2KDOA

Structure of the human shwachman-bodian-diamond syndrome protein, sbds
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
252
structure length
252
Chain Sequence
GHMSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, dynamics, and RNA interaction analysis of the human SBDS protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Ribosome maturation protein SBDS
total genus 57
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2009-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01172 SBDS Shwachman-Bodian-Diamond syndrome (SBDS) protein
A PF09377 SBDS_C SBDS protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.900 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2kdoA02
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kdoA03
3.30.1250.10 Alpha Beta 2-Layer Sandwich Hypothetical 12.0 Kda Protein In Nam8-gar1 Intergenic Region; Chain: A; Ribosome maturation protein SBDS, N-terminal domain 2kdoA01
1KTVA 4ZCMA 4FN5A 1N0VC 1ELOA 2WBMA 2NPFA 4ES2A 1NYNA 2I8EA 3B82A 3ZZUA 2BM0A 4QR0A 1ZM2A 1FNMA 1ZPWX 2EFGA 3E3XA 4QR1A 4ZCLA 1N0UA 1ZM3A 2J7KA 2BM1A 2I0XA 3B8HA 2BV3A 3ZZTA 2L9NA 2CVEA 4M1KA 3EXCX 2XEXA 4MYTA 1ZM9A 1DARA 2E1RA 1U2RA 4MAKA 3OQ2A 1ZM4A 4ES1A 4TNOA 4QR2A 1VI7A 5G4DA 4ZCIA 3LH2S 1P9QC 2KDOA 3UI3A 3ZZ0A 4MYUA 1T95A 4ZCKA 4ES3A 2IVYA 2ZITA 3B78A
chains in the Genus database with same CATH superfamily
4OV1A 1ZGWA 2ZCWA 3OL6A 3K2ZA 3ENWA 1TL7B 3RPQA 3AKZA 1LWFB 1P4XA 1Z2LA 5HMYA 2BVLA 3H92A 2E19A 1R1UA 4DYCA 1UZHA 2BEFA 4IRHA 2LXFA 2Y0SN 1NJWA 5F8IA 1IKXA 4DYRA 3VAHA 5E3CA 3GV5B 4KNYA 3HZJA 3UD4P 5L3BA 4U96A 2HQNA 2E1AA 4OIXA 3GJTB 3DEEA 1YRNB 3ZQ7A 1BJZA 1POGA 2LMIA 5EYRA 1KQ9A 1IJFB 1JGSA 1IXRC 4JI5J 3SXLA 3M2UB 2PI0A 2JNJA 3CC2S 1QJHA 1APSA 1H3DA 4RU9A 1KVKA 3PEHA 2KYZA 2VG5A 1SPBP 1FIPA 3DRPB 3T9NA 3KG1A 1VQ5I 5E20A 1EA3A 4RGXA 2YKAA 3DLEA 2A61A 3A2KA 2JEJA 3SBMA 1FX4A 1XN7A 2CA9A 4I56A 4LF8F 6PAXA 4KFBB 4O4GA 5AXKA 1RK8A 1DDNA 2E5NA 3BGRB 3FGVA 1QAJA 2R5YB 3ZO7A 3W64A 5HBMA 2HOSA 3IAS2 4M5NA 2G2ZA 2IJRA 3FXKA 3MM5B 1D1CA 4X4SA 2ZJPQ 2QLBB 5G0RA 1WC5A 1X60A 2PJRA 3ISPA 3T1AA 3QP6A 5E17F 1U1OA 1X4BA 3KG4A 5EWGA 3PY8A 1N25A 1IAWA 4V2GA 1U09A 3WTWC 4KA4A 3IBCB 5G4DA 2ROGA 1U1RA 2KDOA 4I7FB 1PCAA 1MGTA 3OR2A 3PNYA 4P10A 5CPRB 2DNKA 1KOOA 4XLNF 4LK1F 5L8RC 2FD2A 5C25B 2OAUA 2JZYA 2HMIA 2DXEA 2YNGB 2J9DE 2COBA 1H89C 4DN0A 3FK4A 3W8GA 4HLBA 2XWYA 2A18A 4K4XA 3OTOF 3HXLA 1FT9A 3AOAA 1MN9A 3GLLA 3BR3A 3WE3A 2I1RA 3WC0A 5HBMB 3HOUJ 3H35A 1IXKA 3LSJA 1J7KA 1NJXA 4U6PA 3CIMA 1Q16B 4DSJA 3FISA 1RT4B 1AW0A 3NL0A 4DGWB 1SFKA 3MPUB 3VQSA 1GX6A 4ZP6A 5D0RA 3QPLA 1A5JA 1G59A 5LEKA 3DMJB 2JC1A 4E98A 2RRBA 3QYBA 1WG4A 3WHIA 2V9KA 2V8VA 1H7XA 2QMWA 3MFIA 2OBPA 2IRYA 3FMQA 2ZBQA 5ADZA 1HLVA 2HHHF 1T9VA 3N05A 1R23A 2LQ8A 1S97A 5K20B 1Y6IA 2RNGA 3MOZA 4RUBA 1TL5A 1Z67A 2F2EA 3TZXA 5RUBA 4M5KA 2R5ZA 5J6XA 2VLAA 4D9JA 3PNVA 1W2BR 1F9FA 2EV0A 3NY0A 3C6UA 1FERA 3G86A 3C2HA 5LMNJ 2XQCA 2ERRA 3KCCA 4I01A 2MYFA 2QBYA 1NB2A 1XSVA 3I9V2 1R4MB 2DNQA 2F8HA 2C2KB 5GADI 5HLIA 2XVCA 3U21A 4EM2A 2C2OB 2E7XA 3KEYA 3V6KA 4USMA 2KIQA 2GQ2A 2OPPA 4PZVA 4OX6A 4FISA 3I53A 1OY9A 3BG3A 3KLFA 4P71A 3VYTB 3I31A 2PMWA 2H6BA 4OYPA 1VFJA 5HLFA 4WKYA 1VNDA 4HT7A 3D5MA 2LKXA 2Y3YA 1NJZA 2FTRA 2F5EA 2FJAB 1KLMB 1BQNA 2XMMA 1REPC 3OYNA 2M4GA 2Z56B 2WW8A 2XF7A 2GJFA 3R6LB 2DHSA 2VHGA 2V4QA 3P96A 5IWAF 3T5XA 1ZAWA 3V81A 5M5WJ 5IOZA 1IG7A 5EWFA 5DEQA 4M5DB 3A8KA 5J47A 4OX9F 3Q86A 3K0LA 2ZJPF 3KIOA 3C16A 5HS9A 5F41A 4O3QA 1YRUA 1ITPA 1DGRM 1Y1WJ 5A8RA 4HPQA 2CQBA 1DQ9A 2BE7D 4JK1X 1VQ6S 3MR7A 3AXMA 5J8FA 3TX8A 4PCQA 3P7NA 3VGUA 4TN2A 1TAUA 1UVNA 3A4CA 1BWVA 1KFSA 2CRLA 4LSNB 2GCFA 1GVJA 3LGMA 1IV8A 2R8IA 2EW9A 3W9IA 2QQ8A 1RA6A 4TY8B 5C2CA 4EGLA 1SVMA 1UB9A 2HG4A 4RBOA 1X7VA 1NNDA 2EZIA 3QWUA 3CF5F 2BEOA 4AD6A 5JR3A 2L9VA 1R3NA 2POKA 2IVMA 2MZSA 4KKOB 3HM9A 2FVCA 3KJVB 3LH2S 2NXCA 2KZGA 3LSTA 1JLCB 3I5BA 1N34F 4G1IA 3LPEA 1IXSB 1RHRB 5GADU 4F02A 4YFNF 1P8GA 3F22A 1S5ZA 2U1AA 1HL6A 2D3O1 4DOZA 4B9NA 1DLOB 2ZMEC 4OHVA 2YKNA 2V26A 5A8RB 4LR7A 2SXLA 1FTRA 3TEDA 3MM8A 4C8OA 3DU5A 3BTIA 2PDAA 1W7PA 4I64A 2ASYA 1PBUA 1LNWA 3L2VA 1LKXA 1R5HA 4TXSA 3IWNC 4U0YA 4ES3A 1K6OA 1D8ZA 2DEJA 2J7UA 2QE5A 3E8OA 3BO3A 5K8PA 5DZ6A 3DOLA 4OZ0A 3KMQA 1C0UB 4ED5A 2BM1A 3HVTB 3E6MA 2KG0A 5MLCV 3CP8A 2D41A 3WU1B 1PYSB 3H9GA 1V55H 5T41A 2QRRA 1OYWA 1X1DA 3QATA 2ELKA 1IWGA 4DL7A 3SDGA 4OIQF 1RAOA 6FDRA 5KG1A 1F5AA 2K7LA 1EQ0A 1U1NA 4J9MA 4JUZA 4DR4J 4CCHA 1OYEA 1HBUA 2WVCA 2JTVA 4NMXA 2B4UA 4C0HA 4F2RA 1Q1KA 4Y34A 4AIJA 5I4MA 3DTEA 3F6VA 2QL9B 1MSEC 4ENNA 1YW7A 4ANCA 2ME6A 2KXFA 3JW4A 4JI8F 2YSRA 1OQYA 4A3EJ 2JA7J 1WI6A 3E3VA 2CQ2A 1XMQF 2ECBA 2UXBF 1K1QA 2K5CA 1F1ZA 4ED1A 1J09A 4S05A 1O5JA 1FKPB 4ZN1A 2MQOA 1IRZA 4W98A 2MHNA 4P7VA 3WGHA 1ZKGA 2KFZA 5L3FA 3PIOQ 3ADAC 3HUGB 3J7AO 4I0WA 4NZ6A 3H5AA 5E3NA 3G71S 3M1VA 4Q48A 2JEIA 3FXOA 3NCQA 1VQ9I 1RISA 2ACJA 3QPTA 2JLFA 3O8WA 3R0JA 4B17A 2YKMB 1W26A 2N4DA 1G3YA 2J8AA 1T05B 4FVMA 2RDPA 1P7JA 4QQBA 1N34J 5HLTA 5ILUA 2EKYA 2W00A 1LE8A 1RT2A 3JAMY 3SXYA 5M2RA 1TWGJ 3LANA 3TDUC 