2KDOA

Structure of the human shwachman-bodian-diamond syndrome protein, sbds
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
252
structure length
252
Chain Sequence
GHMSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, dynamics, and RNA interaction analysis of the human SBDS protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Ribosome maturation protein SBDS
total genus 57
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2009-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01172 SBDS Shwachman-Bodian-Diamond syndrome (SBDS) protein
A PF09377 SBDS_C SBDS protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.900 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2kdoA02
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kdoA03
3.30.1250.10 Alpha Beta 2-Layer Sandwich Hypothetical 12.0 Kda Protein In Nam8-gar1 Intergenic Region; Chain: A; Ribosome maturation protein SBDS, N-terminal domain 2kdoA01
4ES2A 3B82A 1ZPWX 4ES3A 1N0VC 2WBMA 1ZM3A 2CVEA 3LH2S 4MYUA 3ZZUA 2IVYA 3E3XA 1ELOA 1N0UA 4TNOA 2BM0A 3EXCX 4FN5A 1VI7A 1P9QC 3ZZTA 1FNMA 1ZM4A 4ZCMA 4MYTA 1ZM2A 2EFGA 2I8EA 2BM1A 4ZCLA 3ZZ0A 1NYNA 4M1KA 1U2RA 3OQ2A 4MAKA 5G4DA 1DARA 2NPFA 1T95A 2KDOA 4QR1A 3B8HA 2ZITA 4QR0A 2L9NA 2BV3A 4ZCKA 2E1RA 1KTVA 2I0XA 3B78A 4QR2A 2J7KA 2XEXA 1ZM9A 3UI3A 4ES1A 4ZCIA
chains in the Genus database with same CATH superfamily
4U67Q 4LFCJ 1N77A 3MF5A 1YJNS 3E5QA 2KJBA 2H65B 1YLXA 1SKWA 3S17J 2RS2A 1G7CB 1B72A 4IUFA 3HSFA 4J00A 3HD2A 1PILA 2AMCB 3Q8RB 4HDHA 1LPQA 1ZG5A 4LIRA 1I27A 1G6NA 2VG6B 3TO9A 5F0FA 2K9SA 4P1WA 2P9EA 1NK2P 3F3XA 2AEFA 4EJVA 1XB4A 1EETA 4RAZA 3DRYA 1YJ9S 4TN2A 1FJLA 3CMQA 5JVTA 5KK1A 1ZYQA 2HVDA 4F3MA 3ET6B 1EA3A 1W2IA 2BKPA 2DR9A 1SBRA 1YFHA 3QU3A 5J2QA 5HLFA 1YHQS 2LREA 2IVFB 4Q2LA 2DA2A 4OJ3A 2IBDA 2H5EA 4QWAA 2GBYA 2CJXB 3V4IB 3KJVA 2NVTJ 3N0VA 3TW0A 2R7RA 4AQYF 4LF7J 3I6PA 1IXRC 3LP2A 4UB6C 1RTJA 2YH1A 4P55A 1N56A 1RISA 4C2TA 4PZJA 2VDHA 5GAEI 1ON2A 2MBFA 1R6YA 2W82A 3PR5B 4OV6A 5FLXY 3G9CA 2BXJA 2N7CA 1WHWA 4DV4F 5D6GA 3BJOA 4LSNA 2V4JA 4QLCU 3SXYA 2K9MA 2XAHA 1DTTB 2HQGA 1DLOB 2LFBA 3C6TB 2CQIA 2CW7A 1R7IA 2JC0A 1YX2A 1IBKF 2WTFA 3LSKA 2FLOA 2PI5A 1OR7A 5M2UA 4MIBA 2ESHA 2EWNA 2NOJB 4L6V3 5LT5A 2FNPA 2C6YA 1Y39A 3GIKA 4OZ1A 2JMWA 2LP0A 5KOWA 4WYWA 2L9RA 3NOGA 1MJAA 3WU1B 2R93J 2V34A 2OAZA 1V5FA 3AT1B 4GC7A 2VH7A 1SAUA 1FESA 4WIIA 3GTMJ 3H4BA 2AGOA 4Q0BB 2EK5A 3ELKA 1W0UA 4RW7B 4HPQA 1HMVB 2VLAA 3DLEA 5EN1A 4NEYA 4EGLA 3HTUA 3ZQIA 1J2XA 1VQ9S 3NNAA 3ONQA 4ITVA 2BVLA 3N4MA 3CCSI 4J9VA 3IH3A 2MLZA 2RAEA 1T03B 4FASD 5BNGA 1U6FA 3IM9A 3TQNA 1RT4A 5BYRA 4X4NA 1W0TA 1FWPA 1OKRA 3OMYA 5EWFA 3EE3A 1AKHA 1MW7A 4B09A 3FXQA 4ZYAA 5KFZA 3K5NA 2DH8A 3NGUA 1NK4A 4BQOA 3TO8A 3I58A 2KM8B 3PFIA 2CQ0A 4NE9C 3VYSB 2UUBJ 2Y0MA 3GFZA 3LQVA 2FDNA 1HIYA 4ES2A 4C2MA 3TEDA 4CLPA 2Y1LB 3FBIB 1I3QJ 3OBIA 4S0MA 2D1CA 3PRBA 2E7VA 4B3OB 1JI8A 3BGFA 2XMAA 3GTOJ 3H7HB 1RAIB 3R3TA 1S12A 