA 5E0OA 5KFHA 3DRSB 1Q0NA 4KC5A 4B9NA 1QHGA 2FJXA 2RDPA 1L3TA 4ZVSB 5D5XB 3TQNA 4EBEA 1SC7A 1D8YA 2C22A 3H59A 2VG6A 3RG6A 2BW2A 2OCEA 2WOMB 3QWPA 4YDXA 5ETOA 1KFSA 4ID5A 5BJRA 4N4NB 1N4LA 3MEKA 2ACYA 3BG6A 3IBFB 3R60A 3Q2SC 2HHQA 4AQYJ 2QUFA 3PIPF 3T1YJ 3V4GA 5KTQA 5EGOB 3HKZN 4CCOA 1CF7A 3QBCA 3QU6A 3GG0A 2P81A 4X64J 2Y9ZA 1TR0A 2HDWA 3WTZA 3HSGA 2OO4A 1BI0A 4Y3OA 2OMOA 3R7NB 1NCLA 1RAJA 4RKUC 1PJRA 2ZJQF 1P7JA 1FMVA 5HS9A 4XLAA 5BQTA 2CPEA 1LFUP 3SYTA 1BM9A 2MMYA 2WK4A 1YJWI 2VD3A 4RGXA 5HLHA 4KNYA 2ZWPA 3UD4P 1FDDA 2Y31A 2L3DA 1YJNI 4E6KG 2K9LA 4JI3J 3O6QA 2ALZA 3CUQC 1JIHA 3J81K 4RDUA 4XOPA 3GFLA 1VQOI 2RF2B 3CF5F 2J5PA 3IM9A 2DNGA 3LAMA 3CMAS 2XIGA 3IKTA 3VYSB 2QA1A 5DD4A 5JVHQ 4KFCA 2WY8Q 1VQ7I 1OJLA 1OY6A 2B8PA 3IP4B 2ZHOA 1RT7B 1MJBA 2FXAA 3VB2A 4UQGA 3J80Y 3PYGA 1NZAA 3GWCA 1WFXA 4USJC 3KG1A 8AT1B 3FWEA 4CCKA 1AFJA 3DHXA 4R1HA 3QJLA 1IG7A 1HL6A 4PPZA 3I54A 5KFRA 3VAFA 4EZ9A 4BXXJ 3LWFA 2YNIB 5D15A 4HI2A 4RB3C 2WONA 1DTTA 1JT0A 2CZ4A 3DN9A 5J1UA 2FHJA 2HNDB 4HZFA 3W64A 2ZSHB 4WK8F 5FD5A 5CZVA 2XY6A 5IT4A 4YY3F 2VL8A 2E7WA 4DOZA 3G6XA 3SQGA 1O3TA 2H4YB 5BYRA 3DBRB 3FBBA 3TVKA 1XBWA 4WK1A 4NHJA 5SUHA 3DDKA 4HL9A 3CP2A 4NLOA 5L9XA 4I2PB 1TT5B 4IG0A 4ELVA 3QJPA 3VYTB 1H7XA 5JJBA 3C3WA 2F4VJ 4XIUA 2HPIA 2X6WA 2VFRA 2JPBA 2EPFA 1IJEB 3PR5B 1VISA 2E1MC 4UUSA 2M4GA 3BOQA 3R7BB 1FE4A 8RUCA 1X3WB 1XR5A 1L3SA 1ZA1B 3ITHB 4Y33A 1KU7A 3FXQA 4C8OA 1FKPA 3FDYA 1IWGA 4J5OA 2FQQB 2P7CB 3MM6A 5D4SA 3PO2J 2W85A 4LF6J 1SQGA 2ZBRA 2JLGA 4A3DJ 4DV4F 2CQHA 3K4LA 4IRGA 3N97A 1NHAA 4R8UA 1TL4A 4CM2A 4WP8A 2MKSA 2UUCJ 2CQCA 4RB2C 4FX4A 3UKGA 3N28A 3CC4S 1S8NA 3BQYA 4YFXF 5KT5A 4EMDA 1JE8A 3R6GB 2A6OA 1DGRM 4DS5A 4QWCA 2VQHA 4ES1A 3DLLF 5LSRA 3QOEA 3R9LA 2LOOA 2KIFA 3H2LA 3ISPA 3P9KA 2HVEA 3JSBA 2LEAA 3G71I 2G2ZA 1IVZA 1HBOA 4EM0B 4L75A 3TA2A 1ULRA 3RBDA 1R58A 3G6ES 4FS1A 2WV1A 4R5PA 1FC3A 1JJ8C 2KZVA 1HBNB 5MLCV 2O0YA 4ALZA 3EUAA 2JC1A 1XERA 4P75A 2F5DA 2X9DA 4AIDA 4KV8A 5AJ3J 4DR4F 1WRJA 4BJ5C 4KKOB 4BC9A 4S05A 3IAM2 1X4HA 4DPUA 1WTBA 4E7SA 4M3EA 3DM2B 3MUVP 4QTRA 1N8RT 3TZZA 5F8JA 1ETWA 1QUVA 3IR6B 2DGWA 2YH0A 2EIJH 1JKQC 3KXDA 3CDBA 3OYMA 2R2RA 4M3BA 2RVCA 2GHVC 1OCPA 4RZRA 4UXNA 2RJZA 5JXSA 4OU0A 3WE2A 3WTSC 3FBNB 4EFAC 1W5CC 1D8KA 1IV8A 2KH9A 3H4DA 1X5OA 1MBFA 3AXMA 4I69A 5LGTA 1VJQA 2E60A 3AH6A 2VPYB 2DI3A 3GFYA 2V2ZA 2J6UA 1FWKA 4L0ZB 2KG0A 2HFSA 2LQJA 2AQ4A 4P2SA 3MXHP 1SQFA 4CCNA 3HUGB 4NNJA 1R8CA 3CJ2A 1GH8A 4G6QA 3CDUA 5E79C 3OR2A 2E5ZA 