2R9LA 2DK8A 2W1OA 2CQGA 4H54A 3GV7B 2HU9A 3QU6A 3R6SA 2Y9HA 3V81B 2ZZTA 3DXSX 4ZVHA 2VG7B 1RT3B 3BOQA 2XSDC 2DO7A 1IBLF 2W85A 3FM3A 1HYSB 3F56A 4PJJA 2XMWA 3G2BA 3CJ4A 4RNFA 2QEXI 3K4KA 3BPXA 1MBJA 3FBIB 3OYFA 1FX7A 4AUKA 2RILA 4ZK7M 3OYCA 4LRAA 3EGVA 4PG7A 1X1AA 3GFJA 3MMBB 4DXLA 3BZQA 3Q23A 1FYKA 2QSWA 1MKMA 2FF4A 3M32B 3I4PA 1YIJS 1WC3A 2DDBA 2OSQA 3ILOA 5J4VA 3D0IE 1RTHB 2JRTA 4HDHA 4LIUA 2BJEA 3CQZJ 1MDMB 4KBIA 1TWFJ 1S77D 2HW3A 5F1RA 3BBFA 1X19A 3G82A 5ILVA 1YJNS 4Y7NJ 4AC0A 1IBMJ 1FOWA 1ZBTA 2VE8A 4ZZDA 3SV4A 3HIFA 5D6FA 1UHMA 3RTRA 1AXQA 4I69A 1NH7A 3GCWP 3V8JA 4FYWB 1RZ4A 3LSGA 1XMQJ 2M2BA 4AFFA 3HB9A 3NWGA 2XAGA 3ABUA 2Q6CA 1S9EA 3L7OA 3F41A 1XGOA 1UPMB 1ELOA 2ETHA 4WXDA 3K8VA 4EM0B 3SJMA 1C1BB 2K3IA 1JLBA 3ZTSA 1F5BA 1ZM3A 5HLFB 1OPIA 1R6YA 2DRAA 3IR7B 1WI8A 3OXLA 3BR5A 2RQMA 1H2VZ 3TAMB 1I27A 4CZZA 1H98A 1H9GA 2RAEA 2ZMEA 2NUHA 2ZVIA 3M6UA 5F8MA 2Q66A 3IM8A 2WRMA 3Q24A 4DWIA 1YLXA 2JSCA 3TVZA 4C48A 3G4SS 4P73A 4GO5X 2BE2B 4DFMA 4FXDA 4F4AA 1ZQ3P 4XRMA 4OI1A 3GIKA 2IDEA 1LWFA 4IH5A 4PWWA 4I67A 4LIVA 1VQMS 2DCEA 4DF8A 4A3LJ 1VHFA 2DNLA 1WF1A 3NS7B 2NVUB 1D1BA 2HGLA 2QJ3A 4BCAA 2NVXJ 3E97A 1S4EA 2DHHA 1WKMA 3KG0A 3EUAA 3KMSA 1QY7A 3K89A 1S0NA 3HRTA 4DPYA 5CABA 5H20A 4CCLA 4KJZA 2AQFA 4OX7A 3TJAA 2NYXA 4ABZA 3KETA 3DOLB 1N5VA 5J2NA 1REGX 4JI2J 1M1EB 2FSWA 3AA8A 4M5HA 1VQOI 4XQFA 1PBAA 4KE5A 4YEJA 4F0MA 3POTA 3K2AA 2VODA 1UFWA 1O7LA 1UZDA 2DJIA 3IS9A 2Y75A 2LY9A 2KKOA 3DDNA 1MJBA 1MLAA 3V42A 2W9CA 2MMYA 4CUGA 4RUCA 2DD8S 2R7QA 3A01B 2Q1LA 1APLC 4Z37A 1MU2B 5AT1B 3ZZRA 5EG0B 3CJ0A 2J6SA 3S32A 3F23A 2CJ9A 2Y0BB 2WY8Q 3K70D 3AD9C 4IG3B 3IN5A 1OR7A 1ZK8A 6AT1B 4W1UA 3K6GA 5C25A 3T5LA 4L75A 2OD5A 3OYAA 4OINF 3PVXA 2Y1IA 1HNZF 4K59A 4HLYA 3V6JA 5FO5A 2ZEJA 1X5OA 2XZTB 1BWEA 1MNMC 1XMOF 2VQFF 5ETMA 2KT3A 2ZXWH 3CUNA 2HFVA 2CKWA 2G9OA 2H6CA 4U7CA 5C7PA 2F4MB 4O6JA 3KLGA 1KWMA 1Q78A 3GYGA 1FFGB 1A6QA 3L7PA 1MMGA 3VVTA 4GO7X 1HKTA 2W9BA 3NEUA 3IH2A 1MIJA 4NZ7A 2UXXA 3U2RA 5BQTA 1LE8B 4XO0A 3COAC 3D68A 5AXMA 4UXNA 1A6IA 3GMGA 3DKDA 3G8QA 3OVSA 2C3YA 4DJAA 4A6DA 1RWUA 5ETQA 4J9QA 1EETB 1VQPI 2MZJA 4KFBA 2NOJB 3UDCA 1YJVA 2ZBIA 3I71A 1HNIB 4OYWA 5E3QA 3CUQA 1RCXB 1S6UA 4ES2A 1HPZB 3GZNB 4B3TJ 3R5AA 2EILH 5C5JA 3CCZA 4GCVA 3MTJA 2QEXS 1WC6A 2UUCJ 4YRVA 1K83J 3RZAA 5HL7Q 1U45A 1T03A 2FBIA 4L5JA 2PMHA 2XYPB 2G0EA 1U8BA 1PDNC 1P92A 1VQNI 1HFEL 2KM8B 2N82B 3V4MA 1KVIA 5KVRA 1TUVA 4IL6C 5KFEA 2RQ4A 1IRXA 2RQCA 2OP5A 2J5PA 1JJ6C 3T1HF 4JI3J 2ZZNA 3S17J 3H25A 1FI4A 5KG5A 5B0CA 3SV3A 2IJFA 4U67Q 4UVAA 3GIJA 2AZ3A 4F0KA 1S1UA 2QLFB 3MM9A 3GILA 3CCRS 4O5VA 4JV2A 2YPYA 2HHHJ 4QR1A 1DGWY 1CULA 4K7QA 1M5KC 4JOMA 1EH7A 1IDZA 2WAQD 5CD4A 2L9SA 3M9NB 4B09A 5B3SH 2L9RA 3FBBA 3RRKA 3GFMA 2FZCB 1GX5A 2HWHA 4EZ6A 3ZQFA 2E35A 3G73A 5FD5A 1VCTA 3ABMH 1AYEA 1MBKA 3RPUD 1S9GA 3RI4A 3CO9A 1TWCJ 4ER8A 4DL4A 2ZXIA 3QPSA 2D7SA 3VWSA 4LB6B 3HGYA 2X9DA 1F9NA 2PMZN 2MPUA 2DT6A 4LJMA 1RHKB 1VQYA 2M34A 4G1QA 2VXDA 5AIQA 2HOAA 1FC3A 2D1HA 4B08A 3HJFA 2ADUA 2LA6A 3I87A 3J7YU 4FYYB 5FRMA 3LPYA 4PJLA 3PR5B 3D5SC 3SSSA 2MG4A 4M9SA 2AJFE 1P2FA 4CO1A 2GZWA 4TNOA 1EJ7L 3PFEA 1U26A 1YJRA 1X4GA 5CCMA 2EIKH 4NLTA 2Q43A 1E0EA 1R6VA 4ALZA 1BC8C 2XF5A 1DP3A 3NS5A 2HKXA 3NGKA 3ZMSA 3N4MA 2EK6A 5JVTA 2VKZG 4KMUX 2FJWA 4F92B 1TMJA 2NXNA 3KLIA 4I02A 4DX5A 3SFZA 3LSMA 4B43A 3JSRA 1BQMA 3N28A 2VASA 2DJNA 4S0MA 3HOXJ 1ZRFA 1HQ2A 3HDSA 4LSLB 4RW4B 3UFCX 1YJWI 5E1ZB 1M1KT 1DUXC 4R8UB 1RWMB 1EP4B 1QUVA 4DF4A 4RAYA 4OV6A 1VK8A 1P7IA 4DNCA 1X4FA 2JUCA 4QZVB 2IMOA 2CADA 3FRYA 4CRJA 2NAZA 4U0WA 1SVOA 1TP4A 2DNYA 3TO9A 5DM6F 4M5IA 3NKYA 1K73T 4MEYF 1Q82T 3MM7B 1WGXA 1A7GE 3L4BC 2BZTA 1B7FA 2RDIA 4OLPA 3TVKA 4JI5F 2JK3A 2IM3A 2F48A 4X65J 3R61A 5K5OA 3GTYX 3S15J 2G0CA 3GPAA 4OWRB 1Q79A 4GO1A 2HPIA 4K0KF 2HIQA 3GTGJ 4J9UE 1L0OC 4WK1A 4RMNA 3PYGA 4Q2MA 4XKWA 2L9NA 1SMTA 4ECYA 5C44J 1SD5A 5J1UA 3FZVA 4EFAC 2ZH3A 2DNOA 3D1OA 1PUEE 1F9HA 1VQ7I 2LLKA 3E5XA 3QWPA 2HHPA 1KYWA 3D6HB 2DGUA 3JTGA 2KVQE 4DV6F 3PUBA 1J27A 2Z3YA 1S1WA 1N5YB 5DG8A 1MJ9A 4JX4A 4RJVA 5BR8J 5J1PA 3FK6A 1FD8A 2E9ZA 5HLHA 3HXMA 3ZMDA 2QA2A 1RDRA 3MZHA 4XNFA 4IRCA 4U0VA 4ILLA 4K5SA 5IYDJ 1FEEA 4OMFG 1X2NA 2HZDA 1VRQC 1YJ9S 4H4OB 2AD9A 1JKOC 2K7JA 3DOKB 4RNHA 4LMZA 2K9QA 4EV0A 2B63J 1F43A 4C3KA 1WTFA 4USHA 3WC2A 1QUPA 3CXCR 1D1AA 3W5YA 2M0MA 3HPHA 3A3OB 2HS0A 5C42B 3D9BA 5FKOA 3IWFA 2W57A 1RPWA 1FXRA 2FRHA 1R7IA 1BL0A 1CGPA 2YQ3A 4KY3A 3HYIA 1FPQA 2R4FA 4LLLA 4DSIA 1R31A 2LTPA 4BY7J 3EE3A 2FJDB 1N77A 4Y4RA 1FVQA 2BJ8A 4KAIA 2Y8YA 3P9CA 4NLQA 4JI4J 1EKEA 1BGXT 3JREA 3S1QJ 2BDPA 3Q2SC 1UWBA 4ZPVR 3BROA 4ECVA 2F4OB 5CD4H 3W60A 2ZMEB 3FMRA 2HQRA 2QUFA 2XYGB 4XK8C 3B4DA 3IGNA 2XB0X 3AG1H 5E8GA 3MKLA 4JI0J 4DZPA 1NK6A 4HTIA 3JRDA 4I7HA 3V4GA 1LWEA 3QGGA 5A8WB 1QU3A 3W2WA 1FOKA 4LF7F 1UELB 3H0GJ 1F2HA 5GADJ 2WV1A 2DR7A 3HT0A 2BX6A 2MEWA 2V2ZA 5F1JA 2QYOA 1KU2A 2Z0GA 4PQUA 3A12A 4H4MB 2QGUA 2IRXA 4ZVPB 1FRIA 1N88A 4N0BA 2R0QC 2BJ1A 4OMZA 4B9UA 3CCYA 3HOVJ 3R60A 2NYHA 2DNRA 2BUNA 3NAIA 4BJ5C 1L3VA 2WB1D 2KN4A 1V54H 5GAGJ 5IQ6A 1M5SA 2E71A 4O3MA 3DTIA 1IN7A 4QIWN 3A0HC 4C11A 2MQMA 2X6YA 