4DV2J 3E6DA 2EV6A 3HFZB 4UOGA 4Z6YA 1MWZA 3FZ2A 3R6LB 4J5OA 2QA2A 1N33J 1VGYA 4DFPA 2O7OA 1SFUA 1S1UB 4X1EA 1I94F 2EJRA 1ZA1B 2M7AA 1DLOA 3BR0A 3U1KA 3JYTB 4WZQA 2M34A 2DRBA 4PUOB 3FXKA 1N8RT 2HBQB 2BV3A 3HVTB 3M07A 3HHNB 4DN9A 1IRFA 1T8IA 3A13A 3IR6B 1EKEA 3Q8YA 1W7PD 1XMKA 3H5NA 1X0FA 2QWWA 2HTSA 3Q3SA 1N0UA 4QJVA 1D1AA 1U7LA 3IWFA 3LMMA 2CUFA 2N3OA 1S1TB 5LFAA 3HJEA 3ITHB 4HSRA 4PGGA 2F5GA 2E60A 1DBDA 1IQTA 4USVA 4AIJA 1KBRA 4HHJA 3IN5A 4KR0B 2DGSA 2F5DA 4HBLA 3CDLA 3SZGA 2IRYA 2KT2A 2H94A 2UUAJ 3VDXA 1YDLA 3EM1A 1S0VA 2E7XA 1Y3KA 1NJZA 5K7FA 5F3ZA 4ESBA 2CGPA 2HYIB 3EUNA 2YNFB 3W63A 1SKUB 2VQFF 2FJWA 4QIWN 4PXDA 1OS5A 3KLHA 1EP4B 1REVB 4AUXA 3M05A 1IUFA 4E7HA 3IS9A 3A0HC 2BJ3A 3M6XA 2RRNA 4Y2IA 3BTJA 2OPPA 2R8IA 1NYNA 5HVQC 3OTBA 4IFYA 1QAYA 4JX6A 2ZE2B 4KV8B 4CH0S 1XC5A 3I9V2 1CEZA 1WJAA 5IT3A 4M5NA 3M4XA 1KU9A 4JI1J 3FQKA 3U1LA 3RAQA 4IX7A 1IDYA 3CCWA 5AJ3F 1HR0J 5U47A 4UUWA 3KMSA 5D77A 3M3YJ 1XSDA 3NAIA 2F8EX 4UXNA 3PIOQ 4HEA2 4M6VA 1VJQA 3CJ2A 5D8LB 4DV3J 3G3ZA 3AL0B 4MTDA 2L5QA 2HKOA 1FSHA 3GFHA 4DSKA 1F60B 3VV2B 4NYOA 2M9HA 4BDYA 2XB2D 1ZAVA 4M5IA 2L9DA 2V50A 1S6QB 3T8TA 1XNQJ 4ZMMA 1LVKA 4CM2A 2X51A 3LSJA 3K58A 5CYQB 3I0SA 3T5LA 1Q7YT 4IHXA 3A01A 1APSA 2V5HG 1GX5A 3M8JA 4A12A 2CNKB 2BVMA 4M95A 1JMTA 1FXLA 4GVBA 5L1KA 2PO4A 1S9HA 3ET6A 1U1OA 3WIVA 4LB6B 3F41A 4ZPBA 4CCHA 2CQ2A 3UCGA 5DM6Q 4IHVA 3D5MA 2IRUA 3FC9A 4OOIA 3S1NJ 3SCKE 2W8KA 2UVWA 1YJRA 1U8RA 1WF1A 2W2PP 1VQKI 3WU0A 4NRTA 4URSA 2DJWA 4DUYF 3J7AO 1TL4A 3QWPA 4WK3A 8RUCA 2M8GX 5IP6A 3IWLA 2YX7A 3HHLA 2JOQA 2IGKA 3K89A 2MLXA 2NCKL 3D5LA 1JJHA 3AA9A 2YWWA 4GC6A 4G6QA 1KKHA 2K7JA 5DYMA 2LFVA 4NLWA 4DNCA 2JA6J 3ASNH 1OMIA 1WDTA 5KNLA 2JJ7A 4PKDB 4X64F 4I6AA 2POKA 3C15A 4RNMA 2FY8A 2DW4A 2N4CA 5HI7A 2OTJI 3HJVA 1GXTA 4HOBA 1V3FA 4WP8A 1P7JA 4CA0A 3L9ZA 4O3SA 4AYBN 3ZQHA 3M32A 3RQ4A 5KFFA 2E5HA 3FBBA 1NDCA 2VKDA 4P52A 4EUVA 3QPLA 3GVAA 2LXUA 2LQ9A 1IN4A 3CF5F 5J2MB 1ZLJA 4P72A 3PRDA 3K5LA 1ZG1A 3ZQLA 2MQ8A 2EVZA 3IAM9 2DMPA 3JQKA 2F4OB 2JZYA 2AWZA 4RNNA 3BR3A 4LF1A 4JI6J 2A6TA 5I3UA 3CD0A 3TNVA 3BSAA 3TW7A 4M9SA 3H40A 2M3DA 3DGVA 2VUMJ 3DRPA 3L3CA 2DT5A 2HPMA 3SQOP 2GOXB 2FHKA 2R4FA 4JP0A 4ES1A 3N01A 2WBMA 1RCOB 2F4FA 2CPDA 4R1HA 3J80Z 4IRGA 5KFIA 5E3QA 2MQNA 5E0OA 1K6OA 1OJLA 2NVXJ 3GE9A 3J81Z 1WHXA 1LFWA 2VZ9A 3MEGA 3SFIA 2M0GB 3HOSA 4DR1J 4DR4J 3AG1H 1MROB 5IT4A 4DFKA 4YIIA 1TVRA 2C3MA 2K7KA 4Y65A 5A0YB 1Z1DA 1BOAA 1IAWA 4DBRA 1MMSA 4ZOSA 4N4OB 1MJBA 2XV4S 2HQRA 1UVMA 2XMTA 4CCMA 5L1IA 4F52A 1H2VZ 5KHDA 1N6QA 1WG5A 2GAGC 4UB8C 3NS6A 3RR8A 3G6XA 2XGDA 2QSGX 5GAGJ 2QGUA 3CC7S 2LQJA 3MR3A 1YKWA 1G3WA 2DFFA 4V1Ak 4M74A 4U9RA 3OJUA 2HOSA 1I6XA 5IWAJ 3L7PA 3PEJA 3TAMA 3AFHA 5A2QK 4CIOA 5SUHA 3M1VB 2HOTA 4LD5A 4FN5A 3FFIA 2UUBF 3C2GA 2RSQA 3NS5A 4EJOA 3GQCA 1JLAB 3Q86A 4RW8A 3ECHA 2UXBJ 4GMKA 4WP9A 5J3LA 4RR5A 4JI4J 3E1SA 4C3KA 5DLFA 1KTVA 4OI2A 3TA1A 1NJIT 5D4LA 4B3MF 2ASDA 1TL1A 3K8VA 3BV8A 2BXZA 1X4AA 2VPRA 1FOWA 1U1NA 4H54A 