3HHHA 3FEXB 2AYMA 3QRQA 5IT9Z 2MY7A 1XG1A 2CQNA 3TYTA 4W97A 4LSNA 3DKXA 2D1VA 5A8KA 2N7CA 4KN7X 3D1OA 4M63A 5IXUA 1QM9A 2UXDJ 2ZMEA 4DV7J 4DV0J 2AGPA 3MEGA 2VIXA 4UOCA 4B3OA 2V6CA 1VLOA 2XM3A 4RW6B 1REPC 5AE1A 5KFIA 2VQFJ 2Z16A 5E2QA 2NLWA 2ZM6F 2DFIA 5B3SH 1ZYRF 2ZZTA 2K85A 1UW4A 1PO6A 4IXAA 2GIFA 5KFDA 1S0NA 3AG2H 4I09A 4J9MA 2RUSA 3VF0B 3IAS2 2BOPA 1OWXA 1ZR2A 4UV9A 1WG1A 2E7XA 3KEYA 1M5OC 2R7OA 4KRWA 3BTIA 1WHUA 4G6DA 4DPXA 2Q8KA 4YY3J 5B0FA 1NJXA 2FB0A 2ZH7A 2XF6A 1JLEB 3L4BC 4Q47A 1GUUA 1U8WA 3S3NA 5AXMA 2Z3YA 2UZAA 3F8BA 3KZIC 4NA1A 3ULQB 2VPZB 1Y3JA 3KK1B 4TY8A 2CUEA 3F3XA 1SKUB 3GP9A 3M2UB 3K4BA 4UY85 1RWMB 3GLXA 5D0RA 3H5XA 1RHUB 1T38A 5ICEA 1N5YA 1Z6RA 2DKOB 3KJQB 3D68A 2DHGA 5JLXA 1TV6A 3C16A 4UOGA 1IJWC 3LSPA 1S1TB 2C2DA 1S7OA 2B56A 3QPIA 5FKMA 3CIMA 4PUOB 1WJAA 4A3EJ 4UOHA 3MCMA 3NMRA 1EP4B 3N05A 4TYBA 4JV5F 4LF5F 2HVSA 1WKKA 2DCUB 3FFIB 3BYRA 1RBOB 4LFAJ 3SMZA 1W36D 2BR0A 5FO5A 4WYLA 2P6TA 2VIHA 1WC1A 2WAFA 2RQKA 3K6GA 4ZDPA 4ED6A 5HL7Q 1FYMA 5E3RA 4ZP6A 3MFKA 3DBLB 4QPTA 4LSLA 5G0RA 2QSFX 3EVMA 3UD3P 3KYDB 3WU1B 5GAEJ 1FDBA 3G96A 1LQ9A 3RB3A 4KHPJ 5KG0A 2VBWA 2KJWA 2QA4G 1FFWB 1P9QC 1ERDA 3HVAA 3LNQA 5K20B 4B02A 5CYJA 2E29A 4ZVQB 5FKOA 2DR7A 3R0AA 1DAXA 1Z7LA 1B9NA 4U8VA 4EO8A 2HOAA 2D3ZA 3EICA 3EE3A 2DO7A 1ETKA 1XC5A 5D8KB 1MROB 1UTAA 3U27A 1IKWB 4TU8A 2BRLA 4ITSA 1U47A 4U67Q 4OZNA 3I55I 1R36A 4Z2XA 1S12A 2ECBA 4GYGA 2J7UA 2N4DA 2VG5A 2QTWA 2AWZA 4QPXA 1Z4UA 2N7YA 1BBYA 3SDEA 1F3VA 3G4SS 5KFEA 1DQ9A 2BEFA 1YJUA 5D77A 4M9ZA 3BS9A 1VFJA 3ISZA 1CULA 4WK3A 3M9NB 4OZJA 2CQKA 1S1VA 3LP0B 2YKMB 2YPYA 4XO0A 3AD9C 3M1EA 3S2WA 1HWJA 5A0YA 3MEDB 1ITYA 2XF7A 2V5HG 3O3KA 2RT3A 4OYZA 4DUYF 2RN7A 4BDZA 3FMSA 5KFNA 1VYAA 2MZSA 3JQKA 2W8LA 4JUZA 8ATCB 1TK5A 3RQ4A 1D0YA 3I3LA 4JV1A 3KLFB 4C0OC 2AEMA 5L3CA 4U6PA 4ABZA 1XX5A 3KDOA 2QSHX 3RRKA 1NK4A 1IN7A 2BE2B 4ZPDA 5KFMA 5L1KA 2JLEA 3C46A 4OI1A 3LP2B 3ELHA 2A07F 3DWLE 1OPIA 3BF4A 2XZTB 2K1RA 3HJVA 4KH1B 2AT1B 4CICA 1YI2S 2NR0A 3N79A 3M6VA 2HK2A 2K4BA 1WWHA 3I31A 3OJSA 3OYGA 2X0LA 3UDCA 1GTEA 3DRRB 4KGZB 4M1KA 1F60B 2VQCA 4IR1A 3PNYA 4Q5VA 2M7BA 2ADCA 3UCZP 4Y2IA 2PO4A 2GBYA 1F9FA 1P4XA 4BJTA 1V5EA 1JLAA 2CXEA 1CPZA 2XGCA 4RLFA 1CC7A 4XNFA 3FQKA 1S6QB 1F1ZA 4RNNA 3BTCA 1IBLF 1UFLA 4LFBF 5DM7F 3JRBA 3WDOA 1VQ5S 3BSNA 4F3MA 4BU2A 1XCBA 2XB0X 3R6LB 2QFIA 4FHTA 4IO9F 2O1PA 1X1DA 4X4OA 3DOMA 1CJTA 2XAJA 1L3VA 4I0BA 1NK3P 1BLUA 2O7OA 3QGHA 2VB6A 1IRFA 1SVOA 1WUUA 3VSKA 1VR6A 4I6WA 2HQFA 