2PMZD 5EF6A 4P9UA 1QZZA 2YU3A 3FCWA 2HHVA 5J4YA 4ZVSB 5B66C 2JLGA 2J0QD 3CSKA 3GTLJ 4OU0A 4X62F 4RM3A 3J81Y 2CQ3A 3GSDA 1NTCA 4WJBA 2UV8A 2AGPA 1JUSA 2HQGA 3E5UA 2IA6A 4PRFA 5FKKA 1EV7A 3HVRA 3OFFA 3C19A 3LOUA 2WVEA 3BM7A 3C6UB 1S6QB 1KS2A 3RQIA 3LAMA 3B82A 5ILSA 4J91A 1X3WB 3GR1A 2E1MB 1Y8QB 5FKLA 2ZJRF 2QTWA 4JI6F 3B6BA 2H1KA 1GDTA 4JI4F 2H27A 3I0RB 4PUSA 4K2XA 3CDHA 3IRWP 1GFWB 3UN2A 2NS0A 3KLGB 2VC1A 3HHLB 1FYLA 4FDFA 2OFHX 2DKOB 2HNYB 2B7BB 3G8TA 2HRYA 5AE1A 2FPHX 4U88A 2A69F 1FJCA 1KLMA 2B3TB 3LALA 3RBXA 1VHIA 3RAQA 3CE8A 3Q0WA 4I1TA 2CXEA 4EJVA 4DR1F 4EGYA 4AL7A 5B1BH 4CZCA 1I3OB 3C3WA 1IKVB 3RR8A 5B0DA 4EBCA 2ZD1A 2CSOA 3HPGA 1ULYA 1EARA 5KCMA 4Q5SF 2FLOA 3R8YA 4IOCF 4AL6A 4J9PA 5GAGI 1I94J 3UCGA 1JJCB 1OPZA 3M6XA 5CZXA 3U1KA 3K69A 4OYAA 1L3TA 1LXNA 4XL9A 5IP9J 4NQWA 5DLGA 5GP9A 2NPIA 2Q79A 2QFIA 1LWCB 4ZLNA 3J81j 1TUGB 2UV8G 2JMWA 2HVSA 2V68A 1GV5A 2BACA 1HD1A 4HR2A 2HQCA 1LWCA 4MQVA 4DUYF 1C2PA 2MY7A 1P6TA 4G1PA 5A0YA 3FSXA 4A8XA 4A3IJ 3NQOA 1OS5A 4HDGA 1IN5A 1DBDA 2UVVA 2MLZA 4UQTA 1T03B 2M7BA 4WF2A 3FBEA 4EVIA 4DJBA 3BWGA 2FD5A 1EF4A 4LF6J 5ETPA 1XX5A 4NCGA 2NNYA 4BQOA 1PG5B 4PXBA 3HHLD 4YS2A 3TO7A 5EEHA 4QWAA 1TKDA 3ZTRA 1YO5C 1UJ4A 2UV1A 5B7WA 5JUMA 4HRIA 1DTQA 2RDDA 4LF4F 1R00A 3CCMS 1R1VA 4DX8H 2OGUA 3FEXB 2O8XA 2OPTA 1T9XA 2O3FA 3TJ8A 5M2PA 4J37A 2QLXA 3NLCA 1HBNB 4F25A 2MYSA 4RX6A 2LG4A 3K4BA 4F55A 2OCEA 4ICLB 5JLXA 3BF4A 2KZMA 3IMQJ 2CNNB 2HQDA 3DLEB 2NCKL 3RW7A 2KXHA 4Z2YA 2A6OA 4LSLA 5A76A 3SQNA 4C8ZA 2GM4A 2FBHA 3CLQA 4WZQA 4YP3A 3SZPA 3PX6A 1FE4A 3ILLA 3MUMP 3FCVA 1YJWS 2CNKB 3FBCA 1JKRC 3F3XA 2ZH5A 1NU4A 5LHHA 4BACA 3B02A 2HFSA 1UZCA 3H8YA 1YRNA 4ES1A 3LSRA 1QRYA 4KHPF 1PAUB 3EVWA 4FKXA 4PUOB 4DR6F 1FTZA 2L7MP 1HBOA 5IC6B 5A6WA 1S4FA 4F67A 1UJ8A 4X64J 1PUFB 1GUUA 3VF0B 3ETOA 4RA2A 2WK4A 1HW5A 4RGUA 1U1LA 4GKJJ 5JXSA 1FSEA 3O6BB 2DJWA 2HEKA 1FWZA 4E4HA 3J7YI 2PMUA 3OSPA 3DEUA 1R8BA 2YWGA 1RB0A 2OSRA 1KN6A 3G6EI 4RW4A 3AXKA 4QIWD 1LW2B 5DD4A 1XD7A 2FVPA 5J2NB 2CG8A 1U8RA 2RHQB 3TEGA 4BDPA 1RTIB 5JVGQ 2WB4A 2AT1B 4BEHA 3FFIA 3MURP 3I4HX 2MKCA 4OYZA 3BQ0A 2AEJA 3PRBA 2XIGA 3MPWA 2XMJA 4U7UD 4NLPA 4HQEA 4JI0F 1E6YA 4CT8A 2EFQA 3S1MJ 1ZM4A 4Y2KA 5EGYA 4LBIA 2VPXB 4G6VB 2Z2SB 3ZGKA 1D5YA 4P6QA 1NKEA 3I58A 2FJXA 1PC4A 3L09A 1CG2A 1N78A 3BQ2A 5K7HA 4I2OA 1R22A 1RBLA 3SFIA 1JUPA 2VZ9A 2HNHA 2DFFA 4UF4A 2M8GX 2EBIA 4X6AJ 3FNNA 5THWA 2DYAA 1FTTA 4MKVA 2AV5A 3N0VA 5E3RA 2RUSA 2LDIA 5DUKA 3KLVA 2K86A 2CZ4A 1BMQB 5B09A 2LY1A 2XROA 3F8MA 1ZG1A 4QIVA 3CCTA 1O4XA 1JQGA 5E5NA 4PG4A 2VT2A 3CJRB 1HBXG 1C0UA 3HRMA 3OQ2A 4KFCA 4ELUA 2FU4A 4MYUA 4XLEA 2HVIA 1BN5A 2HHXA 1XMKA 4G12A 2WV0A 2LKSA 3CGIA 2LYVA 4NDLA 3ZNJ1 4O44A 1Z6RA 2WCXA 2NS8A 4AT1B 2WSFC 4QOTA 4A0ZA 5KFZA 1LVKA 1IM4A 3N9UC 1VQ4S 4GKJF 5KOWA 1IM6A 4ENMA 3OFEA 4KITB 1O51A 3S1RJ 3W8PA 1QQIA 3I0SB 2VQEF 4FX4A 3IHUA 1RKIA 4MKYA 2J7WA 2IYGA 3ITHB 4DX6A 1W5TA 4YG2F 2A3SA 2D1CA 4XM3A 3D6FB 2OPRA 3HK2A 1HQEB 1NB7A 1ZM2A 2ZJQF 4WFBQ 4LSNA 5FLXK 2V2QA 2JZ5A 3MM6B 4C0BA 4C8NA 2A6EF 5LXRA 2XG8A 5DS7A 4FS1A 1NKCA 1ZAVA 1D0YA 3M8YA 4M3GA 5LMUF 1HSTA 2HFUA 2NXEA 2G4BA 2NXUA 1K4TA 4O3OA 3FSYA 1IWAA 1B7YB 2MH9A 2OU2A 3EUHC 4M5DA 2WB1N 3AAWB 4UUVA 4UV8A 2VKEA 2XB2D 3VV2B 3ZZOA 3BSOA 4PJNA 2QKLB 3LWMA 3UE2A 4M63A 3OSFA 3AQPA 4ENKA 2H5EA 3J81U 2X7IA 2OUGA 2OD6A 2RIJA 1W5SA 1U6BA 4FNHA 4RNNA 1NYNA 4IHVA 3NWTA 3TL4X 4MT1A 1S59A 4DV1F 2KKHA 3DKXA 4NE9C 2LA4A 1J75A 1SC7A 2BANB 2GVDA 3PEJA 4OIRF 4IR9A 2P8IA 3BR0A 5BYRA 3MCNA 4ETZA 5CQGA 1RWVB 2VUMJ 4K5RA 1JJ8C 3ZZUA 4GKKJ 1OYYA 4XLFA 4TLQA 4ED8A 5BNGA 3IL2A 1FNNA 1YGYA 1DU6A 3IV5A 3NXZA 1SKRA 1JNRB 2R7WA 4ZPTR 1RP5A 2ZJQQ 4WF9Q 4LFAF 3GCMA 4LF2A 3PW2A 2DODA 2KT5A 2TCTA 2KZVA 5C42A 4CM2A 2Q1ZB 2UXCJ 2W2PP 1I3AA 3BG6A 3K2YA 5D6GA 4IQJA 1XPXA 3WTXC 4ETXA 3PW4A 5HAOA 4N8OA 1S0MA 1PYVA 2A5YB 2JA2A 2IVYA 1NDPA 4HV6A 1YSJA 1UFLA 4HNTA 1I51B 4I98B 2V5HG 4QBUA 2NPFA 4C0OC 2WW4A 1ZR4A 1CC8A 1JE8A 5ITHA 2HNYA 2UWMA 2JA5J 2M5YA 1XSXA 4PSXA 2X3DA 3QSYB 1ENHA 2KH9A 2W9BB 1FVSA 2OEMA 5M5YJ 5FLXU 3L2UA 4RB2C 1ETVA 5L3DA 1K78B 2DLLA 3BSAA 4ZPCA 2X1AA 2VOOA 3T1YJ 3WX8A 3QJJA 4YEAA 1X5PA 1BC6A 3GO5A 2E29A 2AJ0A 2CJQA 3DI6B 4P72A 3SCIE 3V6HA 1E3HA 1O3RA 3DRSB 2RB7A 2Q2EA 3GMEA 5HVHA 5HN0A 3S8PA 2BE9B 3NEKA 3I6PA 2PEHA 5CCLA 4S04A 1RT3A 2QLZA 4FYVB 3EZUA 4L5EA 2AJ1A 5I42A 2HFNA 5HDGA 2VBYA 5FJ4A 2C3PA 3E6DA 1Z7LA 3S8SA 1JXLA 3DXBA 3FMSA 1T9TA 1WORA 3L2CA 1BW5A 5F9NA 3OOPA 2C3UA 2G2OA 3Q8SB 4UOGA 1N33J 2Y48A 4JB8B 3EZOA 3PO5A 1SVLA 2IM2A 4QU7A 2R8KA 1RE1B 2DGSA 3H2VE 2YX4A 3A02A 4BJTA 3ZZZA 1LB2A 1IV6A 1QPMA 1D0EA 5J8CA 4OYXA 2V1XA 4IDKA 3VGVA 3GFXA 2R2SA 5L3CA 2LFVA 4M94A 3CCQS 2NXNB 2N7CA 1XCVA 2MGQA 3IR6B 4FBTA 2YNFB 4UB6C 2H1LA 2E1NA 4LITA 2ZC2A 3FVYA 4F2SA 2CU7A 1Z2ZA 2DA4A 3AJ2A 3DV8A 2M9KA 3BJOA 4KIBA 1HWUA 5DLFA 3FWEA 4DR2F 4W4MA 3UNYA 3RRHA 3QRRA 1MMLA 5D4RA 4I99C 1ZETA 4DPTA 1YG0A 4Y00A 4ILRA 2VA2A 1H0MA 1OY8A 3SMZA 5KFBA 4P9FA 4I09A 4UHTA 1B6AA 4F91B 3HBLA 2L9WA 1A31A 3R97A 4IO9Q 2EK5A 2WTEA 2VQHA 2B4PA 1GTEA 3DCAA 3JRCA 2NNNA 5KFQA 5DDRC 5D4NA 1UW9A 4YFKF 2VB6A 4W97A 2AP6A 1IKVA 3EX7B 1R7JA 4BDYA 