2EA2A 4OYZA 5KFGA 2RNGA 1PP8F 4DU7A 4EJTA 2EI5A 2F4VJ 1TAUA 2VU5A 1TL3B 5F8GA 4BS2A 1Q78A 2I0XA 2EFQA 2W4DA 5DTDA 2ZUGA 4BYYA 2XKPA 1KLMB 1FJGJ 4U96A 2AD9A 1RUSA 1AYEA 2IDLA 1CGPA 1HC8A 2HDCA 1KVJA 4S0HB 3IBWA 4QWBA 2P9GA 2PBIA 3CP2A 1REGX 3B8HA 1HA8A 3VR1A 2IIHA 1Q86T 4HT5A 1G3SA 1WEYA 3DU6A 2G4BA 2QT7A 4F0HA 4MHGA 5J1NA 2Q0OA 2Y30A 3BWGA 1K61A 1S5ZA 1BW5A 3TQ1A 2VODA 4CT8A 2MZQA 1B8IB 1IM4A 2J9CA 4GKJJ 3D7SB 1STZA 1HHTP 1ZH5A 3P4UB 2UZAA 1ETKA 2L9SA 3TWZA 1LJ9A 3HT3A 3IRXB 5T41A 2MJNA 2KRCA 3VSLA 3SYZA 5CYVA 3E3VA 2CV1A 4CICA 3VGTA 1W26A 4ZK7M 2VE9A 2B7CB 2OD5A 4NI2A 1YG0A 3T3FA 1ZBTA 4A3JJ 1QNTA 4HDGA 2OZ6A 1OFCX 5HMYA 3EDPA 2KO1A 2YWEA 2K9NA 2ZWPA 2D45A 4RW8B 2CPYA 2DPIA 3IH2A 5FLXU 2ASJA 3E7LA 1A5JA 4M5LA 1ZOTA 2ZXIA 3T1HJ 3RB4A 3CDIA 3T41A 3CE8A 2JLFA 2R7SA 5D4RA 3BG5A 2VHGA 3RU0A 1Z6TA 3H5AA 1YBTA 3NWTA 4GGGA 1NB7A 4NLOA 2DY1A 2Z2ZA 1N48A 4B3RJ 1RDRA 4NASA 1PYVA 2DTRA 2KHCA 1SUQB 4JI1F 1IG7A 1Z4UA 2DNKA 2Y8WA 2BZ2A 1POGA 1NPPA 1TK5A 4XPCA 4DV0J 3A4TA 4LSLA 1KA8A 2RDIA 1BWEA 2PEXA 4RW9A 4CO8A 2VJIA 2CO5A 5HK4A 4HH0A 2F1FA 3TVKA 1S10A 1VC0A 2LNBA 4X4UA 5IQQA 1NDPA 4LFAJ 3MKLA 4DG1B 2WC2A 4L3NA 4B1RA 1X4EA 4AL7A 4YIRX 3JW4A 4WTOB 2ILZA 5ETKA 2EBIA 4ZDLA 3V81A 2CWXA 2V1NA 2GGPA 4JI7J 3ULHA 1XGOA 3LPYA 1V54H 3ZTOA 2D3OR 3VCDA 3KWMA 3MURP 2Y3YA 1LNQA 4ECYA 1DQ8A 1U2RA 1GVDA 4WFAQ 5D78A 2ZBCA 1SB6A 3KEQA 3OOPA 5LHGA 3DBLB 3ZRGA 2EC2A 2SXLA 2YKNB 1PYTA 2HK2A 2R7TA 1ZRCA 1SPBP 2JQ7A 2BA9A 4ELUA 4HDUA 4M3FA 4JI3F 3I32A 1VQ5S 2BUNA 4URGA 4EM0B 1NDKA 2MGZB 2O03A 4RUBA 3NLCA 4MGRA 2RHSB 2N7YA 1U0HA 1ZKGA 1B4SA 2EW9A 5KFJA 2MA3A 4K4TA 2YVSA 2V9KA 3B02A 5K5MA 1S99A 3D0HE 5E17F 1UW4A 4DV5J 1ZAOA 3VWBA 3O6QA 1OSDA 4BQQA 4NNJA 1M1HA 1U02A 3BQ1A 4B3SJ 1P1TA 4HHUA 2EKYA 4L5IA 2BW2A 2H1LA 3G6VA 1BI3A 2NYHA 2KXHA 4D5CA 3FBEA 2AQ4A 2DYRH 2YWHA 2HVQA 5ITHA 4ECWA 4ED0A 4A8WA 1H9GA 1YJVA 2ATCB 3IBFB 1JX4A 1RHJB 4K59A 4BC9A 1GXLA 1C0TB 3MUTP 1WSUA 3HC7A 2J6SA 1Z91A 5FD5A 2JVGA 3AOCA 3HMJG 3IKTA 1EJ7L 3L2CA 4B17A 3QZ7A 3TMOA 5CVVA 1B99A 3NP5A 5J8CA 1TUWA 4O3OA 4GVBB 5JR3A 2K9QA 1BR2A 5LMNF 2APOA 4O3MA 2YBVA 1NEEA 3W62A 1XCBA 2ZFHA 1HW2A 3CDBA 4ZVQB 3AODA 2Z57B 4QW8A 5FKMA 3HOWJ 2AV5A 1N36F 5DS9A 1KQ9A 2XC7A 4NX9A 2Z3YA 2XO6A 4ITSA 3IO1A 3G6ES 4N0BA 1TK8A 1Q8IA 2W1BA 4Y3CA 3ILJA 2V4RA 1QAJA 1TKXB 4G12A 3GFLA 3BGOP 3IRWP 2J9DE 4C8KA 4DX5A 2CQ1A 4QR0A 2YKQA 4G6VB 3LP1A 5FLVA 1GDTA 1GHCA 1MU2A 2XMWA 3DKDA 1U45A 3BREA 3ULQB 2GXGA 3IC7A 4CWBA 1WACA 1IQZA 3AD8C 4XSXF 1JJ4A 2FMLA 1RKWA 5HANA 3GFJA 4CLFA 3I82A 3W9JA 4PQUB 3C7JA 4USKA 2LF8A 4HAMA 2FLPA 4I09A 4KC5A 5IPAA 1NK7A 2FJDB 3CC2S 2DMUA 4USMA 3FK4A 1JXLA 5KT4A 5AJ3J 1U0SA 3CCVI 2C3PA 2L9NA 3OYKA 2BGCA 1H6KX 2F7VA 2B43A 3SYTA 2HZDA 3B73A 1WJEA 4E4HA 3R6GB 1K6YA 2X3DA 2BW3A 1IZ1A 3MM9A 3PIOF 4DDFA 2QKMB 4YOEA 1CC8A 1RR7A 2GAUA 3QPIA 3ZTRA 2JSXA 3ITHA 3MCSA 3OV7A 2M2BA 4RW4A 2HVHA 4FYDA 3ZZOA 2VN2A 5BJRA 4MTPA 4OAZA 3O2PE 2FVCA 2E1MB 2F8HA 5H6RA 3TOBA 3KLFA 3HFKA 