1FY7A 1ZGWA 1U6ZA 3FMBA 2BZTA 1RT2A 4DL2A 1PKUA 2B5JB 4Y34A 3G8SA 1RTDB 5EZHA 3DP7A 1X19A 2RU9A 1PP7U 3HTSB 4M5HA 4LB5A 1ZPVA 4IQMA 1OPCA 3C6TA 4G7HF 3QIDA 2R8JA 2LLKA 2XSJC 3FDSA 3CJ0A 2ZUGA 1NTCA 4NLGA 4ZPCA 2DFHA 2VG7B 4UT4A 1JLQA 3DRXA 4K5RA 2YTCA 4DUTA 2U2FA 2DK5A 3CCEI 1WEYA 1SJ3P 3TRGA 2M9KA 4ETXA 4QYZJ 4O4GA 1ZN2A 3ZOBA 1IF1A 2IS2A 4LUBA 1MMDA 3TOBA 1M1HA 2D3O1 1W5TA 3MKYB 2CJKA 2DD8S 1OCZH 2Y9HA 4PWWA 1Y5LB 2XLIA 5KNLA 5DGBA 1IRXA 2ZO4A 1HKTA 2C2EA 2IYGA 3V8LA 2CRGA 2Z99A 2JRSA 3WX4A 4NI2A 4Z7CA 5GADU 1T9WA 2FYXA 2Y1IA 5K9FA 5LMNF 1RI7A 5M5WJ 4HEA2 1P7IA 1WJEA 2O03A 1W4MA 2EC2A 2QVOA 1UG0A 2OPPA 1G2HA 4O3RA 4A8QA 4OI0A 1B4SA 4M5IA 2XNQA 3M2RA 2P7VB 2ID6A 3VDXA 4LLNA 3PKYA 2OQRA 1C0UA 4O3PA 3RKXA 1FNNA 4MIMA 3D5RC 1JLBA 3BR5A 5BXIA 2R7VA 1SH3A 4IO1A 4C8MA 3LSJA 3QODA 1DUXC 4TQSA 2DO0A 3NCQA 1AUSL 2PEBA 2F48A 3CD5A 1I27A 1IAWA 2WAQD 1YS7A 2N3LA 4RW8B 3KPHA 3GMEA 2M5YA 1YYVA 2JX2A 5KFCA 2ZWOA 5JLWA 3OQ2A 4CO1A 4D5FA 4J00A 5B0AA 2CQPA 1W0UA 1UZHA 1Y0UA 3WTYC 4KE5A 1FP1D 4WF9Q 1EZZB 1N78A 2IRUA 3SQOP 3ZO7A 4ITVA 2P9CA 4ENKA 3G9CA 1GX6A 2QX0A 4MKYA 5KK1A 3T8RA 3Q9SA 1QO0D 2Z2ZA 3IR7B 5I3UB 2IRYA 4EI2A 2M8DB 4JI0J 3HM9A 2DNLA 1VQ9S 2F65A 1B8IA 1Q8LA 5I3QA 5AE2A 3KUGA 4IUFA 2WA0A 3GIRA 2V4RA 1S9GA 3BO4A 5F0WA 2EZIA 2GNKA 4K4ZA 5E20A 1R8BA 3Q5FA 2BXYA 1RADB 3OSNA 4OZ2A 2YX4A 3LPYA 4DG1A 2QA2A 3GJSB 4FN5A 4DFMA 4WIIA 5DYMA 3JRHA 3T6BA 9RUBA 2VHGA 4LF2A 5DM6Q 3W2WB 4LJZF 1P4WA 3S1MJ 4JI1F 1LNWA 1JJ2R 1MKMA 1GMWD 5IYDJ 4P72A 1ZK8A 1H0MA 1OO0B 2J8SA 1C1CA 4UUXA 1GVJA 1SJ4P 4IKFA 5EG0A 4AYBN 4M5DA 3K4NA 4WCGA 1AKHA 2ATLA 3OYEA 4RAFA 2GVZA 2CSOA 1D1UA 3DTEA 3MMAB 2R8GA 2Q3PA 1M5KC 4ZCLA 2C3UA 5LRSA 1IKYA 4HYKA 3D7SB 1K4SA 2JJ4D 3QZ7A 2O5DA 1U2CA 2EPIA 2BQRA 4ZVOB 1O6XA 3JREA 3Q3SA 2WAEA 3QYYA 1LWEA 4XIDA 1UJ6A 2Y0MA 4ANEA 1I39A 2KKOA 4R0JA 1HW2A 2DK2A 3BY6A 5F8HA 4HT7A 5D8HB 1Q86T 2R7SA 2AW0A 1WKMA 4AC0A 3NS7B 1LDJA 3H5UA 3KLVA 3M1VA 2LXIA 2DJWA 1HR0J 3OYLA 2H5IB 3E5QA 1DQUA 5L3EA 2R3SA 3F72A 1RKTA 2IGOA 2K3FA 2WCXA 4F0HA 4DGWB 2HGCA 2E1OA 1Y10A 4F0MA 2ZH6A 2EK6A 4A69C 3ABKH 3IRXB 4Q2MA 1UWBA 3R27A 2ID3A 5GADI 4Z37A 3QZ8A 2FVRA 3WU2C 2A3JA 3QT5A 1HD0A 3ABUA 1VQLI 1D1CA 4MFBB 4ZJOA 4DSEA 1X0FA 4WWSA 1XC9A 4WU2A 3ZZRA 2YR2A 1Z91A 2FMYA 1EQ0A 3H25A 2L4AA 3J80Z 2J6SA 4RLQA 3M8WA 2WBMA 4C8YA 1N34F 4EMSA 1JJ6C 2XZDB 3GILA 3GB0A 3RBXA 2HHTA 1Y0NA 2MQOA 3FEZA 3J7AY 3OHAA 3FKIJ 3W9JA 4CIOA 2VA2A 3K0LA 1HMVA 3GF2A 3CWJA 2DTZA 2IAIA 2VQGA 4WXCA 