2FVSA 2D3OR 1W0TA 2WHOA 3Q8PB 2BJ3A 3W61A 5FJ8J 1FMVA 1WJBA 2GZOA 1ONVA 3KP2A 1ZOTA 5KFPA 1NDKA 2HWIA 4IR1A 4R25A 4KSEB 2X6OA 4IOCQ 3DM2A 5CZVA 2JHEA 1CSJA 2WBRA 5IYCJ 4K4VA 5K5QA 2LECA 4LSZB 2MQLA 1TTHB 1ROFA 1ZYRF 2M7AA 1SV5B 2JEGA 1I5OB 4QYZJ 4B48A 1LNQA 3PO3J 2HPUA 2UXDF 2EVZA 2P81A 1WELA 3W9JA 4GC7A 1TELA 4N56A 1JXVA 3M8JA 4C3HJ 3HC7A 3M9OB 4CO3A 2VQGA 2DRBA 4U7BA 2ZXHA 1U1PA 4XLAA 3VQTA 4HH1A 3RZOJ 2CUFA 5LGUA 4RB3C 3TZZA 5DS9A 4EU0A 2RRAA 4XN3A 1IN4A 5EEGA 2VE9A 3WODF 2DRDA 2VG5B 1H2UX 3MAJA 3ZPLA 3CCES 3TOBA 3IH3A 3AD8C 3CMEI 2GIVA 2BXYA 3WE2A 2B7EA 4DZDA 1R27B 3H20A 4ZVUB 2OCCH 1JB0C 4LRCA 1VISA 3EICA 3FZBA 3G6ES 2N3LA 4OOIA 2DGWA 1Y3KA 3DCFA 3WU2C 2IMWP 3GW2A 1AUSL 1NPRA 4P2SA 2M7SA 4YFUA 3FKJA 3CJQB 1XDSA 3HP6A 4KT5C 1T7PA 3IKTA 1IW7F 1E3OC 3F6OA 1JHHA 4XICA 4L9TA 4BUPA 2P9EA 4Y0FA 3G9CA 1YTYA 1JWWA 3CMAS 3LA7A 3OYBA 1FEXA 1PYOB 2AF6A 1PVEA 2C2DA 1IN0A 4IG0A 3VGSA 5J2PA 2BA9A 4B3OA 1HWIA 1MBGA 1W7WA 3R2CJ 1JLQB 1MNEA 3EGZA 3KK1A 1LFUP 1Q7LB 1NZ8A 2CJJA 4N4OB 2VOPA 1U24A 2GNKA 2RVJA 3KYCB 4CT9A 1SJ4P 1V5FA 2LQBA 3DKYA 3MZYA 2ZM6F 4NX9A 5HMWA 3JQMA 3HD2A 3EXCX 1B59A 2QFJA 1BIBA 1XEZA 2HLTA 3MUVP 3M30B 3ZN0A 1ZA1B 3HSRA 4BWJA 2M0GB 1TFYA 2M4KA 4BGDA 4A3MJ 2J76E 2KIMA 4LLNA 1NAQA 1V3ZA 2WVFA 4E7IA 4LRBA 3GJRB 1XIQA 4DBRA 1W7PD 3GTPJ 3ERMA 1S6PB 2KFDA 1FDNA 2DCUB 2H8WA 2B9WA 4J01A 2VD3A 2DR8A 4K4ZA 4DL6A 2VFRA 2YQ0A 1SANA 3WIVA 2EQRA 4XKBA 4P74A 1ETOA 5HROA 4UZCA 3UW1A 5JVGF 4V2FA 2Z57B 2YKMA 5D4LA 3GYHX 5E79C 1BQNB 3B8HA 4KGZB 4H4OA 3TX0A 4G6DA 3E6CC 1DHMA 2ZB9A 4GVBB 2KRCA 3LW5C 3HHNB 3P3DA 3DPTA 4OHXA 4URQU 4DV0F 1VQ8S 1UVIA 2XPVA 3FDYA 3A3NB 3HCXA 1IKYA 3UWTA 3H42A 2Z1DA 1O8BA 1KD1T 3HKZA 2DQLA 2RREA 1H72C 3OMYA 2BVZA 1Y11A 3CTRA 1U1QA 1RT1B 4NI2B 5IP7J 5T14A 4ZC3A 5KT4A 4J9OA 4F3OA 5HJYA 2XAJA 1V5IB 1YG2A 4USUA 1A9NB 1JKPC 3TQEA 4U87A 2L08A 1Z4UA 5CAAA 1WD6A 3B73A 3KUEA 1P6RA 2L9DA 4BE2A 5FRNA 3OTEA 5DQIA 3J7ZI 2I2YA 4KDPA 2JL9A 3MECA 3BSNA 3D4JA 4PKDB 1GV2A 5EUHA 4ILMA 2F65A 2UU9J 1HSJA 1KKHA 2DFEA 3PM1A 5IP6A 3NRVA 2A2CA 2FHJA 3DLKB 2PI5A 2M87A 4ATNA 2R7ZJ 2ZXJA 1XBWA 2AYEA 4EI2A 2HFHA 3ECHA 3BYPA 3M9MB 2ZH8A 2ZJRQ 4RB1A 2YS9A 4DL2A 3TRGA 4WKRA 4KMFA 3IFEA 5ETSA 1S1WB 4PWDA 3H1CA 4IOAF 1FNMA 3BTLA 2FZKB 4B3TF 2ZJ2A 1XN9A 2CV0A 1U5TA 1RC9A 2ZC3A 3POTB 2OQRA 2L5QA 4LB5A 4GMKA 4YHHJ 2ZBKA 3RKWA 3MD3A 4JYAJ 3K5NA 4V19K 1IJWC 1CJTB 2IT0A 1T08B 1KGSA 4HA8A 2JRMA 2GFFA 1QLNA 2F8MA 3ULHA 2XSJC 4CQ1A 4JI3F 4ECTA 1QGPA 2IP2A 5D0GA 5KFTA 1EB0A 4KYZA 5F9LA 5GAEU 2QSFX 4CO2A 3IG1B 1LWEB 2XHWA 4ZVGA 2B6AB 2L02A 1JLFA 2VV5A 1G1XA 2BOLA 8AT1B 3V7RA 5HNFA 3WTTC 2BE2A 3BGLA 1PP8F 2G1DA 4CYCB 2ASJA 4A3GJ 1QSYA 2EKNA 2CJBA 1U47A 3UCUP 3ELKA 3TO6A 2IXSA 4NLWA 1P4AA 4NRUA 3W5ZA 2E5GA 5CYJA 3V6DB 5K8OA 3CJ8A 2R5ZB 1XMAA 2OTJS 3TP3A 1K47A 4O4GB 2EFVA 4RW7A 3QRPA 2HHTA 1I1GA 2MGZA 1G4DA 1PAEX 2AZ1A 3BGUA 2H94A 5EHHA 1JJ2R 1FY7A 1ZRDA 3M8PA 3BR2A 4JP0A 3J7Z5 2W4CA 2XGPA 1AHDP 3ULQB 4NCGB 1ZLKA 2FE3A 5KG7A 2XGDA 1X5TA 2L48A 3M8PB 3UCZP 2XY5A 4EUVA 3MMBA 4OJGA 2RS8A 1RT4A 3IG1A 2NSCA 3WG9A 1RZMA 2V8PA 4X4VA 3PFYA 2XGEA 3QAHA 1MBHA 1O3TA 4R0JA 2NZCA 2ROPA 1UHWA 2LOOA 2IGNA 3V4IB 3K5PA 3MAQA 4WX9A 4F04B 2XMAA 2Z33A 1KTVA 4DN9A 1FBUA 4IFYA 1ZARA 2FZGB 4K0KJ 5KT3A 5H6RA 1U5TB 3OYEA 1DURA 5IYBJ 1QVGR 2ZFUA 4PGGA 4HNVA 3DU6A 4OI0A 1ZYQA 4HT5A 1RT5A 1RAIB 3F0NA 4I2QA 1CVJA 4M72A 4RDUA 3OYGA 3NGTA 3ZMVA 3M2VB 3K4LA 4X2BA 1CJKA 1Q95G 1XC9A 3CJ5A 5FGMA 4IH7A 4FPRA 1YK9A 3QSIA 4P75A 1ZHFA 5F64A 1V4RA 5DCMB 4PK4A 2VJVA 4KPYA 3ZXWA 5FLVA 3UO0A 1VQLI 4RWXA 2R8HA 4ECWA 4YR3A 4LF9F 2F9JA 1TAQA 5E1WA 3MTKA 2HS5A 5H9EK 3MEEB 1XTAA 1NUEA 5G0RB 3D67A 3T19A 4YDDB 1VQSA 3GX4X 5FIIA 4E7HA 1JKHA 3KDNA 3IRXA 4M6XA 4K2EA 4HHJA 3HTUA 2F4VF 1ETQA 3A0BC 1XR6A 3HFVA 5F04A 4Q7AA 3JAMZ 1IGNA 4AD9A 4WIQA 3ZRGA 3GONA 3TO8A 2R7RA 2CWKA 3I4NJ 2ZE2B 4C2TA 1HQUA 2MW8A 3AH6A 3M30A 1U8WA 4DR5F 1HQEA 2HLUA 5KG3A 1U7LA 2VQEJ 2BKOA 4XRSG 5EGOB 3I0TA 5FB2A 1VGYA 4UQGA 3HOZJ 2Y0SD 2ICWG 1YX3A 3FBFA 1C0TA 4NEZA 2DGXA 4KTQA 3O5TB 3CDIA 2C2NA 2D1VA 5JLWA 4OHZA 2O03A 2GO9A 2DH9A 2D69A 2MLGA 3DLGA 4IRGA 4IHTA 1D9AA 1RNLA 2KHDA 3MEDB 1SD6A 2P6TA 4KUMA 3ZOBA 2OC6A 1MMSA 3IRXB 4E8UA 4DR7F 4WFAQ 2TRTA 5DZ7A 1IBMF 5CVUA 3E5QA 2K40A 1UEKA 1YBAA 1G3OA 1ZLJA 2DOEA 1EZZB 4TU9A 4ECUA 5CYQB 4BAYA 4F4XA 1Y5NB 2KFNA 2DMTA 2JVHA 2D2WA 2HQFA 4KGVB 4A8YA 3OS1A 1RAFB 5KNLA 5GTIC 3HTSB 3RKXA 2H5JB 4DFJA 2HVZA 2VBXA 1UA1A 2YTCA 2CUZA 2OPPB 4QWDA 2Z2ZA 1NMEB 4LFCF 3KP7A 3HL2A 2MKJA 5KAKA 2F5VA 1STZA 2B9XA 1TNSA 5DGAA 3LSHA 2CFOA 1B8IB 2AMCB 2EPFA 4JBAA 4BE1A 5E3PA 1SL0A 1Z1ZA 3UPFA 3RB6A 1VK3A 1R43A 2ZHOA 1NK3P 3L3CA 3ESWB 3QGIA 3NGSA 2MY8A 3OS2A 1F5TA 4MO7A 1CQMA 2L01A 3NGRA 3C7JA 4C9DA 4KN4X 2ROEA 2EFNA 5IY5H 1UW4A 3WGIA 3IGVA 4A8QA 2M4MA 2E1PA 1X4HA 4B1RA 2J0SD 1YJTA 3DFEA 1SCJB 4WXWA 3DDIA 2CUJA 1VBKA 4CGZA 2YWKA 2W01A 1TL3B 2IDLA 2KP6A 3OYIA 2DPJA 3MEXA 1UAAA 4TLRA 3PNTA 1LJ9A 4CLTA 4TYBA 3NGDA 1CJKB 3BGFA 5J2PB 3JAMU 3CDUA 5D0EA 3X3UA 1I6XA 5D5UB 4ZDPA 4HF2A 1UAWA 4HAMA 2RDJA 2WADA 4A3CJ 4D1QA 4GKKF 1WH7A 3BR6A 4FS2A 4RAFA 2RMLA 1BI3A 2QYGA 1EIYB 