3FIWA 2QYGA 3T19A 2UZKA 2DIUA 2ZVIA 4EBCA 2KMUA 1UW9A 1FYLA 4NRUA 1LQ1A 4ZDNA 3ML6A 1ZR4A 2KRFA 2OH2A 3KEYA 3OV8A 3KZIC 3HRUA 3I4PA 1WI6A 4XLCA 2JSCA 4D5FA 2VFUA 4ABZA 4LUBA 3FGVA 4JI6F 2O9LA 1P1LA 2DQRA 2WK4A 4B9NA 2QL5B 3H8YA 5KFPA 1OCCH 1L3VA 3B4DA 4BE1A 1H73A 2NREA 2CPXA 1K78B 5IOLA 1GAOA 3GTPJ 1QHHD 5K9FA 5GMKa 1BBYA 1N5VA 4LG0A 4KO0B 4G65A 4N56A 1Q16B 2KH9A 1IWGA 3FMBA 3OTOJ 2P8IA 4D9JA 1HW5A 2NOGA 1T11A 1GX6A 4HYKA 2PI4A 5AIPA 1T9VA 4RX6A 1PAEX 3CSKA 4C48A 4Z2YA 1YZ6A 4A46A 2COMA 3NGSA 4B3TF 2C42A 2ZBKA 1IN0A 1RT4B 2ZBIA 5L8RC 1X4PA 4ZCLA 4PYDA 5AE2A 3QYYA 4CM0A 5EWEA 2VONA 2FVRA 1JUMA 5E3NA 4WTYA 1BD6A 1T9YA 3ZC4A 2M1BA 4CHUA 3MFIA 3BO2A 3V6DA 5KFUA 2QMWA 2GJ2A 1NH7A 3UR0A 1YS7A 4OZ0A 1OSCA 1W7PB 5LSRA 5T7LA 3JTHA 4M94A 3FHNA 1CG2A 2WVDA 3G71I 3H59A 3I59B 1MU2B 1SFEA 1DHMA 5A8WB 1E17A 5FFXA 2RQMA 3GV7B 2OQRA 2HKEA 3HTSB 4ED1A 2IS4A 1SH0A 1UFKA 3T1YJ 3ZZUA 3MTKA 2I38A 1XR7A 1HWLA 2DNZA 2RF2B 2VE8A 2B8PA 2EINH 1N4LA 5EX3A 1RT6B 3A8IA 3CCZA 3MD2A 1HNXJ 3KNGA 2UXCJ 1HD1A 3PO2J 4IYQA 1CULA 1P9YA 2ISZA 2O5DA 1L3UA 4HLYA 2LG4A 4XLAA 2ZZMA 1IKWB 4N8NA 3BLYA 3G86A 4BUPA 5HDGA 1YIOA 3R27A 2MSTA 3CDAA 1IBMF 4F25A 2ZBPA 2KFDA 2Q2EA 2B9EA 3OTOF 2W01A 2B63J 4OI1A 3U27A 3R0JA 5KG3A 3H3ZA 3KTQA 3LWFA 4F50A 2GCFA 1S7AA 3RUBL 3JRGA 1J7KA 2VBWA 2HURA 5A76A 1W36C 3SI8A 3E6BA 3C6UA 3PW0A 4BEHB 4W90B 3QPSA 2HYJA 3VYRB 3CCJI 1IN8A 2E2HJ 2VXZA 2DO7A 2DHGA 1URRA 3DRRA 5L9XA 2NS7A 4P5OA 1RBOB 5HS8A 5HATA 4XLNF 2V68A 3GB0A 1FEHA 2LOOA 4Y13A 4FF1A 4KYZA 3BQYA 2CJ9A 2XNQA 4AM3A 2FPHX 4X65F 4G1IA 4M9ZA 3EUHC 1U25A 4AQYJ 3K8WA 1S59A 4IFVA 3TAMB 1TKZB 1SAXA 4FKXA 3GYNA 2DH7A 5L9NA 5L3DA 3LH2S 4WWSA 2DU9A 2KL4A 5IXUA 1RU2A 1MSWD 2HNZB 4NC8A 2GVZA 2YKMA 3ZZTA 1I1GA 1R4MB 1XERA 2GJFA 2ZWOA 4NEZA 1FA0A 1UWAA 3AJ2A 4I76A 1H74A 3S3OA 3ADAC 3HYIA 1SV5A 2HFHA 1HNXF 1Y4ZB 4YEJA 2CS3A 2DYAA 2DO4A 4NA3A 5L3EA 2ZOFA 3CDWA 4DOZA 2MZJA 3F8BA 2PMZD 3RIRA 3U1NA 4P73A 4KGKA 2FVSA 4O3PA 5D6FA 4JI8F 2NZCA 1TTHB 2EFWA 2KXFA 3L7UA 3G82A 5IC4B 2XC9A 2MZRA 2XAUA 4V19X 3S1RJ 5HJXA 2DT6A 1TC3C 2MQQA 1X8DA 2CG4A 3R1LA 3Q5FA 4GKKJ 4II2A 4F67A 1OISA 3DDIA 4YR3A 2QV6A 4XKVA 2DNHA 4HYEA 1U5TB 4IH6A 1TWFJ 2A6EF 3ISPA 3A4CA 3O8GA 1EETB 5C42B 2L41A 2KZGA 3QT6A 3RRHA 3LQRA 1NB2A 2VIHA 3PJ9A 4CZZA 4J9OA 3ECOA 4WPAA 4XN0A 2GIRA 1UP1A 3JSMB 8ATCB 4GO1A 4EFAC 1UG2A 2GA2A 5K14A 1K1QA 3FSIA 2ALYB 2RJZA 3WTUC 2A2CA 1EQ0A 2E9RX 2OAUA 1RT5B 4EO8A 1U9NA 3RKQA 2VA2A 2WB4A 2XAJA 5H9FK 1USTA 1SIWB 2HYFA 2CKWA 3QRQA 2HFOA 2RQQA 3M7GA 2OKQA 3DGPB 3OYMA 1S97A 2BE5F 3HRMA 2IJLA 3DGPA 1VF9A 1OY8A 3KG1A 4XRSG 1LEAA 3OR2C 3RB3A 4ICLA 5IWAF 2XIGA 5D6EA 5E3CA 1W1WE 4LB5A 2GXBA 1KU3A 4PCQA 3TYTA 1A31A 1J5EJ 2JA2A 1JLGA 2XZTB 4LIWA 3RCOA 2RS8A 5M5WJ 3P5TL 4GDFA 1WC0A 1NSKL 5A2QY 1X1CA 4AXJA 1EV7A 4RLFA 3MMBA 3DLGA 3F9KA 3BR8A 4RW4B 5IC6B 4DYRA 4LBPA 3QZ8A 2IM2A 4G7OF 1AA7A 1Z3YA 2OD4A 3HOZJ 2A18A 1EX8A 2VUGA 4KJIA 4HF2A 3CMYA 1CJVB 3BCAA 2D74B 2F5EA 3PW4A 2EC0A 4DLEA 