3SCJE 3V4IA 2Q79A 1RT6A 1UEVA 1FRMA 2Y0SA 3OXLA 4XKCA 3O2PE 5CH7B 4A5MA 4D7NA 2HWIA 2EW9A 2ERRA 2XVCA 3RPUA 2ZBKA 1SFXA 4MNUA 5BNGA 3FM3A 2QYCA 1K0VA 1YJ7A 4WFYA 3D28A 3MEXA 2XSDC 3ROUA 4OOIA 1NPPA 2L9VA 4N47A 4B3RF 1ZS6A 7FD1A 4DL4A 2BV6A 3TZYA 2KDZA 1STZA 3GTOJ 3TO8A 3H35A 2DMTA 3ZQ7A 3LSIA 1BC8C 6PAXA 2F4MB 2VUMJ 4KT0C 2CUZA 1RT4A 2FF4A 1IN6A 1B7YB 2KT2A 1S0OA 1WI9A 2RUGA 3T5HA 1SFOJ 2BOLA 1T9YA 5J2MB 1JT6A 2XPWA 4FISA 2MD5A 1GNKA 5DS7A 5H6RA 2F63A 1Y00A 1VZ0A 3G82A 4B3SF 3CCSI 4DV6J 4C11A 4DR3F 3C66A 5A2QZ 3RAQA 4C2UA 2E5IA 3Q24A 3GYHX 1IJFB 3TMOA 2RDJA 2OC6A 2JVRA 2NQPA 1ZREA 3CCJS 2CQIA 2ETHA 1YWXA 3GSIA 4DDFA 5DCMA 3HZEA 2DR5A 2ELHA 2RHSB 1X31C 3KLIA 4ZP7A 2KXFA 2BY3A 4D3HA 1X1BA 1Y6IA 2EA2A 3PNIA 3LGHA 1R0CB 3HZJA 2IS6A 3N6MA 2YWEA 2EZKA 2Q2EA 4ZPWR 4GVLA 1RTJA 2GHPA 1OCTC 1HKSA 4ZN1A 4Y2AA 2GM4A 1N32J 3PNTA 2V4JB 3JTPA 4ZCKA 1XGNA 2XMMA 3B4DA 3KZYA 2NYIA 1TZ0A 5B0DA 2GW8A 2YU9J 3SQNA 4A93J 3O8HA 2G2OA 3I96A 2BW3A 1A31A 4DZ6A 1NH7A 2FLOA 1Q1KA 4U8YA 4OIXA 4CO4A 2V1XA 3RKYA 2LKSA 2QLFB 3OYBA 3R5DA 2GLOA 1R4NB 4RW4B 1IW7F 5IOYA 4ZZLA 2PLYA 1SQEA 2DGVA 2ZEJA 5EX3A 2MXYA 2CWEA 2BVZA 4NLWA 2WW8A 5C24B 4WFNQ 1ACIA 5M2RA 4DV2J 4FF3A 3KK3B 2MKCA 2DPUA 3CZ6A 5B0CA 4EJOA 1Y39A 4YHHF 3CCYA 4B4CA 3GZ6A 1ZGJA 1S4FA 1TKTB 2NZCA 3CESA 1WHYA 3OLAA 2RNGA 4Q8FA 5L38A 3AFGA 1V5GA 1CJUB 4XL9A 1WSRA 1KRPA 2H6BA 1T0FC 1SJ1A 1RAEB 1POGA 2ALYB 4RAYA 4BHQA 1BQMB 4K4VA 3DDNA 3U02A 1H2UX 2IAJA 2R2SA 2CV0A 3U1KA 4AUXA 3AT1B 4HLYA 2BRKA 5IYBJ 1KQKA 4OI3A 1Z9CA 4JI2J 3OYFA 3NL0A 4E70A 2IA2A 3MCZA 1ZGAA 3F21A 3PCOB 2X51A 4PSWA 1LJ9A 3KEOA 3OYIA 1HCRA 5LRRA 1FNMA 4XDDA 3CCRS 3DMJA 2YKQA 4N9IA 3PYFA 1FI4A 1ZM4A 1X3UA 4DZDA 2XEXA 1Q8BA 1XMBA 4E7KA 2G0JA 4OYOA 2ISZA 3CF2A 3SZ2A 3LP1B 3CE8A 2XC9A 3L9ZA 3UNGC 1S57A 3RIRA 4K5SA 5BS6A 2BANB 4BL0B 4RUAA 4U7UD 5K8OA 3RYRA 1WC3A 5LL6d 2DGUA 4ED5A 1WOPA 2QEXI 1T33A 1U24A 4NB5A 2RKHA 3JRIA 3ZXWA 4DR1J 3UPFA 3PSFA 3KJVA 3BGOP 3G86A 1GXUA 3GV5B 1U6BA 4BQAA 2R7ZJ 3VAHA 1I94F 2KB2A 2Z5UA 1UEKA 2XG8A 2FRHA 1RWNB 2FU4A 1IQZA 3UE2A 2HMIB 2CAJA 3QO9A 5IT0A 2I1RA 3DCAA 1T7PA 4IHXA 2FUG9 5JVGF 1D3WA 1C4AA 1UETA 2GO9A 4IKAA 1XEZA 4GFBA 1Z3XA 4Q7AA 2J0WA 4O3MA 5DGAA 3MURP 4LG0B 3OOPA 1RA6A 4AXJA 3CJTA 1GX5A 4QZVB 1K0TA 3VGSA 4AU7A 2V4JC 2KRRA 4A0ZA 3NWRA 4YFKF 2ACMA 3ZTQA 5HNFA 1HKQA 2VG6B 4L6V3 5JHFA 4DR3J 4PZJA 3VFZA 3S8PA 2Z2MA 2WVBA 1FKOA 5B08A 3M4XA 2VLAA 2DFEA 1E6VA 4X4TA 3CJNA 1N33J 4QWQA 5B0GA 2YKNB 4I2OA 2RKIA 3W2VA 