3FXRA 3LWFA 2MKKA 3JSOA 2XO6A 3BT9A 2ISYA 4NWBA 4XRFA 3R1LA 1N36J 1ZM9A 2OPSA 1QNTA 4OX9J 2FQ3A 4UUXA 4DLEA 5L46A 5IZHA 5D6EA 1UTAA 9ATCB 4LQ9A 4IHXA 2CNLB 1FFWB 2BE5F 4IFVB 2GQCA 3UVJB 5D4OA 1NPPA 1QHGA 3JTNA 4F0HA 1JTYA 1EH6A 3H9JA 1WOOA 2CV1A 2CPDA 4F8RA 3IBWA 2UXNA 2BJ9A 3Q8VA 4UB8C 3U9GA 3HD1A 4PJ0C 3KXDA 1S7AA 1AZSB 3IUOA 1AKHB 1S6LA 4AQYF 1G6NA 3BB5A 1Q53A 4UZBA 2RKHA 1S9HA 2MSYA 2J7KA 4N5SA 2OO4A 1GVDA 2CPHA 3CCWA 2HPMA 1JUMA 1YZ7A 3S2WA 3TUZC 2K9LA 5CA5A 1I5ZA 2JT1A 2FOWA 4HACA 4ID5B 2E9RX 4QPQA 4PYAA 3K17A 1N32F 2ZWOA 2GOXB 2CQ4A 1OJ4A 2HMIB 2BOPA 1ZG3A 1YBTA 3J81Z 2MLXA 2Z9OA 1EQMA 1YQAA 3T8RA 4JX6A 3PL8A 1TKXB 2FGOA 4UNOA 1WG1A 2M8HA 5LJ3Y 3WHBA 3GQCA 4CO5A 4EZ9A 3LAPA 2NVQJ 3EVMA 2IGOA 2X6WA 4IJAA 2M8DB 2EI5A 3MKZA 5KOXA 3CC2I 4KGKA 2KU7A 1N5YA 4FBUA 3QNWB 2AYGA 3FDSA 5DDOC 1BC7C 5L1LA 5F8JA 3VYSB 2N3OA 1VI7A 4FX0A 4M9ZA 3C2BA 3I3LA 4GDFA 4L73A 3WU0A 3WG7H 4CDIA 4DPXA 1SC4B 3CD0A 3HG9A 9ANTA 1NZAA 3C2PA 4ZZLA 1VR6A 3U1NA 2HZCA 1WOPA 2V4JA 4HLXA 3TAMA 2FJBB 3HOSA 3VAKA 1DJ0A 4ECSA 1S49A 1HNXJ 3Q8YA 4NA2A 2Q8KA 1KU3A 3K1MA 5FKNA 3K1NA 2HS4A 4GRIA 3CUOA 2E9TA 3GF2A 4WYLA 4O23A 1Z21A 2MSSA 3P4UB 1HDPA 2QX0A 1H0HB 4I6AA 4NYOA 2BXZA 4X64F 3ZQLA 4WK8F 2M3DA 1RKJA 3O6QA 2DEIA 3O3LA 1E17A 4OMYA 3HDDA 4TU7A 1BR2A 3VFZA 2JOQA 1N5QA 1WACA 4PXDA 5HS8A 1CBKA 4LFBF 5D8KB 2EFWA 1RR7A 3LAKA 5L38A 4C8KA 2AGOA 3CD7A 4BBSJ 1N48A 3W7BA 1SFUA 4ZP7A 2MKYA 2HAIA 2AYMA 4R5PA 2XSFA 3H3UA 2ZKUA 1ON2A 1HR0J 1G4CA 2ILYA 1WHXA 3W2VB 1BIAA 3JSYA 3NWSA 1C0WA 3PDNA 2GA2A 5K7FA 1MN7A 4DV5J 3THTA 2MXYA 5F8NA 2DA7A 1T2KA 3BY6A 3R5BA 2KYXA 1KZHA 5BMZA 1JLFB 1J5EF 2LP4A 4OJ3A 1UCRA 1C4CA 2BMBA 1FIAA 1IRFA 1V9OA 1DPRA 4M71A 4ZHRB 1JGGA 3A8EA 5DTDA 1ZPVA 3PJWA 3G6YA 3ILIA 4CTAA 1TKZB 5J3LA 2CJKA 4L9VA 2HTJA 3DLLF 3KWMA 2XMKA 4XIUA 3K10A 3OBIA 1L3SA 3W3SA 1FNOA 2MQQA 1B72B 1QPIA 2Y0SA 2QC3A 1FJ7A 4OFZA 4X4PA 3ERED 2VFUA 4FF4A 1T3NA 4KIFA 3W2AA 1P27B 3K4CA 2MGZB 1RAGB 3P9KA 4CLPA 1U9OA 2WAQN 3IRRA 2J9EA 4B3XA 1CJUB 1T05A 2FB0A 3QQAA 3L1PA 2R7DA 4Z7YA 4WK3A 1D9FA 4WZMA 1JLCA 1IF1A 3BQ1A 5J1YA 4HKQA 4Q0BA 3W2WB 1SKWA 4RL1A 2CJYB 3T41A 2ZVSA 2QYCA 4IQMA 1ZAOA 3F72A 2RKIA 2AHQA 2IS4A 1YYVA 1LV5A 1F36A 1S10A 2I8EA 1BR4A 3TZWA 2PE8A 1ODDA 3G8SA 1PSDA 1TVRB 3CCVS 1MROB 3N6NA 4DPUA 3A03A 2B9SA 4BKXA 3NBPB 1IBLJ 3B6AA 1JT6A 4UVCA 1W0UA 1VC0A 2LBFB 4N9HA 3NCRA 4OI6A 3K57A 3Q5FA 5D15A 4LR8A 2VG7A 1OJLA 5EZHA 3R1HA 4R5PB 1F5CA 2YUSA 4OHWA 2HRUA 4B9TA 3SEQA 5EZGA 1TR0A 3D0HE 1VQKS 5IM0A 5MAOA 2DT5A 5D4SA 2DA3A 4Y6IA 4JOUA 4ASNA 4IO9F 3MEDA 4CO0A 1XNQF 2KG1A 4MK9A 4XOPA 2XTJP 4UY8I 2IFXA 5B0FA 4BJ6C 1NJIT 3CMMA 2J9CA 1UFKA 1CJVB 4ZIWA 2JWNA 1SKSA 2OPQA 3EYYA 5HATA 1R49A 1FDBA 5L39A 4CTAB 2DTRA 5BJRA 2WZ1A 1NLKL 5DM6Q 3LF0A 3O2PE 3GYNA 4WTYA 2CVIA 4ZJZA 4F7VA 1OSCA 1M0SA 2EV6A 2C2MB 2Y1RI 1IN6A 4X4UA 1Q5VA 4CLWA 3S2HJ 3VZHA 3TVYA 3PM9A 2VQCA 3OTOJ 2OJ3A 5AXNA 1OCOH 1Q4RA 3I54A 2RU9A 1X31C 3ENAA 1FE0A 1WJDA 2H1YA 1NK0A 4OZ3A 1A35A 3KLHA 1KBRA 1FRMA 4U7DA 2WC2A 2LVWA 4DSKA 1S1TB 4I7FA 1NK9A 2ZH7A 4GXOA 2VT3A 2EC2A 2AJQA 1X8DA 3FHNA 4C8YA 3D66A 5KFAA 1GTHA 2K9MA 4LF7J 4XAKA 1FWLA 3OYLA 2VIHA 1R0AA 2LC2A 1H38A 1RTDA 3US5A 3BSCA 3C8YA 4MYTA 4HACB 3CCQI 2AHOB 3BREA 1NHKL 2HOEA 3J7A1 2N8GA 3S7RA 2PN6A 2DR5A 4DR5J 1QAXA 4IO1A 2IGMA 4ON0A 1IJEB 2K06A 4ECRA 5CYMA 4CH7A 5HK4A 2F40A 3C16B 4EJOA 3HHEA 4A8KA 1IUJA 5KG0A 4I2PA 5IT9U 2F5DA 4B3SJ 4FTHA 1RTHA 4CICA 1YS7A 2B8PA 5KFUA 4C30A 1J5YA 5DV5A 3CDBA 1FDAA 2XMVA 2XNRA 1H8AC 4CO4A 1KP6A 4ZN3A 1YIOA 3QQCD 4IRKA 5LSLA 2ZNZA 4FCYA 2YX7A 4DBQA 2EPIA 2VKRA 4DV4J 5EEAA 1OMSA 2B4OA 1RAJA 2A6HF 4NMLA 1LXJA 2FY8A 2DFHA 2V7FA 2IYIA 4CXFA 4C2UA 3C14B 1MG7A 4ZOSA 1YHQS 3LTOA 4JQFA 3I82A 1TNTA 4CYUA 4Y3CA 2DNMA 3K5MA 3BEGB 1TQPA 2VXZA 1FRJA 1HA8A 4DHVA 1XC5A 3PIOF 4NZ0A 4OX8A 4B9LA 1WEXA 2QO3A 2HK3A 4C9YA 2JQ7A 3LQQA 5C24B 1WSUA 5F0FA 3MMYB 2XS2A 1NPKA 2L4MA 5ETNA 1DTQB 5F8GA 4IRDA 4DZJA 3JTPA 3MEEA 2VH7A 2JJ4D 4BNCA 3AFHA 1XERA 1Z3YA 1RKWA 1QSSA 3OJSA 5ETKA 4ERDA 3L9FA 4BLGA 1UCNA 4ZVTB 1Y10A 4EK2A 2B6AA 3T5JA 1RESA 2CPZA 2EFGA 1T3OA 1SH0A 3TP0A 3N6MA 2MHEA 2VN2A 3MMJA 3HJVA 4J00A 4D7NA 4YIIA 3IWZA 1RT5B 1SL1A 1HNWF 4UY8T 4CYUB 3T5HA 4UUSB 3G96A 4MTEA 3EETA 2MLYA 2VONA 2LK2A 2BBYA 2JWTA 5DRKA 5E7OB 3PW7A 3TZYA 2ADBA 2LKPA 1NJYA 4UOCA 4DCJB 4J7CA 1B64A 1Z3XA 3NGUA 1QHHD 3THPA 3D6MB 1KU7A 4DS5A 1SQFA 3BV8A 4XK4A 2MSTA 1JMTA 4FT8A 1X3ZB 1X4PA 2DH8A 1KQ0A 4F4ZA 2NOGA 4TQSA 4B47A 4NLVA 3KEQA 3PJ9A 2FJEB 3GJSB 2YKPA 3IBFB 4ZLPA 4N41A 1CULB 2C3OA 1DAXA 4FP9A 4C2MA 4KT0C 4AWXB 2A3JA 4YN3B 4ID5A 5J2MB 3FQLA 2E2HJ 1RABB 1F0XA 3MM8B 1ON1A 3ZFVA 2OH2A 3AB4B 4USTA 2HS3A 4YMEA 2ELJA 5LGNA 4JBCA 2MTLA 1Y39A 3BPVA 2XLKA 1VS3A 5KFWA 4C3IJ 4BXFA 3CVKA 1SBRA 2LH9A 1FBSA 4BHBA 4IZZA 1HD0A 1T38A 4ZKAA 4LBPA 3GYXB 4E7KA 4BHCA 3S3OA 4BY1J 2CVEA 1WCMJ 2HFZA 4HI2A 2R7OA 4ZIVA 1UJ5A 5DO2A 4LQ3A 2EC0A 3SEZA 5E8IA 1S48A 4Q47A 2Z16A 5AIPA 3FEZA 3Q0VA 1X0FA 2VJ4A 4UOFA 3QODA 1B0VA 2WVBA 4IOBA 3DI6A 4HI1A 1J2VA 1WH5A 1EETA 4CLKA 2KIFA 2CPFA 3ZMTA 4ITSA 1VQ4I 3HKWA 2KQRA 5HS7A 4B3AA 4DL3A 3HHDA 3BR8A 2JSPA 2B4VA 2ZKTA 2EEYA 