1I3OB 3EMTA 1ZM4A 4UUSB 3BTCA 3PEHA 4ZPDA 5DQGA 4BAYA 3HSZA 2GHPA 3WQPA 5IZHA 4PWWA 4AE5A 4N4NB 2KDOA 3EPZA 3C66A 5DUKA 3S2HJ 1N5SA 3PACA 2EIMH 3IRQA 4P9FA 1XEZA 1ZR2A 4O4GB 2OF7A 3C18A 3CCVS 2Q79A 1I3AA 2CZVC 3FK7A 1OPCA 2QL7B 4XLPF 2FZGB 4QBUA 1Y10A 4Q47A 4EZ9A 3HEFA 2IY5B 2UWMA 3M8QB 4CO0A 3OL7A 1KQ8A 1NH8A 2I5JB 2WWYA 4IFVB 1Z2ZA 2HFSA 3ENVA 2W9CB 1S1XA 2DTZA 1A7GE 1RRJA 1SJFA 1USSA 4Q2MA 1FLIA 1JNZB 4ED5A 2Z2SB 2RUSA 3OQ2A 4PAAA 3BPVA 2VIXA 1WC5A 2W7PA 2XMVA 4PG7A 1NUEA 5DDPC 2UXXA 3C16B 4NL5A 4ZA1A 4L5EA 2W48A 4ZP9A 4IPAA 2ZB9A 1LEBA 5E3MA 4EQQA 2QF7A 3TOAA 2B6AB 2E44A 3GXOA 2PI0A 3AG3H 2CFOA 2ZDPA 1QPMA 4UNOA 5ETSA 2R2UA 2H54B 4HNUA 2IPOB 4DI6A 1UHSA 4LMZA 3I5BA 4NLVA 3COAC 3VOEA 2KU7A 5HLTA 1R5GA 1MBEA 1ETYA 3R5DA 2VD3A 1E3OC 1IV8A 1ZGAA 2GVDA 2ESNA 3FFIB 2BDPA 1V55H 2OPQA 3BG7A 1XPXA 1HBMB 4C6AA 2XMKA 4BXXJ 4OX6A 2RKIA 1MH4A 2DGVA 5J1EA 2R9LA 2YNFA 3MR5A 1NHUA 3QSYB 5EJCA 1HYSA 5LSLA 5LXYA 3ERMA 2NAZA 2OTLS 1T0FA 3M1CA 2OD6A 2M9KA 4BWMA 2H09A 1H38A 3EETA 3CJTA 1T8EA 2IP2A 3EZ5A 1YQAA 4I6YA 4D0PA 4OYPA 2DNYA 4AD9A 3MEXA 3V8JA 1R6RA 4E7LA 4LF5F 5ILUA 5JFRA 3WG9A 4F7VA 4ID8A 4CH1A 3MM5B 3PHEA 1I5ZA 2FC9A 3GV5B 2YU3A 1I94J 3S8PA 2FRHA 4ED3A 5L3CA 3H9JA 2F48A 5HODA 2IJNA 3HVTA 1F6TA 1I6JA 3GJRB 4TKTA 2XMJA 3MEGB 2OEJA 3OLAA 4ZCIA 2KYZA 3UN2A 1K73T 4IRDA 2HS4A 4XL9A 2HPIA 2TRTA 2HYGD 1VZ0A 4BU2A 2VXDA 1QVFR 5B5EC 2J7UA 4CYUB 2WB1D 3CXCR 2HQFA 4ZYHA 5KFLA 5GAEU 1NXIA 4IF4A 2MGZA 2FE3A 1IBLF 1TT0A 1ZA2B 1E3HA 4KITB 1ZGWA 5LSOA 1IXKA 2M4GA 2OP5A 3CIZA 3DXBA 3OVAA 3DCFA 1HI1A 2ZJPQ 4DFJA 2ID3A 4L0YB 5CYMA 2ID6A 4X2BA 1NSAA 4PSWA 3TBIA 3HZGA 4BHBA 2DR7A 5DCFA 4QWEA 5F8NA 4C3HJ 1X4HA 1Z05A 1D0YA 4USWA 2OUMA 3HK2A 2E29A 1FMVA 2PEBA 4BQNA 4U0YA 2XQCA 5KG1A 3FWEA 1R0AA 3Q89A 5FIIA 3RKXA 5LGNA 2M4KA 3CJRA 4A3EJ 3G73A 2B5JA 2FB0A 2Z8QA 1HNZF 4A8MP 3CC4S 4AVZA 3QQCD 1XG1A 4I6ZA 1FRHA 1U3EM 3WTWC 1C1CA 2L54A 3C2PA 1R49A 2W85A 5HP1A 2AEJA 4U7DA 1NKEA 3MM7B 3OYFA 2BJEA 4JOMA 2FF4A 2HK3A 5IFMA 3HD1A 2B0GA 3BEGB 4L72B 2HG4A 3AB2B 1TFWA 3MD3A 3T5XA 2IRFG 2A6HF 4D7NA 3UN5A 5C25B 1ZZFA 4NZ6A 4IDKA 4LREA 4ZN3A 5K14B 4ZJOA 1FNXH 3HOXJ 3AKZA 1XMBA 1UWBA 2OPRB 2E1OA 1KDNA 3POTA 1BR4A 2NYIA 2L4MA 2ZC4A 2B5JB 1VQPI 1T95A 1TLHB 3M6VA 1NZ8A 2OHDA 1JGGA 1S9EB 5JUMA 3MKYB 4BDZA 1KGSA 3HP6A 4LF8F 1HBOA 2UVRA 3A1YG 1QZZA 3WGGA 5KFRA 4BDPA 3NWRA 3IHUA 5IT9K 1OWXA 3OIQA 1T9UA 2DHXA 4U7BA 2BY0A 4X0GA 1WORA 4H4MB 4QIFA 2G7UA 2UU9J 2DPJA 1XMXA 1MMGA 1SJ1A 2LYVA 5D0RA 4DXLA 1SKSA 2O3FA 3LP2B 1JLCA 4DL4A 1RU1A 3HHDA 1JUPA 4ZIWA 1FERA 3LSRA 2DNOA 4P7VA 2DGQA 5KFHA 2YPYA 4CO1A 1RA6A 4ZVRB 3MAQA 1FRJA 3ZMSA 2HEKA 4LFAF 1KQKA 2CJKA 1HNZJ 2CZ4A 1GMWD 1RWKB 3MAAA 3RAXA 5KFQA 1W2BR 3DPUA 4KAIA 4U0WA 2HFNA 5HQLA 2EFOA 4LJZF 2J0XA 4M5HA 5B66C 1W5CC 1ZN2A 2XDVA 3KJFB 3LO3A 3KK3B 3B6CA 1OQYA 2EK6A 3V7RA 2HR3A 2L02A 1Y0NA 1VQ6I 3RTVA 4ECVA 1MMAA 3IGNA 1FJEB 3HOTA 4CCOA 1VLYA 3I64A 2VG6A 3UD5A 3CGIA 5KFYA 1BN5A 2XNRA 4IQXA 3TJ8A 4M5GA 