4YS2A 5J2NA 2I9SA 2QSFA 4LR8A 2W7AA 3GQCA 1CF7B 2EBIA 2XB5A 3JSPA 1MSEC 3GO5A 1M5VC 3CCLS 3KIOA 2P5KA 1R3NA 3K7RA 2B9EA 4BCAA 4ENOA 4HOBA 5T7LA 3R5GA 3W5YA 4TU9A 1R0BG 2HLTA 3M9AA 3CD6I 5ICGA 4GKJF 3C2BA 1JXLA 4K4TA 1IUJA 3D1NI 2BGCA 2KQRA 2JZYA 4RR5A 3WGGA 2DA2A 2L0KA 4EJUA 1S7EA 2PFBA 1K4TA 3M8EA 2H54B 2RDIA 3HHLA 4CGZA 2OEJA 3CW2C 1D0EA 3ZTOA 2GMJA 2HGMA 2M34A 3CNQP 2UP1A 4C2MJ 1ETQA 2G4BA 3TAQA 2BJ9A 2KYZA 1O3SA 1Y56A 1S1UA 4IOCF 2K3KA 4AL5A 1Q1VA 4OL8A 4RX6A 3RYPA 1NM2A 1TL3B 4YHHJ 3ZTSA 3MM8A 5KG5A 2HHXA 4AD9A 5K5RA 3FBIB 2VKEA 4RMNA 4ZTFA 2NXNB 1DTTB 1FBUA 3BN4A 1HD1A 3QNWB 2VE9A 1AZSB 2NXEA 2VQEF 2DJIA 1XNQJ 2CG8A 3BEGB 1DU0A 2FMLA 5A2QU 3CCVI 3SQGB 1GXQA 2VUGA 3D5LA 2F4IA 4ZVHA 2ZKZA 2DH8A 1Y0HA 2ELJA 3CCQS 1WI3A 2Y0SN 3C1DA 2ZH3A 4A0XA 5KHDA 1ZELA 3HK2A 4P2XA 2CFXA 5F04A 2NVUB 2G9WA 2CUFA 2AX1A 4IG0B 2W4SA 3ULHA 1IBMJ 1F5AA 5B5EC 2IYIA 1X4FA 3PG9A 4CRJA 2DOFA 3LQQA 3VZHA 4FF4A 3BM7A 2AJ2A 2BKNA 4EQQA 1IXKA 3CO6C 3AQOA 4H4KA 3TVZA 4QPQA 3F22A 4L0YB 4MIBA 4OZLA 2BQUA 5E3LA 3KDNA 4PRFA 4UUTA 3HOZJ 3GCXP 4UUSB 4F3QA 3MAQA 4ECTA 3EGVA 5HSPA 4PQAA 3A01B 4CLTA 3PJRA 2XCAA 5J4YA 4XORA 4HSTA 3J81Z 3RAXA 3CUOA 3HSRA 1R8PA 4M5GA 3MM6B 3HOXJ 4Y52J 1FRKA 5I3PA 2B3TB 3P9CA 2EK5A 2UVVA 4OV1A 4QU6A 1VQ8I 4FASD 1WF1A 3DF8A 4R8UB 1RWXB 3KNGA 2CA9A 1TFWA 2GGPB 4NCGA 5A6WA 2ZHBA 3FRZA 5J3LA 1H9TA 3R97A 5F8MA 4DYRA 3C7JA 3RB6A 4XN0A 4DR5F 2QA4I 1SFUA 2Q6BA 5LSLA 2ZXWH 1R6RA 2C3YA 1IKXB 4LFCJ 3UVJA 2CJYB 1IRZA 2R7UA 1HNZJ 4OX6A 2MABA 4HH1A 3HYIA 1B6AA 2N82B 1J7KA 3H42A 1W36C 2TRTA 1S10A 1J75A 1X9SA 1NK7A 3DPTA 4L5JA 3D4JA 3PYEA 2QL7B 3PXGa 3KOAA 5HLIA 2QL9B 5KFFA 3H9JA 3DCFA 4DBRA 4HDHA 1JKPC 1OQ3A 4KV8B 3EYIA 1RTIA 4CA0A 1GTHA 2DA1A 2HVZA 3MZ8A 4AE5A 2GJIA 4DPOA 3OBIA 2JEIA 3PW4A 2LC2A 3T19A 3CCWA 2HS4A 1YBUA 1X3ZB 3U21A 3L00A 3FSYA 3BZKA 2RHQB 2NOJB 4TQRA 5LXYA 1TELA 2HFUA 3OPKA 2HFOA 3BH6B 2H1LA 2DAOA 1DURA 3M3YJ 3NMAA 4XOTA 5TRDA 5FJ4A 1R6YA 2GA1A 2NS1B 1XMOF 4F0KA 1CJVA 1ZTTA 1Q7YT 3KG0A 5HQ8A 1TKXA 5ILVA 5BMZA 2I8DA 5DDGA 3VPRA 1P6TA 2FHOB 4GKJJ 1BW5A 2KFYA 2X6XA 4KIGA 2IDEA 3KLEA 1G6BA 4CLUA 2KVIA 5HVQC 3CMAI 4LB6B 2DXDA 2IM2A 2E2IJ 2A5WA 4JQFA 5ETSA 2V8PA 4LG3A 3H40A 3R7SB 2K9NA 3OR2B 2XGQA 3ETMA 1T03A 1WZ2A 1GAOA 4OHXA 4V2GA 2C3OA 3S93A 1OKRA 4LSNB 3EUHC 3BGFA 5A8KB 3PHTA 2QT7A 4CCJA 2ZMEB 1UEUA 2NXUA 3HSJA 2RQPA 4C3KA 3KCCA 4PGHA 1SIWB 1HC8A 4B3OB 3HSFA 3T0YA 2B4PA 2MPUA 4ZVFA 5I4MA 3D66A 4I98B 5KFYA 2JA7J 2XMVA 3HO1A 2XGEA 2HHUA 