2AQ4A 2JSXA 3ZXSA 3RU0A 2P9CA 2RAQA 1LEBA 4ZJLA 3CF5Q 2DA2A 2D5VA 3HZEA 1E3PA 2BQ3A 2FUG9 4NXNJ 3RAMA 1RT6A 3M4OJ 1OQ6A 3BG9A 1T98A 4Y17A 2V94A 4R8UA 2W2OP 2OPRB 2V8DA 2QL5B 2LDUA 2HBQB 2Q0OA 1YJ9I 3E51A 4P1WA 5IXUA 2XGXA 4P96A 3RKYA 2LLZA 5HO4A 3OTBA 5DJBA 5GMEA 1NH8A 1U5TC 4X65F 3VSKA 4IKAA 1WC4A 3ISND 2MC4A 4KO0A 4E70A 2YPZA 3NBPA 4L9JA 3I56S 1RI7A 3CF2A 1W1WE 2VJIA 5HOOA 2H65B 1NO8A 5K14A 3ZTPA 3F73A 3U1MA 2OMLA 2I5JB 3AOCA 2IS1A 4ZVRB 1FXLA 1HHQA 3EJMA 4USIA 3JRBA 2CDRB 3OY9A 1T8IA 1XR7A 2MA3A 4J9VA 1RQ0A 3I5AA 1D5VA 3QYFA 1F2GA 3OS0A 3I59B 3BBCA 1TV6A 3PIPF 4MIMA 1Y00A 1K61A 1BLUA 1PUFA 2RN7A 3W65A 2GC8A 3RUBL 4PG6A 4DR3J 1MJAA 4IYQA 3D28A 3SCKE 1XB4A 3QWLA 4FE4A 3CJSA 3W62A 1WC1A 5ETRA 5KFDA 3H5SA 4WIIA 1KYZA 3FXLA 4DEZA 4KICA 3WBZA 4WWSA 3RRGA 3GLJA 1XG1A 3GSIA 4BC7A 3RYPA 2WOMA 3OD2A 5B0BA 3MEKA 2DMUA 3D7SB 5F0CA 2EZHA 2EWNA 4NEYA 2DW4A 3E1SA 2YNHB 1RHQB 5E41A 4MNUA 2XASA 2B5JB 1SAXA 3ZZYA 3E2EA 4M6VA 1FOYA 4N8NA 3ZQHA 4BEHB 4BXXJ 1V5VA 2GVZA 1QAYA 4NL5A 4CYDA 2W1BA 1B4AA 3REOA 5HVQC 4Z6YA 4H4KA 3QIDA 3CESA 4GFBA 4JV5J 1SH3A 1OQ3A 1CF7A 1NK7A 5D5XB 2ZBPA 3H5UA 3E01A 3PO2J 2LF8A 2CZ9A 4XONA 1G3TA 1YE9A 3SI8A 2E2IJ 4OZLA 2GHWA 3Q9SA 3G82B 4RAGA 4LFAJ 1NK8A 3CT9A 1R89A 1FNXH 1SI9A 2K4JA 3P49B 3IP0A 3AG4H 1G8XA 1LFWA 4H4MA 3TMOA 3LA3A 2IBDA 2GIZA 3KKFA 4F3MA 3JR9A 3CJRA 4RW8A 4RPFA 2LDYA 3CCEI 3M7VA 4DFKA 4YY3F 1OYDA 3DNCA 4U7UK 1YZ6A 1LEOA 2BW7A 3M2VA 5GAEJ 3HM5A 4ED3A 2VFTA 4BL0B 3DRRA 2VKDA 3RJMB 2MZTA 1J59A 2X51A 3IM9A 2GMHA 3KHLA 3S1NJ 1K0TA 2Y9YA 1M1GA 4A3BJ 3I56I 4WTOB 2PX9A 2CW8A 4CA0A 5KFNA 4OI4A 1LUJB 3MM5A 2HDWA 2BHYA 2D3UA 1XMXA 3DP7A 1WHYA 2F6CA 3TW6A 4ZP8A 1MU2A 1BJAA 1FRKA 3QRFF 4GYIA 1HW8A 4EEFG 3QLHA 2EA4A 2B43A 3AHPA 4OYMA 4RW6A 1G3WA 4WFNQ 3CZ6A 3C15B 4YOEA 4ID8A 5IV3A 4Q8FA 1QTMA 4HDUA 3BQZA 5LOQA 4JI1F 4Q43A 4A5MA 1VDHA 1HNZJ 2ZUGA 3R3TA 5LL6d 1L3KA 1RTZA 3J81K 4ZVQB 5K14B 3MR6A 1TW3A 1XMOJ 3HVAA 4CSWA 4CWBA 2DHAA 2XWXA 3HKZD 2K3PA 3UNGC 3M8ZA 2WSCC 1IN8A 1S1TA 1NK5A 1PKUA 2CW7A 1QDUB 3H36A 5LBQA 2A10A 2GMJA 3JRIA 2PMZA 3VODA 2VIXA 1LDKB 1M1HA 1TP7A 4G8XA 3KP3A 1HBUB 2DI3A 2G0IA 2FHOB 2HURA 2Z4PA 1OISA 1B70B 2ZITA 4L74A 2XRNA 5CH7B 5F0UA 4OZNA 2LEPA 2KHCA 3SQGA 1Y5IB 4TQRA 4MIAA 3TAQA 5FLMJ 1YBUA 2Q2EB 3ROUA 1FWKA 5CVRA 3CO0P 2D9PA 2HWTA 2FNPA 1H9TA 2FUG2 4DL5A 1S0OA 1B1BA 4LIWA 2DB1A 1Z1DA 3DLHA 3KLEA 3BQYA 2RGVA 4IKFA 1IKXB 1RBOB 3D0GE 2GV1A 3A3PB 2ID3A 3UDLA 4WYWA 4C8MA 2ZC4A 5IM0B 4AIKA 4O3NA 2XV4S 2K8GA 4G1QB 1SVDA 2W8LA 1S1UB 3MM9B 4ECQA 3EUNA 3UKGA 1Q1HA 4ZYGA 3VGTA 2RC4A 2OMOA 1Q8BA 5ETVA 4DV5F 3MCOA 1K1SA 1S9FA 2CGPA 2UUAJ 4F4WA 2EIJH 3JXOA 2ATLA 3TARA 2HZTA 1D3YA 3M1VB 2QA4S 4U8VA 3VAFA 4HX4A 2DT7B 2ZDOA 4K4SA 2Y1LB 1FXDA 1D0ZA 3C14A 2X1CA 2UZKA 1F6TA 1EX8A 3OPKA 4FXVA 4KH0B 4R1HA 3P45B 3HSEA 4LR9A 1FA0A 1RWWB 2RKIB 5L9NA 4UV9A 2E5JA 5FD1A 1HLWA 4ANDA 1HQUB 1FJLA 5LEJA 2BYCA 3KLHB 2DQRA 3O2IA 2RE1A 2W4PA 3SSQA 3T6JA 5JI6A 3D3CJ 4IG0B 3F8NA 5AJ3J 1GT0C 2QA4I 1SFOJ 1DQUA 1OY6A 1HBMB 2XEXA 2HNZB 4B02A 2MQPA 5ERIA 4KRWA 2E1OA 2V69A 3OR2C 4RZRA 5GPAA 1S29A 4DUTA 3MDFA 2N4CA 3DM2B 3JCUC 1V3FA 3IP4B 2EXUA 4NYZA 4WFZA 5LJ5Y 1EAYC 1FDDA 2QQ9A 5EDWA 4FE7A 4DR3F 5I3QA 1X4AA 4Y33A 3CUQB 5T7LB 4XDDA 4DQRA 5JMNA 1TKZA 5HJXA 2DY1A 2Q6BA 1CJVA 2MKHA 1U0HA 1U3EM 5L1JA 3S2DJ 2QF7A 3DOMB 3BTJA 4BHQA 4OI2A 1FKPA 4MIBA 1XSDA 3CP2A 2ZSIB 3I0SA 2D74B 1XNRF 5KAFC 2V6AA 2RH3A 1SUQB 4ECXA 2ESNA 1JLEA 2FBKA 2CJAA 5IQQA 1D8KA 1PJRA 2GOMA 5IC4B 2DYRH 4F4KA 1JNZB 3EMTA 4EJUA 3KK2B 5F08A 2IS6A 2G9WA 5CHCB 1LFPA 1U0JA 1ZREA 1JJHA 2PGCA 2ZH2A 1V3SA 1YW8A 4FETA 5FD6A 3K9TA 4M5GA 5F27A 1H88C 2JJ7A 2IRFG 3QAEA 1D8JA 2JFKA 2OFGX 2P5KA 2J0WA 1WFXA 4K4TA 1I6JA 4QCLA 3EPIA 5I3UA 4M3FA 3GIRA 4FVCA 2DCLA 1LKZA 3NMRA 1JIHA 2MKSA 1RWXB 1SMYF 3KPHA 2MD0A 4RW7B 2W9AA 3AQOA 5CYQA 1LOUA 3DLBA 2UXBJ 3CIZA 2QGFB 4DIQA 5DGBA 4USWA 3IO1A 2ZH4A 4KGXB 1TLHB 2I6WA 5GMKa 2W7PA 1VIOA 3WTVC 3HULA 3E6BA 1WSRA 1HBMA 2EB7A 2IAJB 3VCDA 3GP9A 3GB0A 3JRGA 1K7AA 2XSJA 2E44A 2ZH1A 1I6HJ 3R5JB 4LUBA 1NSAA 3EZ5A 2CPIA 2GGPB 1RETA 4DV4F 1KHWA 4XSZF 5GPCA 2XY7A 1C1CB 1R4NB 1FD2A 3MPDA 3C6TA 3Q2TC 2EWHA 1ORKA 2OF7A 1R8CA 1BD6A 3CEDA 3VTIA 4XSXF 1BM9A 2EA2A 3RKQA 2Z30B 3OL3A 3KJFB 4L76A 1HHTP 1OSDA 1HNVB 3R5CA 3CJKB 4IG3A 3WTZA 3NOGA 3KEOA 4NB5A 4JI1J 2H9ZA 5LD2C 3DBLB 2CJXB 2PG4A 3DFGA 2KJCA 1JI8A 2A6MA 4DZ6A 2E7VA 4PWDB 1FWPA 5ETLA 1B3TA 2ZOMA 3J7YJ 1HMVA 1Q8IA 4MKAA 1Y4ZB 5FROA 4WE1A 3QRQA 5DQHA 1B0TA 4M9XA 5L1KA 2MQNA 3E01B 1WDDA 1U6ZA 4EMSA 2KIUA 2AJ4A 1DP7P 2VFVA 1ZGAA 2DHGA 1K9MT 1N6QB 2MJNA 1WI9A 3BJ6A 3F8FA 3C66A 4PFPA 2YWWA 4I4BA 2LF7A 3MECB 5IV4A 3DOKA 3LP2B 3ONQA 1WJCA 2XCAA 1X4CA 1WRJA 4USKA 4ZITA 2KO1A 4X66J 3MF5A 2IPOB 3SFUA 4ANJA 1T6SA 1FCAA 3MUTP 4JV1A 1PJ7A 1MMNA 3PX4A 2DBBA 2PA8D 4DQIA 1HNWJ 1VQKI 2OZ6A 2HVQA 3SQGB 4I2QB 2PQ8A 1FRLA 3UR0A 4ZCMA 3TQNA 5GAHI 2MQ8A 5U47A 2VPYB 5ICEA 1F9EB 1U2WA 1ACIA 4D7MA 3T0YA 2NUUG 3OUYA 3EGNA 2NZ4A 5K9FA 4P55A 5JFRA 1GXLA 2KXNB 2L2OA 3SHFA 2LVSA 3CCVI 1SL2A 3OR2B 2W7NA 3TKYA 1JLBB 3OIOA 3PKYA 1BXNA 3N01A 1Z91A 3K4NA 3M1CA 3MKWB 3CJTA 1KC8T 2UVRA 2UUAF 