4IO1A 1GFWB 1VQPS 3PX6A 2GX8A 3D1QA 1NJYA 2R5YB 2VPZB 1OYDA 3SDBA 4EJUA 2OJ3A 2X1DA 1VFCA 3LP1B 1YW9A 5K1YA 3SZTA 2E35A 2VQEF 4B9UA 3GYHX 4KDPA 5KG7A 1RC9A 4FXWA 1FO1A 3H92A 4PSXA 3NGRA 1FOKA 1H0MA 3F6OA 3N28A 2QSHX 1LXNA 3IBCB 3E97A 4AL6A 1L3SA 3DOKA 1RT3B 3TQEA 4ETXA 2XY5A 5E3RA 3KLEB 2HHWA 2BJ9A 4RAGA 1FYMA 3T1HF 4RBTA 4B44A 1GTEA 1SVDA 4RS8A 4BE2A 1FP2A 3D4JA 2CQKA 4FS1A 4XO0A 2DVIA 2Y9ZA 2FD2A 2EFVA 3KK1A 3UE2A 2KJCA 1FK9A 4I7FA 3IM8A 1KFDA 5G0RB 3TP0A 3KETA 3L1PA 3QPHA 2P4WA 4NBQA 3KK2A 3KP2A 2R2TA 4ZZDA 3AQOA 1Q8BA 2NVYJ 4BJTA 1YOVB 3BGUA 4AXIA 2EIJH 4N9HA 4K4ZA 2H6CA 4QYRA 2OFGX 4O3RA 5J1YA 1QQIA 5C25A 4P9UA 1SC4B 3KYCB 4QU6A 4NHJA 3AFGA 1JKHA 1BC6A 1KVKA 2L3DA 3LWMA 2V26A 2FJVA 2PIIA 2V0NA 4IRIA 1QSYA 3MHYA 5IP9J 4B3OA 1BWVA 2Y0SD 4F3OA 4ZCMA 4OIXA 3N6NA 1WD6A 2WBRA 2IM3A 3C3LA 3PKYA 3O3KA 1YX5A 3IGVA 4DR2J 1HXDA 1LW2B 2MDAA 2KP6A 1IUYA 3OUYA 2A6MA 1WC3A 2M0MA 3V2UC 3AH6A 4ZJZA 4BBYA 3AG2H 3ETOA 3DM2A 2E5NA 2OSRA 2VL1A 4YRVA 2XPWA 2DGOA 2B3TB 1P4WA 3KLNA 4CTAB 1AUDA 2MKCA 3PW5A 1XCVA 2IS2A 2ERRA 1KNZA 3MPVA 1SKRA 3M2RB 1IF1A 4CP5A 4D7MA 4W98A 3EGWB 4X84A 1CBKA 2EV5A 4IG0A 3TP2A 2ILYA 3D68A 4WFYA 2LXIA 4B3XA 3EX7B 4F2RA 3OW2R 4DR3F 2V8VA 2JA5J 4EYIB 2FEZA 5H9FJ 1K0TA 1TL8A 2X0LA 1DU6A 1PO6A 2YPRA 2WY8Q 5H20A 5BPIA 1WH7A 4LF7F 4ILLA 3NG8A 5EDWA 3MM7A 2E34A 4RMNA 1CC7A 2MHNA 2ZNZA 5KT2A 1ETWA 4X4SA 4ICLB 3HT0A 4XLEA 3ZTSA 2L01A 4U8VA 5IM0A 4OHYA 2KRHA 5H2FC 9ANTA 4NLTA 2UP1A 3IC1A 2DITA 2YS9A 4CH7A 4AL5A 2QRRA 2X1AA 2K2PA 3N05A 4KN7X 1VQSA 1JLQB 2UXCF 1HW8A 3TW6A 4NLYA 1S7IA 1XX5A 3ILLA 2HXIA 3BN7A 5M2RA 2E9ZA 2RNJA 2GXAA 3I4MJ 1DFDA 1HW9A 2FIUA 1VQ4I 2I5UA 1UG0A 3EWGA 4C0OC 2BJ1A 4PJJA 2XROA 4JYKA 2DHHA 3D3CJ 4ZLLA 1DQ9A 2MTLA 3OYLA 2RDJA 5KFMA 1DPRA 3CJ3A 4DV1F 2HGMA 4PQAA 2EZLA 2WAEA 1H0HB 3FVYA 3HG9A 4FDFA 1VQKS 5JVHQ 2R92J 4NXMJ 5CZXA 4J9PA 4HH1A 1SD6A 3SQGA 4TVAB 4PABA 4NYZA 2OIHA 4N77A 2I8DA 2JHEA 2Y0BB 2Z2LA 2KKHA 1Z2LA 3KYLA 1YRNA 1J5OA 2MQPA 1JJ6C 2HHXA 3PFOA 2KZMA 2VJJA 2HQ3A 2NLWA 3RPUA 1W4MA 3G82B 3B4MA 3M30B 1YVFA 3VAJA 1UEUA 3I9ZA 5JHUA 1TW3A 4R0EA 1U6ZA 2CH0A 2ZDOA 4M71A 3K4JA 3MAHA 4NDLA 3ELHA 5CQGA 1P9QC 3M9AA 3F22A 3GFXA 4RDUA 3UD3P 2LY2A 4Q8EA 1T9XA 3TDUC 4ENMA 2EFPA 2EA4A 4EMDA 4P10A 4JI0F 2VC0A 1S77D 2M3AA 1BY9A 2R8HA 2X1EA 2K1RA 1XMAA 1OLTA 3CUQC 8AT1B 2W7AA 1GV2A 3VVTA 4C30A 4ZP7A 3IAS9 4DL7A 1D0ZA 4H0EA 1PC4A 3Q0AA 5GTIC 4UV8A 3FMRA 4MEYF 4KIFA 4M8LA 1QE1A 2OBPA 4FZVA 3K10A 3CO6C 1RAOA 3BKFA 3M6WA 1M1KT 1YJWI 1YG2A 3GV8B 2RKIB 4WCEQ 4FT8A 3K5PA 2RDPA 4Y4RA 1CJTB 1RAFB 4EEYA 2D5VA 3UDEA 3N4WA 4XK8C 4JBAA 2XRNA 2M5YA 1WNEA 1G59A 5F8MA 1ZM2A 2E5LJ 4B02A 4F36A 2ABYA 2QEXS 3AXKA 3BZQA 2K3IA 2Z16A 3A1YA 3JTOA 2FX0A 2QGFB 4H4OA 2A1BA 4RL1A 3P45B 1K4SA 1UFWA 1T9TA 2MKKA 2Z99A 4HV5A 5DETA 4LRCA 4V2FA 5FB2A 3HX9A 1RWNB 4YELA 3MEDA 2NXNA 4ASNA 1U0JA 4RBVA 3QIPA 2ZSHB 2A69F 3EXCX 2MH9A 4UY8I 1UMJA 2A10A 1ZPVA 2F4VF 3MUVP 4M3BA 3KHGA 2P2CB 3BGLA 4K8RA 3DQVC 5AE1A 4EI2A 