1L5UA 1U9OA 1VTNC 1FJCA 1LPQA 1HA1A 1YX5A 5D4NA 1XGOA 3FXLA 4JYKA 1S72S 5F1JA 2YUSA 2IW5A 2DXFA 1DZ5A 3KUEA 2KO1A 4LIWA 3PSIA 2XDVA 2A6TA 4Q5SF 1UAWA 3HZGA 4P96A 2EFOA 2HYJA 4OLOA 4JI4J 5KOXA 3ISND 1VQSA 1JMTA 1OPZA 4F93B 1Z77A 3W5XA 4M3DA 2EVZA 2E2JJ 4ELUA 4A8OA 3DV8A 1TP7A 2WWYA 4H4OA 4EEYA 2ZH4A 2HOTA 2VJUA 5E1WA 5FFZA 1SXLA 3O8WA 1G3TA 1KA8A 4YIFA 4QIWD 4TY8B 4BAYA 2NPFA 2W2OP 3K1NA 3V2UC 1TVRB 1QPIA 1BHNA 2NXCA 3GJQB 3HKWA 1U1OA 1N5YB 1QU3A 4HRIA 2AKWB 4NLSA 4I01A 5TJJA 3GJTB 1QHHD 5FLXZ 4IRKA 2TCTA 1CG2A 4OHWA 2IT0A 1TV6B 3C16B 3MM9B 4C3LA 2YNGA 1QDUB 1G2EA 2DCLA 1NBEB 3U9GA 2J9CA 5CVUA 1RT1A 3MUTP 1LW2A 1FJEB 2L3MA 3CC4I 2WB1D 2RREA 2HKXA 4I7FA 4K2XA 4D5CA 2XAHA 2PDAA 4N8NA 2COLA 3P5BP 2VZ9A 4M6VA 2CGPA 5HMWA 3NAUA 2CQDA 5D0GA 4I6AA 3EZUA 4Q48A 4NZ0A 1ROFA 2DHXA 1FT9A 4LSLB 5G0RB 4DEZA 2V9VA 1HBUA 2HRTA 3V4MA 3DGPB 2XMWA 2FGOA 5H6QA 2X1AA 3G6EI 5L1JA 4UY8I 1D0ZA 1JLGA 1NDLA 3HHLD 4P1WA 4OJ3A 1TW2A 2PEHA 3M7VA 5HQLA 3NAHA 3OL9A 4MO7A 4PG4A 2WTEA 2EI5A 2NNYA 3TANA 3IRQA 2XMAA 1NK6A 2DA3A 3I4MJ 3V5RA 2XAQA 2HQNA 4M6XA 4CH1A 1VQ6I 2VG5B 4BBSJ 4U0WA 2DH9A 1U0SA 2QLBB 2MZJA 5C25A 3GFMA 5ETPA 3SFZA 1RLDA 3SDEB 5K5QA 3MQ0A 1GT8A 1RR8C 4OJ1A 3MMCA 5CXTA 4K4XA 2HQGA 4RNMA 3SBMA 1CULB 3DQVC 2XYPB 4HNTA 3QPHA 1X5PA 2UV8G 1KVJA 2HVDA 2VU5A 1S1VB 3AOCA 3AAWB 1QAYA 4GO5X 3E6BA 2CQ0A 2FSWA 1DLOA 4PG6A 4DSFA 1Q1HA 4Z7YA 3IWZA 5A0YB 2J8AA 2ZMEC 3QPTA 3PM1A 2BVMA 3ZTRA 3CULA 2F8EX 2AHQA 3AFHA 2DFFA 1NG6A 3T41A 2CQ3A 5CVVA 1OMSA 3H98A 1NB7A 4N7TA 1HBMB 1V4RA 2JH3A 3I32A 1U8SA 5HDKA 1EA3A 4HHHA 3J81U 2ZJRQ 4BQOA 2HQDA 2W7PA 4ECZA 1WHWA 3KK2B 4P9UA 4I02A 1QVTA 1FZPB 2LA6A 1Z05A 5C4JJ 4PWDA 4XRMA 1DHMA 5IOZA 3SFUA 5EEGA 3QQAA 5HNHA 3A1YA 2K1RB 2BE5F 4HX4A 2CNOB 4MK8A 2L7FP 3CCUI 4IRCA 2GHWA 4E2FB 1YW8A 5J8CA 4X65F 1YDLA 1TWHJ 4GKKJ 1PJ5A 4IZZA 1U1MA 2IBDA 2QKMB 1OY9A 2DOEA 2EV6A 5J6XA 1Q16B 4HA8A 1KS2A 1SMYF 1YBTA 1JLAB 2E44A 4OX7A 3I71A 1FTTA 4FE7A 1N6QB 2YNHA 4FX0A 1LKZA 2WAQN 3L7PA 2H4WB 2Y30A 3C19A 1BWVA 3TAMA 1MMLA 2B7EA 3F8CA 4U9RA 5M2PA 2W2NP 5E5NA 1CVJA 4HG2A 2VBZA 2E5HA 3RZAA 3H0DA 4ZH4F 3BJYA 1WJ9A 3DOMB 1CJTB 4EO6A 3HT0A 3MMJA 3KJFB 2MKIA 4HDUA 3W60A 5DG9A 3JAMK 3IWNC 1PSDA 1TL1A 5D6GA 3WG9A 1H6KX 1RT2B 4C8LA 4EGZA 2MLYA 3WTWC 1VQPI 3QU3A 3GFJA 1T9XA 2L9NA 2Z1DA 4C7QA 4Q8EA 3E8OA 1YS6A 2FE3A 3Q8UA 2L08A 2DA6A 1LWFA 2OCCH 3RZDJ 2CW7A 4XLPF 3GV7B 2DMQA 3C6TB 2PJPA 1PJ6A 4MKVA 4ZPVR 3WHIA 4JI5F 4OJHA 3S3OA 2MW8A 2PA3A 1HFEL 1JLQB 2AHOB 