4Y2MA 4OLOA 3TW0A 1NEEA 1BI0A 2K02A 2NQPA 2IJLA 4B9MA 5E2QA 1RLDA 1SEUA 2C2RA 3Q8UA 1UMQA 2CFXA 3CDEA 4JYKA 1NH3A 3H4BA 2AEFA 3PKMA 2JFDA 2HYIB 1VQ6I 2RRNA 4OZ5A 4Y2IA 4R8HA 3AAFA 1GXUA 1QTNB 5JHFA 3TQ1A 4J9NA 5FDLB 4JI6J 4WFYA 3WGGA 1IBKF 3CCRI 1HWKA 1BA5A 1SB6A 2QSHX 4MFEA 4A93J 1JLAB 4CM0A 3PO4A 1ZGJA 3O44A 1HW1A 3IC1A 1FHTA 3FRZA 1X1BA 1FMWA 1J0RA 3SSRA 1SAUA 3ZNUA 4EO8A 4BU2A 1JXEA 4EATA 3OYKA 3DRRB 2RV8A 2O6GE 3FUYA 3GR0A 2GMLA 2O0YA 4EO6A 1XGNA 1VLOA 4MHGA 3M6VA 4Q45A 1R71A 3AB2B 1M5OC 2FXAA 2XUBA 3ZZTA 3SYTA 2M2EA 3OL8A 2MABA 2P0WA 4FZVA 2W82A 4AVZA 1HOMA 2B9YA 2ZOFA 1FYMA 2XLIA 4K50A 1RT1A 1ZS6A 1RCOB 2ZBCA 2DA6A 2CQXA 3CJNA 1E6VA 4ZVFA 3M1EA 3LFUA 3K70C 1WZ2A 4FF1A 2LQ5A 2DNPA 2LRDA 4Q4ZF 4NXNF 3KLEB 4U95A 4OIPF 2R8GA 3EYZA 4Y15A 1M5PC 1TL8A 2FVQA 1RWOB 3TW7A 1SJ3P 4X4NA 1AKHA 3K5OA 5DG9A 5J40A 3HVTA 3BZKA 1VQOS 2LD5A 2EFOA 1QE1A 4DG1B 4ZLLA 4U8YA 4ZCLA 2XM3A 3LL7A 1S99A 3J80Y 3TA2A 4HSRA 3BG7A 1NG7A 3FXJA 3IRQA 1REVA 1WJAA 4RW9A 4DV7F 4B9VA 2ADCA 3T1YF 4I68A 4QYRA 4DR6J 4O3PA 1L3LA 3KP6A 1VQMI 3T8TA 2DIUA 5LRRA 5ETTA 4B4CA 1J5EJ 1TK5A 2BZ2A 2CQ7A 3VHQA 4FN5A 3Q9VA 2CQQA 2FQ4A 4EM1A 5F6FA 1UVMA 3PFIA 1N4LA 2IC3B 2IBKA 1TC3C 2DHXA 2QCOA 1W4MA 3V4IA 2R2RA 4UUWA 5A6PA 4EYIB 1S1VA 1QZEA 2BJDA 4OYIA 4PDKA 1TVRA 4P5OA 1SUQA 2CNOB 1KR4A 1KTQA 1SIWB 4WXCA 1KFDA 3E3XA 1TFWA 2OEKA 3SIPB 8RUCA 2IA2A 1N8RT 4NHJA 3GFYA 4MFBB 4A2UA 5J2QA 3HOWJ 1QE1B 5A2QY 1R5GA 1TWAJ 3DPUA 4DQQA 3OT9A 2UUWA 2D45A 3BDEA 4YB1P 5FKMA 3QP5A 1Q1VA 2NLWA 4LLGF 5BYQA 2KT0A 2OPQB 1IC8A 3GXOA 4BXUA 4WE1B 3QT6A 4BH9A 4KJIA 2GBYA 2MDAA 5E18F 4NCAA 1QVUA 4C3MA 2PIIA 2D3ZA 2EZKA 4DUZJ 1SD7A 1ZH5A 3QFHA 4K4UA 2F5CA 4CNYA 4UUSA 5B0EA 3AJDA 3R2DJ 2V63A 1ETXA 4TKTA 3GU0A 2LY2A 1TQIA 2J5OA 4QIGA 4LFUA 2DNZA 5GAHJ 4DR2J 4Q2LA 2PSZA 2YNIA 4D3GA 2EG1A 3EDQB 2FOKA 4ZP9A 1BOAA 4NA3A 3DHXA 4K4WA 1FKOA 4UVBA 3ITHA 2KM8C 1FOXA 3DRXA 2O1PA 4TY8A 2QM3A 1LW2A 2PJRB 4F93B 1F1BB 5KFKA 4Q0BB 3FMBA 1S1XA 3MR5A 1BI1A 4XR6A 2K3FA 2Y9ZA 3CCJI 2BGCA 1BR1A 3H59A 1U6GA 3PSIA 2A68F 2W24A 2NR0A 1VI0A 2Y30A 4WU3A 4A48A 4ZJOA 3W63A 2DTZA 3JRHA 1LW0A 3U1DA 5JVHQ 2YX1A 3P5JA 3O8HA 4ZCIA 1OYIA 1YI2I 1RLCL 4XRSA 1HI8A 3QT5A 5B0AA 1USTA 1HNVA 4ED0A 3MXHP 1A04A 3CJQA 2FY1A 3IXQA 1MD0A 1G6BA 4CLLA 4ZVOB 4NOHA 3G71I 1YRXA 2Y31A 1DARA 3CDWA 4YB6A 1KHVA 1P1LA 1YQHA 2E1RA 3H4DA 1SC6A 2R3VA 3EUHA 1K6YA 1YHQI 5A2QZ 4FYXB 1EH8A 1T95A 3J7AY 3BR9A 1ETKA 4LFCJ 3ELHA 3HSJA 3UD3P 4J19A 2QN6B 1R5ID 3H3VK 2I9SA 2OQGA 2EINH 3RDIA 4A0YA 2FHMA 1WF0A 2CQKA 4EQQA 1GLNA 1Q8LA 4G94A 5C3EJ 1RBAA 4LG3A 4N9IA 3G6XA 1WC0A 3TDZC 2FC8A 2LU2A 1Y9OA 1AOYA 4E2FB 5HVGA 1ZTRA 2QSGX 2VC0A 4KHRA 2E34A 2KRRA 4FF2A 3TOQA 4X0GA 1WOSA 2JEFA 5FLXZ 3VDXA 1U0HB 1DRZA 3FKBA 2KLOA 1TKXA 3S14J 1O57A 2E5ZA 3S3MA 2YWHA 3G1OA 2XAUA 1D3WA 3HO1A 2XPUA 1B9NA 2WVDA 3RYRA 1Q7YT 2PFDA 2HQAA 1UL3A 1CC7A 3D54A 1LFBA 4TY9A 3Q22A 1HQCA 1PGZA 5SUHA 3OHAA 5DETA 1T56A 3FM5A 2OI2A 4OL8A 3NG8A 2R7UA 1L3UA 3CMQA 3G1LA 1BI2A 2GIFA 2DN0A 4Y13A 3CC7S 3L2RA 4BDZA 3OSNA 2LEBA 2Y8WA 5IT9K 2OEJA 4G6QA 5AONA 2CQDA 5LMUJ 2OKQA 1H7WA 2OPSB 3GFIA 2IRUA 2R7TA 2UUBF 1HA1A 4CLFA 1HIYA 5L3GA 1VJQA 3QZ7A 2G7HA 3ICLA 4IFYB 3DBRB 1O3SA 2OV7A 4HG2A 5LGTA 5KTQA 2X85A 5KFRA 2P2CB 1R1TA 4O0IA 3HRSA 4RBVA 1G2EA 2HBZB 2YNHA 3JRAA 3TUJC 1NHAA 7AT1B 3MCSA 2R2TA 5BS6A 3FFIB 1WJ9A 2BKNA 2BRKA 1JLQA 4F26A 4O4RA 5J1EB 3QO9A 2XCPA 1RT6B 4RNOA 2C1EB 1CJUA 1YWXA 2ABYA 4AM3A 1SQEA 3MEGB 2OIHA 5KK1A 1PC5A 2V9PA 4CHUA 3RB0A 2VL8A 3EYIA 5HDNA 2EG2A 4M95A 4Y52J 4JX5A 1OLTA 4DV3J 1TV6B 2UU9F 1M90T 2HHUA 5GAHU 2WBMA 4DPWA 4NUBA 1S6QA 4DLGA 3IA0A 1JXSA 1DQ8A 1XMBA 1VIXA 1IUYA 3O3KA 3H9QA 2IAIA 2IPQX 1OFCX 4F4YA 4WCEQ 4R79A 1BHNA 3GG1A 3DC2A 2WONB 5GVQA 4MQ9F 4CCNA 1U2CA 2UVUA 5TJJA 1S7HA 3PCOB 4KHMA 4QIFA 1FKOB 1H2TZ 4MLOA 5EGOA 3RB3A 2XGCA 1TT5B 2DTJA 4DFPA 4CNZA 3M05A 1BUXA 1HKSA 1PJ5A 5KFOA 2ILZA 3RR7A 1S7EA 4LIRA 2OLWA 3ZQIA 4ETSA 1CJTA 2GO8A 2V34A 5F3TA 3OXFA 4GC6A 3A01A 5H9FK 1MWYA 2LNBA 2FX0A 2X4HA 4U9RA 3ABLH 2H54B 4KB7A 2L0KA 4V19X 1B8IA 2ZH6A 4DR1J 2IAJA 1U48A 1VF9A 2W9CB 3JTHA 3A1YA 4WP3A 2CIMA 3S01A 5BYSA 1FF2A 2F5FA 5D8HB 1IKYB 2YPRA 4AYBN 2A2DA 1JLGA 3M8QB 4LGWA 3ZMUA 2AXLA 5HMZA 2R2UA 3ML6A 2DOFA 1BW6A 4ELVA 5KAIC 4X4QA 2UUTA 1IBCB 1WHUA 3PXGa 2CMPA 1XS9A 3WIUA 2O67A 2AX1A 5DDPC 3C15A 3Q89A 2DY9A 2MB0B 4P2FA 1A0OB 2CS3A 4ZHRA 4DUYJ 1N52B 2XHKA 1USSA 3RZDJ 3SEOA 1U0SA 3JYTB 4BBRJ 4HQMA 2W2NP 3NOCA 2V1DA 5C4XJ 3WDOA 2R93J 5D8LB 4L5IA 2B9EA 5E33A 2X1BA 1N33F 4OIOF 4URGA 3M8RA 5M3MJ 1S3JA 3R7BB 2QENA 2YR2A 2HTSA 3LO3A 4C98A 2PJPA 2RNJA 3CO7C 1LK5A 4AIDA 2YY3A 4ZLJA 2LQJA 2B0LA 3PQJA 3KJVA 4PXEA 2AWZA 3MOJB 2C6YA 5KFJA 5LLQA 3FZ2A 2P7VB 1BY9A 3PIPQ 1FJEB 5M5XJ 1NBEB 2KTQA 1P9QC 2LCWA 3QMQA 3CWJA 4IDKB 4F50A 1VQPS 3FHZA 1U02A 3PACA 2W4DA 3H98A 1VRTB 4BBYA 1AUDA 3BCAA 1HNIA 3BZCA 2R7XA 4HVZA 4RKUC 2PT0A 4AXJA 5GMDA 3BR1A 3I5UA 1RWPB 2L7ZA 2YH0A 3ISZA 4A6EA 1HMVB 1H73A 2GAHC 3T1HJ 1V5EA 1IKWB 8ATCB 5EWEA 2R7FA 3JSMB 3JQKA 3A13A 2HVHA 4EYHB 2EBGA 1WEZA 4OQJA 2XAQA 3SDEA 3OVAA 4PAAA 3GVAA 2JN6A 3K7AJ 3BPDA 5HSPA 3PW5A 2CH0A 4TV7A 5K8MA 