1YBAA 5MLCV 3FISA 2MLYA 4KGZB 4I99C 2UXNA 2BANA 1MROA 3HVAA 1TBXA 4PUOA 3HL2A 1RNLA 2A3SA 1B0VA 4WXWA 3CMES 4EBEA 2C28A 1UMQA 3DEWA 3HHLD 2MEWA 3ZCOA 2HI3A 3GIRA 4ELTA 1FE4A 4Y33A 2ME6A 3LAKA 3RKWA 1Q95G 3FMWA 3IMQJ 3U7JA 2FJ1A 2N8GA 2WONB 4MJKA 1P27B 2DNNA 5T7LB 4FXVA 4MIWA 3K0LA 3T1AA 1C1BA 3MECB 3HPOA 3CCUI 1QAXA 3ZQFA 3TAPA 4P96A 3PIPF 4IG0B 2YXLA 5ETOA 2D69A 3H98A 3MM8B 3VZHA 3TJ9A 1QO0D 1ZAXA 3OXLA 3EGZA 4UQGA 1JLGB 3BR1A 1BE4A 1WKKA 3HKZD 1YJUA 4UVCA 5AXNA 4YIFA 4NZ0A 2GHVC 1RSCA 1WI8A 9RUBA 1ROFA 4I0WA 1JWWA 2R7UA 2RRAA 2MKIA 3CO0P 2HIQA 2H1YA 1YRTA 1VQ4S 3L7OA 4OIQF 2J5AA 1FJ7A 3MECA 4LMYA 3R60A 1HKTA 5EG0A 3QGHA 2E5ZA 1ZREA 1T0FC 3MZIA 4X62F 4DZJA 1RTDB 3PQKA 2ZO4A 2LC2A 3UW1A 1O57A 4FTHA 1S79A 3ASOH 3IXQA 1REPC 1SXLA 2LRDA 2V94A 3V8LA 2BE7D 2VV5A 3GX4X 3OL8A 3UNGC 3M32B 3FDSA 2W9BB 2CQ7A 1RADB 2W7NA 1FYKA 2O8KA 1DURA 1LDDA 3MMAB 4XMYA 2CQGA 1S7EA 3HLUA 1XC9A 1X2NA 3QGPA 4JQFA 3SSSA 4DPYA 1NLKL 4XM3A 2LF7A 1MNMC 4ZKAA 3PX0A 2V6EA 4L9VA 4XAKA 3KK2B 4Q5SF 4K5RA 3TP3A 3PL8A 1BJZA 1RKJA 2KFNA 2GIZA 2ZJRF 5A8RA 3S2WA 2BRKA 2Z4PA 3GYXB 3K2AA 4EM1A 3IR5B 2IM0A 1EJ9A 2IC3B 2AHOB 3OXGA 4ZITA 1FKPA 3FHZA 2DLLA 3S1QJ 2JEJA 6PAXA 2ZHBA 2HQNA 2W9AA 1Q81T 2QSWA 5EEHA 2BW3B 3DV8A 3CO9A 3V4IA 5DM7F 2BZTA 2JSPA 3F8NA 2N3LA 2H4YB 3PSFA 4ENKA 2PD1A 3EZOA 4H4OB 1XD7A 3GG0A 3HDDA 1SFOJ 3R1HA 1NK5A 3FUYA 4I67A 2KTQA 4PPDA 2EFNA 3GTKJ 2JZ5A 1TKTA 1JJCB 1URNA 1FIAA 1RQ0A 2LA6A 4E98A 3ETMA 3Q0WA 3WHIA 3OHAA 2ZJQF 1D8YA 4LF4F 4ALZA 3JAMZ 2KJVA 4LF9J 3JTNA 2GJIA 5D8HB 1WWHA 1TL5A 5HBMA 1LW0B 2HIYA 3RKYA 2WHOA 3CJQA 3EUHA 4JV5J 2OPRA 1HQEB 1ZLKA 1IN7A 3HVRA 3M2UB 3MTJA 4YN3B 3TUZC 1R27B 3V7CA 1S6OA 5LL6d 4N5SA 7FDRA 3CCMI 4WZMA 2RF2A 3ZQ7A 2XLKA 1VHFA 2VJUA 3W6VA 3KOAA 3L09A 1OYEA 2EV0A 2DXFA 2W7OA 3CCQI 2OU2A 1TKXA 3VGSA 3M1EA 4A3GJ 5C5JA 3IWNC 4B08A 4B4CA 3CF5Q 2NSCA 3KYDB 3OS1A 5KFTA 5K20B 3CJRB 2VFRA 1OY6A 3WTYC 3CJ8A 5LGUA 2XB5A 1JLCB 4ECTA 1R8HA 3F0NA 3KLGA 2YWFA 3B6BA 1RUOA 1N0VC 5J2NB 2RVCA 4IR9A 2ZKZA 4RAYA 1OYWA 3ESWB 4C3IJ 3OS2A 5E79C 3MM8A 4OHWA 1PYOB 4PXEA 4A93J 1ZRFA 2OPSB 3W3SA 1HQUB 1IBLJ 3RZAA 1R5ID 2VQGA 1HBOB 2FLNA 1U8BA 4QSHA 3WU2C 2HOEA 2OEMA 1Y8QB 4KHPF 2DGUA 1TWHJ 3QJLA 1WOOA 5EGOA 2W2OP 2CUEA 2WVFA 4F04B 1S1UA 2FUG2 5F9LA 3CJKB 5C2GA 4AIHA 3D6FB 1X3ZB 4LRDA 4N8OA 1E6YB 2J76E 3LQQA 4AIKA 3M8EA 4ZC3A 2PDAA 2CNOB 3QMQA 2BY1A 4KRWA 4DPOA 1X1PA 3VQTA 5JXSA 4K0KF 1OJ4A 2F65A 3GONA 1LFBA 4AVPA 2YNGA 3W1YC 2J6TA 3X2QH 3UI3A 4R8UA 3QIPB 3CCJS 1IKXB 2DCEA 2DN0A 2LMIA 4ZJLA 4CXFA 1KWMA 2XCPA 1YW7A 2LEAA 5A8KB 4BGDA 2QCOA 3F6VA 4HX8A 4F0MA 5F1JA 1HHQA 5I3UB 1HMVA 3K1MA 4AWXB 3PQJA 2HLTA 1FTTA 1V4RA 2DOFA 4UY8T 2OO4A 3AJDA 4QIWD 1FIPA 4DW6A 4DYQA 4WFBQ 2WVBA 4DQPA 1J0RA 2FBIA 3BBBA 4O0NA 1JQGA 4RGUA 1X1DA 3BKUA 1LVAA 5K5OA 3TZWA 1HOMA 3J7A1 4B47A 2NVUB 4A8YA 2Z9OA 1FDDA 3MKZA 1T02A 2CUJA 3WX4A 3I31A 4U7UK 1R1TA 1S1WA 3FBNB 5J47A 1T7PA 3K4CA 4CCJA 1CVJA 3BOQA 2ZC2A 2LQ5A 4Z2XA 1RLCL 1XBWA 2K1RB 