1YG0A 1AUDA 1TL7A 2UXCF 5H1SV 3M6WA 4O4GB 1P9YA 2DRBA 1GFWB 2HBYB 3CJRB 4RGRA 2FZCB 2OV7A 3I87A 4B48A 3CC2I 3IAM9 1QLNA 2XF5A 3NGRA 1K61A 1I6XA 4DV1F 1XN9A 1R9TJ 2RVJA 2OTJS 4X84A 4S04A 4S0HB 4IOAQ 1KSPA 3QAUA 3HVRA 2VF3A 4PZVA 3BPSP 2XRLA 1NUEA 3HGGA 2C2RA 2BJ7A 2KP6A 1SC1B 3FK7A 2R5ZA 4DCPB 3BR9A 2KHDA 2A61A 2C1EB 4I56A 1SKRA 1BQNB 2K9QA 1Q8IA 1U49A 1X4AA 5ETTA 2E5JA 2QLJB 1JXVA 5K1YA 2OPPB 4J9QA 5HMYA 4XLEA 5D78A 3NGUA 3QPLA 4B9VA 1RJJA 5FRMA 1IZ1A 4WKYA 1C1BB 2YY3A 3S6EA 1C0UB 3N5FA 3PW2A 3ZMZA 4HF0A 2DW4A 3T6JA 3VODA 5GAGJ 5L9NA 4X4NA 4HF1A 2EQRA 3G4SI 1I6JA 3VALA 4DQPA 1ETVA 4FPIA 3FF5A 4OAZA 4GDFA 3WC2A 3H3ZA 1SEUA 4QIVA 4OYPA 4E4HA 4E7JA 3DEWA 5D0EA 4QJVA 2PJRA 1VGYA 2DNOA 4DHVA 4DFKA 4ZLPA 3SV3A 4ESBA 1V55H 2FNPA 3BDPA 4IG3B 1WEXA 5EEHA 2KL4A 3TDUC 5EN1A 2RILA 2HVRA 2B7BB 5FLXU 2KDOA 2PEXA 1H89C 3IV5A 2VKHA 4ZTJA 3TP0A 2M1BA 1S9GB 4I0AA 5E1XA 3MR7A 1REVB 4RAGA 4FKXA 2BMBA 1HBXG 2XO7A 2H9ZA 1BWEA 2VASA 1YI2I 2JL9A 3ZQHA 4A8KA 5HLGA 4R8HA 3H0GJ 4DG1B 2BHZA 4OX8A 2MLXA 2J76E 1LEOA 4USUA 5EWFA 5K8MA 3L7OA 2ZD1A 3CGIA 1SVDA 2LBFA 4M72A 3Q0WA 3TZWA 4PSXA 2B0GA 1OYYA 2HIQA 5HK4A 4TVAB 1AU7A 2G7HA 5EG0B 2IGMA 1XD7A 3P8BB 3AAFA 4M5DB 1AKHB 4ZJZA 1Z7UA 4KITB 1VQ5I 4F50A 2L54A 3P96A 1S1XB 1XDSA 1Z2LA 5ETKA 1IKYB 2YBVA 2JHEA 4B9TA 5LMUF 3VQSA 4C98A 3R1HA 2GXBA 5CPRB 1J2XA 4EEFG 4DX7A 3J7AN 1MN7A 2DQRA 5DO2A 1LWXA 4CQ1A 4LLGF 2IJLA 1E0EA 1Y7PA 4ZLJA 2O67A 5IQQA 4O3NA 3M1VB 3IMQJ 4C9YA 3OYJA 3BT9A 4B17A 2HVHA 4OI6A 1XR6A 3EDRB 1YJ9S 1SKWA 3DLHA 2C2KB 2D3OR 1YRTA 1H72C 2W8KA 2DGOA 1RZ4A 2HDCA 4G3IA 4HVZA 4W90B 1LDKB 3CJQA 3TQ1A 4CCHA 1B4AA 2IEKA 1KN6A 3JR9A 2CYYA 2DNMA 1P8GA 3VZIA 1U1KA 3EMTA 2KJVA 2W7OA 4QIEA 1MD0A 1S1WA 2LYVA 3PNVA 1TQIA 4C97A 4ECVA 2CMPA 4XICA 1APLC 2UWMA 4IHVA 1YFHA 2JRMA 3BDEA 3HOYJ 2O9LA 1HMVB 4CO5A 1A04A 4FYWB 2XC7A 3V4IB 3LA0A 1K1SA 1RT6B 3WIUA 4ZYEA 2K9SA 4HHJA 4NLXA 4DV3J 5J1EA 1VQNS 2OUMA 4WFBQ 1V3RA 1K78A 3TEDA 2BM0A 4A5NA 4DJAA 2K8GA 4DQQA 3CCMS 3OD2A 5FFXA 2QBYA 1VK8A 2RV8A 1Q5YA 5HANA 2YWWA 4K50A 3EVWA 1QPMA 2VH7A 3GTMJ 4NXMF 1TWFJ 5IM0A 4P10A 2VE8A 3Q8RB 3KLGA 1KZHA 1U78A 2CPJA 1TNSA 3OY9A 2AMCB 2E36A 1EKRA 1Q7LB 2AIRB 2V8VA 5DEQA 1RT4B 5KT4A 3KP5A 2BKOA 3T5LA 4DR7F 3K4CA 2QSWA 4ANJA 1ZARA 1LEBA 4KJIA 5DQGA 2FVCA 1H38A 4OV6A 3VOEA 5H9FJ 3LANA 3V6JA 2DNPA 3TNVA 1YRXA 5F3ZA 4C11B 1F4KA 4MMOA 1AW0A 2F6CA 1FD8A 5HOOA 5B1AH 2E5GA 4MEXF 3PR4A 9ATCB 4PPDA 3RUBL 3KMSA 2EIMH 3D3BJ 4FF2A 4IX7A 3FM5A 1VQ9I 1CBKA 