3ETMA 3DLAA 2V50A 5JJBA 2QG9B 1RGVA 3KX2A 1PJ6A 3CCLS 5H6QA 3M6WA 4ZYAA 3R6GB 5M2UA 5K7ZA 2O66A 1FKAF 3J80K 1AA7A 1ZR2A 3AG2H 2F4FA 2AU0A 2HZAA 4PYDA 3B6CA 1P1TA 4FF3A 4KR0B 5KFCA 2VBZA 5D3GA 2Y1JA 4DCPB 1UP1A 4P9SA 3MQ0A 3TR5A 2M9HA 2LSOA 4OJ1A 3VAMA 4X4OA 2Z99A 3I5CA 2BABA 2M52A 3SCLE 2L54A 2H4YB 2C42A 1R9TJ 4Y28C 3SDBA 5KFFA 3OR1B 3KZYA 3VOEA 4UTGA 2BKPA 3GJQB 1F60B 3RB4A 3I96A 3LOCA 3GBGA 3PYFA 1E6YB 1GAOA 3TP2A 3LQRA 4RAZA 4RR5A 5J1RA 5D5WB 3VEPA 2CUEA 1ZTTA 3ECOA 2E5IA 3H5YA 4HZFA 3AJ1A 1RTDB 3KZIC 1WVRA 2DFIA 3E0JB 2C3MA 3L7WA 4KPCA 1SFEA 1K8AT 1N6QA 4WBFA 2V8HA 2YQ1A 4TVAB 2ISZA 1RUSA 5D77A 1KEKA 4JP8A 2STTA 1VBYA 2K3KA 4G65A 2RF2B 3WHCA 1GT8A 4G3IA 1VBZA 4ZDNA 2F7VA 1WI3A 3IAM2 2CPEA 3NARA 1WF2A 2RQKA 1H74A 5K1YA 1FFSB 1RSCA 3U1LA 2L4AA 3GLXA 1Y56A 5IOYA 3SDEB 1ZA2B 3W5XA 3TI0A 4LT6A 2YVSA 3LA2A 4G7OF 3M32A 4N4NB 1O0PA 2QT7A 2BQUA 3I59A 2XB5A 4AXIA 4J9SA 3PYDA 3GWZA 4PABA 4YR2A 4DG1A 5KT7A 1T0TV 2JUGA 2BM0A 2NRAC 1VYAA 3D6TB 5T7LA 1R0BG 3QYEA 3OYDA 1VRTA 1TU0B 3VVUA 2F1FA 3VZIA 3N79A 4HEA9 4L18B 4X66F 1R0AB 1URNA 4XTTA 3VPRA 1LQ9A 4IOAQ 3I4MJ 3AOBA 1JX4A 1T02A 4O3RA 3R5GA 5ETOA 1YJNI 1X4OA 5E3LA 1Y1VJ 2GXAA 3V2UC 5E3MA 1DTTB 5C24A 1IKWA 3QJPA 1WUUA 1DU0A 2IM1A 2PFFB 4ZYHA 2OZUA 4RBUA 3L95X 4OHYA 3BGRA 1X3UA 1MSFC 3CCSI 3OR1A 1X9SA 3MM6A 4DDFA 2P8TA 1RTJB 1AZSA 4CCJA 1VTNC 4RM2A 2V2VA 1Q0NA 2KHMA 3BYRA 2GIQA 4M1KA 3OOUA 1KQKA 3KE2A 2KRHA 4DU8A 3ILJA 3SQOP 4K8RA 1TL4A 2RQPA 1PILA 1FP1D 5HODA 2JA6J 1REVB 5D5VB 4EMDA 4M74A 1WDTA 1F3VA 5KT5A 1MMAA 2HI3A 5BOXA 3DOMA 2DISA 3CMES 1X4DA 4CP5A 2WSEC 5ICGA 2J6TA 2GGPA 1N5SA 2VUGA 1TKTB 1T33A 1TQLA 2YNFA 3W9HA 4E7SA 4UOHA 1NSPA 1RR8C 2V0NA 4USVA 1ZZFA 4M3DA 1UG2A 1X2MA 2XYHB 2ECCA 1OCTC 5BPDA 2DMQA 4LF8J 2DOAA 3MAAB 5B1AH 4YFXF 4DV1J 3C1DA 4M73A 2XDVA 4I2PB 2J5AA 1YX5A 3LP1B 4YHHF 3JSMA 2KISA 4B9SA 3MEGA 1VRUB 2DR9A 4LVOP 1UWAA 2K9SA 1KSPA 2R5YA 4F36A 2E1MC 4HF0A 4AL5A 3QO9B 1NK4A 1DPUA 2DK2A 3HPOA 4DV2J 3AD7C 1GH8A 5K5RA 3JRFA 4IVNA 3HHLC 3D5RC 3OV8A 1RACB 2ZKZA 5TISC 4NLYA 2H3EB 1HCRA 3KK3B 4NASA 2HBYB 1XWLA 2BYVE 4DV0J 1VOMA 3WTYC 5F3ZA 1QVTA 3CDLA 1U6FA 1YS6A 2CAJA 2GAGC 4KC5A 4M5MA 4HBLA 2ZE2A 4ZVEA 3M2RA 1CS4A 3K5LA 1TK0A 2FHKA 3MFKA 2LBFA 2AEMA 1VC6A 1XQIA 2X1DA 4FNIA 2JPBA 4Z2XA 3LNQA 2ACYA 4II3A 3FXUA 1CS4B 4J9KA 1EKSA 3QFWA 2EBEA 2Z58B 2HNDB 3MKYB 4M3EA 1S0VA 4Y2CA 5HQMA 1DY3A 5IT4A 5GAGU 1YDLA 4GYGA 2CV2A 2GVDB 4RU2A 1XGMA 4QPOA 4YR0A 5HP1B 2I5UA 3Q83A 2YH1A 3KNAA 3GWCA 2ZFWA 5H9EJ 3KYLA 4IQ4A 2UZAA 2U2FA 1Y0NA 3H90A 1S57A 1TUWA 3MFHA 4NC6A 3DGPA 2DNHA 4DV7J 3DN9A 2VL1A 2PLYA 3WZ0A 2NS7A 5KFXA 3KYDB 4P2MA 2HR3A 4PSWA 4A12A 1HHSA 2XULA 3H0DA 3H40A 2C28A 1OCPA 2DXDA 2YU9J 3H5XA 4M5JA 1E6VB 1K79A 2FLPA 1RJJA 2XF6A 4CYCA 1YFHA 1RWKB 3HGGA 5BPIA 2PD1A 1S1VB 4S0HB 3CNQP 3ENQA 2QKMB 2BVMA 3HHHA 1G3SA 5K8NA 2ZHBA 2K2PA 4H4KC 5J1EA 3R7SB 2OUMA 2DXFA 1VC5A 1DFDA 2HGMA 4ZJQA 2MJUA 5GTHC 2B8QA 3TA0A 5A8WA 4X1EA 4IRIA 2AW0A 5H2FC 2B7CB 5KFHA 4ZDLA 4RW9B 3KK3A 4NXMF 2HEOA 1GMUA 1NHVA 3W66A 1I1SA 1MBFA 2FJVA 2WY7Q 1GNKA 1Q8KA 1VLYA 2TDXA 1QBJA 5A2QU 4A8FA 2WAEA 4Y2AA 2IHR1 2W7OA 5KG2A 1UKUA 5IT9Y 4RW6B 2R7VA 2DU9A 1IR1A 3EM1A 1HKAA 3OV7A 1ITYA 2F8EX 5KFLA 3LWLA 2N7YA 3KP5A 2M5WA 4NA1A 3S93A 3D2WA 2JC0A 1VQLS 3IC7A 1OPCA 2CWEA 5I3UB 2AO9A 3CJKA 5KG6A 3MAAA 5I42B 2K7KA 2I38A 3N6LA 1HW9A 4BQAA 2PFBA 1L5UA 4KISA 1MW7A 1NM2A 4MK7A 2BY1A 3TAPA 3I32A 1B99A 3EUKL 3W6KB 4CCOA 4LMYA 1RA7A 3N5BA 3LSIA 3W6VA 3SZGA 4LF9J 5KFIA 3O1LA 4DX7A 4ZYEA 4FQGA 2IGKA 5CLSA 2C2ZB 2VBWA 4MEXF 4ENOA 1GMVA 5FLXY 1AFJA 3MD1A 1NSQA 3HF5A 4WWCA 3QYYA 3I55I 4MH8A 4DR7J 2F4IA 1Y0UA 4BWMA 4ELTA 2AKWB 3NMAA 3CC7I 3HZGA 5DYMA 2E36A 3CCUI 3PFOA 3IKVA 2VDIA 5A8KA 4PR6A 2UUCF 4PZJA 3MMCB 2R7SA 4O0NA 1S9GB 1EP4A 1C1BA 5DQGA 4FYDA 2HK2A 4EJWA 3KHGA 2X48A 1RTIA 3VALA 4H0EA 3BH6B 3QPHA 3VAJA 2IM0A 1T0FC 3R4KA 3T3FA 1B4SA 4Q5VA 2RUGA 4M8LA 3I9ZA 4KHPJ 5B5EC 1DQAA 4E7ZA 2VPLA 1XNQJ 1TZ0A 1FSHA 2DK5A 4QWCA 2FC9A 1GXTA 1ZTWA 2M8EA 3MN2A 2M70A 1DLOA 1FBQA 5KFYA 2P7CB 1R8HA 3GFZA 2ZSHB 4AU7A 3NNAA 3D3BJ 3OSGA 4RBTA 2AIRB 1KNZA 1KQ8A 2M88A 3WTUC 4K4YA 4WFXA 3OTCA 1HBOB 5HLGA 1YJ7A 3Q8QB 3QPIA 1AWCA 2YWEA 1NCLA 1BQMB 2RVCA 5TRDA 1OKRA 2LXUA 5D3GB 4WXOA 2Z2MA 4PFOA 1XGSA 3VB2A 5HDKA 4A5NA 2HHWA 3UVJA 3BH7B 1RUNA 1UVKA 4J90A 3HHKA 2MH2A 4PG8A 2XI2A 2O5RA 3TOAA 2FMYA 4ANEA 3H0PA 5EJCA 5CKTA 3A4TA 4QWEA 4HHHA 1VQ8I 1TL3A 3TEHB 3RQ4A 4L0YB 3LUYA 5LXYA 3FIWA 3DF8A 1FLIA 1I39A 3T1BA 1MH3A 2HQIA 1IRGA 3H2UB 3VAGA 2FYXA 5HROB 1LEAA 3FXMA 1Y8RB 2OTJI 3LP0B 2Y69H 1JKQC 2E5LF 3K4MA 4DV3F 2CW0F 3HRUA 2IEKA 1XTZA 2RHSB 3CCJS 3LP0A 3CMYA 2HVDA 3EWGA 3HEFA 2VPRA 1NK2P 4LF1A 4NLXA 2GWRA 3CC4I 2G0JA 2DGQA 4CCKA 2AS5F 4N76A 4ESBA 3AY0A 4GRSA 2HAFA 1C4AA 3HSFA 3THVA 4KH1B 3QT7A 4MTDA 4BC9A 2HHQA 3W6JB 3I64A 4QJVA 3MZIA 4MFDA 2A0FB 1RU2A 3MZ8A 2E60A 2BY3A 1C0TB 2CUYA 3QOEA 3OLAA 3J80Z 4FKYA 2O01C 1SD4A 4M3BA 2GVZB 4QR0A 1PIEA 2BANA 2YXLA 3CCLI 2WONA 3OHBA 4B3SF 3DLJA 3R27A 1FZPB 3GUDA 1IQTA 2PBIA 3TNVA 4D0PA 2DO4A 5C4JJ 4QR2A 2V9WA 3LSKA 3G87A 4BE0A 2QA1A 3KK2A 4ZCKA 2X3GA 1FTCA 5D78A 2JX2A 3Q0UA 3ZTQA