3KLIB 2DA5A 2YX7A 3MMBA 1YGYA 1G3OA 1YOVB 2M4KA 3PJWA 5AXKA 1RISA 2QGFB 1RTJB 2XS7A 2C2MB 2G1HA 1B0PA 5ICFA 3FXRA 3HHKA 2JA8J 3RU0A 3ZCOA 3I4NJ 4MAKA 3EDPA 4UTGA 2XRNA 2E66A 1RU2A 1RR7A 1SH0A 3CJ8A 3IH4A 4LRBA 5B0EA 5CVJA 1EH6A 3VYRB 1PBAA 2UU9F 2IS1A 2BW3B 1YITI 1IN0A 4HACA 3HKZA 4C9DA 3FXJA 1N5SA 2IIHA 4ZKAA 2VDHA 1NEEA 2HOEA 1T39A 3TA0A 3POTA 1ZETA 2DEIA 1TZLA 4BE1A 1FX2A 3HF5A 4IQXA 2XYHB 3DTIA 4URGA 3PIPQ 3PZPA 2KU7A 2EIKH 4KISA 4O44A 1USTA 1XK8A 3R5BA 2MC3A 5T14A 3JRDA 3DKYA 2GJ2A 1AB8A 1KQGB 1BI1A 3PFIA 4EATA 2AD9A 3KETA 3M32A 2I38A 2MQ8A 5DJBA 2ZJQQ 2MHEA 1R49A 2JK3A 2XS2A 4P55A 1DJ0A 1M1KT 1DRZA 5G4DA 1RTZA 2OI2A 1UCRA 3VV2B 2XKPA 3OR1C 3FZ2A 5HLFA 1N54B 5KFVA 3CCTA 2ISYA 3PRDA 1S3JA 4LLLA 4F4ZA 2KZGA 3DYAB 1SCJB 3I0SA 5DCFA 4RBOA 3ILIA 4JBAA 5HO4A 2BJEA 4KYZA 3M8JA 4E7IA 1QE1A 4ED2A 3SIPB 1IR1A 1Z1ZA 2VONA 2U1AA 2LY2A 2CQ7A 2VOOA 2KFDA 3EPZA 2CJXB 5KT2A 2L9DA 4B3XA 3QMQA 3FBFA 4A48A 4HEA9 4C8KA 2LQBA 1HSTA 3G6YA 2BY0A 4DUZJ 3CUQA 2POKA 3HDDA 2ZOFA 3IH2A 3CJ3A 2UVWA 2JPCA 4IPAA 1MU2A 3VGTA 3VWSA 3S1TA 3S2HJ 2IBKA 3OVBA 3MOJB 1ZM9A 1SAXA 2X1CA 3KHLA 3HRSA 1S9HA 1MBHA 3I0TA 4CO0A 4EVIA 2IM1A 1ZR4A 1F2HA 1X1AA 1HQEA 4C30A 3NOCA 3Q0AA 4AVZA 1ZZNA 5HJXA 1VC5A 1OQYA 3X2QH 2G7UA 2KJCA 2VKRA 2ZJPF 1RAGB 1HNVA 5K7ZA 7AT1B 3QO9B 1TW3A 1UHSA 1R1VA 3I9V2 2HZAA 1RBLA 4ZP8A 4IRDA 1UFKA 3R5AA 4NLUA 5LJ5Y 5CAAA 5ILUA 1I5OB 2PMZD 4DYQA 4WU3A 1LKXA 1OISA 3F6OA 4YDDB 2HHPA 4MIAA 2KZZA 3BZQA 3G8TA 5H9EJ 5CYMA 1SL2A 3LWMA 2IJFA 2HS5A 1SFKA 1KLMB 2YVSA 3ZNJ1 4DX8H 3ZQGA 1UKUA 4DU8A 3MKLA 1JKHA 2XGDA 2DY9A 1D3YA 1ZAOA 2CNLB 2GS8A 3EM1A 1C0TA 3CMQA 3GE9A 1T3OA 4F4XA 5KFGA 2R7WA 2FOKA 1T9VA 1Q79A 4ER8A 1S7IA 1FKOB 2LDUA 4OYMA 5EHHA 4DQRA 4U87A 1E6VB 2JMWA 4GC6A 1D9DA 1VQKS 3RZOJ 4IHTA 1T98A 3HB9A 3DLLQ 2RKIB 2XCPA 4WWCA 2CPYA 4DR2J 5IFMA 2BY2A 2FVQA 1HWKA 4L76A 5FKNA 3HG9A 3MAAA 4GC7A 2UVRA 3V6DA 3P3DA 1XGSA 1JI8A 3S8SA 3JRAA 1N0VC 1R7IA 3DNCA 3HOVJ 4F52A 5T7LB 3ZGKA 1DBDA 5AXLA 1HHTP 1VDHA 2Z2LA 2RD5C 1QVUA 3PJXA 3ZP5A 3K59A 2R7TA 5KFUA 1RAHB 1PP8F 3A1YG 3HHLB 3PW5A 2KVQE 1FNXH 2CG4A 2X1DA 1GXTA 2OH2A 4PJ0C 4AM3A 4O4RA 2YS9A 5F0HA 2YXLA 3HHDA 2LG4A 1EH7A 2CVIA 3K5MA 2DCEA 1J0RA 1R23A 1YIOA 5LLQA 1ZLKA 5GAHJ 1BA5A 1FVQA 4IH7A 4G94A 2V26A 4HQMA 1SAUA 2DK8A 3C6UB 1S1UB 5HROA 2MLGA 1DARA 1X4BA 3WG7H 2NVXJ 5E3PA 2RNEA 4M8LA 1FESA 4OX9J 5AONA 3MM8B 2ROGA 3FXKA 4JV2A 4NXNF 4HDVA 2OD5A 2E1RA 1F9HA 3VAKA 1VBZA 1Z2ZA 3NGSA 4LRAA 3BN7A 4P71A 5KFZA 2KPMA