1OPIA 4ZVSB 4ZIVA 4I68A 1RYRA 1JT0A 4MAKA 4RNFA 3NAHA 3M9NB 2DYSH 2IVMA 1RAEB 2A3JA 3S16J 3DLBA 2H51B 3EICA 5LMUF 3BYPA 1VS3A 5F41A 2STWA 3ZXSA 2QKLB 5LGTA 4A3DJ 3WTVC 3CEDA 4RU2A 1F9NA 5J4VA 4HV6A 3D6HB 3LALA 1RAJA 3P8BB 4DX6A 1Y3JA 3KHLA 2VASA 4F91B 2D3ZA 1XNRF 3KLIB 2V2ZA 3H0GJ 3P7NA 3L2QA 2V1UA 1V5EA 4F92B 2NXJA 3KK1B 2JN6A 2RN7A 5FLXZ 2XHCA 2CWEA 4Q4ZF 3M8RA 1R58A 2E5LF 3FBCA 3BQZA 1ORKA 2X6WA 1HBXG 3CDUA 4M1KA 2DEJA 5J2NA 5FFZA 4EJWA 3O44A 3VWSA 3RGIA 1PYSB 3HSJA 3R7NB 3M8ZA 2E1RA 3GFYA 3KLGB 4IEJA 2XMMA 5EX0A 1BC7C 2XSDC 4PYAA 2FU4A 2XO7A 1X1BA 4GYGA 3DKYA 5B1BH 4PUSA 3CW2C 3BGRB 3LAJA 1S4EA 2C3YA 2FZCB 4XRFA 3D5RC 4MKVA 1PBUA 3TDZC 2BE2A 4ECXA 4B9MA 2LA4A 4KIGA 2M5WA 2JFDA 3D6TB 5E5NA 3VVUA 4PK4A 4YB1P 2MGQA 2VG7B 4G94A 2F40A 2BVZA 3D5SC 3NNHA 3JRFA 5LXRA 5F1RA 3SIPB 3BYRA 4I2PA 5LOQA 1WKJA 1TW2A 2V2QA 2PN6A 2GNKA 4FBUA 3ILIA 3C14B 3NGKA 2HFZA 5LJ3Y 3GIJA 2L7ZA 2Y1IA 1O4XA 2R5ZA 4A47A 2RREA 4KGMA 1RAGB 2O0YA 2MC4A 4Y2AA 3HPGA 5E1WA 1IW7F 3CWJA 5HQMA 2HPUA 3L95X 1JKOC 3MFHA 2HVRA 2LU1A 4F93B 4P7TA 3H1CA 4KGXB 2IA2A 2KM8C 1FNNA 4LK0F 2L0KA 1XS9A 1JUSA 1YZ7A 4BS9A 1ICEB 3MFKA 1RCXB 2D9OA 2GW8A 5D4OA 2EEYA 4ER8A 3K7RA 1WUUA 4I2OA 2FHJA 4I2PB 2FC8A 4UW2A 2EB7A 1MDMA 2NNNA 4PWDA 1FKOA 2QQ8A 1QSSA 4PZVA 1IRGA 1FF2A 1X3WB 1FTRA 1N34F 2IXSA 3BH7B 4F4WA 3UO0A 4Y15A 4B9VA 2P7CB 1YSJA 1OR7C 1PUEE 3NCPA 2NS8A 4I7HA 3M2VA 1RKTA 1DDNA 3PJRA 2RGVA 1VDHA 3HF5A 1QTMA 1R9TJ 2LQBA 5A8RB 4PJLA 2K27A 1X4GA 5DDOC 4DFMA 3KUEA 3ABLH 3VEPA 3TL4X 3R2DJ 1HL6A 2HFUA 1DTQB 1U5TC 3IA0A 1YQHA 2QMUB 2AYMA 3TUIC 5IYBJ 2WONA 1HNWJ 1LWFB 4OJGA 1VQNI 1NNDA 4L9JA 4C11A 4WFXA 1U0HB 1AZSB 2WA0A 4FF4A 2AKWB 2JTVA 1WI9A 4KFCA 4DN0A 1Y9OA 4DR7F 4C2UA 3BTLA 2UVVA 3IWXA 1EH6A 4FISA 3V6KA 4RW9B 1D3WA 1XMOF 2EK1A 1T2KA 3TARA 3KZYA 3L2WA 2JUCA 2PT0A 3R61A 4OIRF 2JK3A 2CNLB 2IAJA 4E7SA 5EG0B 1V3RA 4FHTA 1MMDA 2XM3A 3F23A 3PUFA 3WGHA 1M5PC 3PRVA 4XQFA 4ZVOB 2ZNYA 2HWIA 1X5SA 1ZYRF 4CGZA 4X6AJ 1MSFC 4DQQA 1MN9A 3RYRA 4YMEA 4UT4A 1YJNI 3KCCA 2QA4G 1U26A 1D3YA 1QGPA 4TNOA 2WOMA 4HR2A 5DG7A 1H72C 1S6PA 4CCNA 4IOAF 2EFGA 4DV2F 1NKCA 5IM0B 3CJ5A 3GEZA 2BKNA 1S76D 4DPWA 1MBHA 2GGPB 3GUDA 3TO6A 3UR3C 5BMZA 3BQ2A 3AXMA 4LF6F 5CH7B 1V9OA 2RE1A 4FXDA 3BG3A 2M52A 2B9XA 4V2GA 2Q3PA 2DEIA 1U8SA 3GTJJ 1HPZA 5E20A 4OJHA 4G3IA 1GNKA 4QW9A 1R43A 2YTCA 3OIPA 3P49B 4WE1B 3IG1A 3WC2A 3OR1C 3CD5A 2QIFA 4DL6A 2Z2MA 4RB2C 2HXOA 4NC7A 3RPQA 3IV5A 3MM6A 5CYJA 2B51A 2O01C 1YTYA 3ZMDA 1U1MA 3DI6B 2WAFA 3FJ2A 3I54A 4OJ1A 5JLWA 1OQ3A 1JIHA 2BJDA 2MD5A 2IM1A 3W60A 4UUVA 1R31A 2KI2A 1SIZA 1WEXA 2BANB 3I9V9 1IKXA 2QBYA 3DLHA 3J7ZI 2ZD1A 5ERIA 2CW8A 5HO4A 2ZCWA 5HMZA 4IZZA 5EUHA 4YB5A 4RKUC 4ECZA 1FSEA 1O6XA 3CCQS 2QSFX 1RT7B 2VOPA 3PR4A 4LT6A 1Q1HA 1H89C 4LBHA 1M5HA 2YWGA 2CJJA 4EBDA 4MYUA 4ETZA 4JI0J 4J9SA 2IPQX 4CCKA 4WKRA 2G1DA 3AB4B 2HHUA 2H6BA 4O0IA 2CAJA 5B3SH 1BQMB 1T33A 2GC8A 2JFKA 2L48A 1FDAA 5DCMA 2MSYA 3NKYA 4PR6A 2HGCA 1YRNB 1J5OB 2UUTA 2XPVA 4FE4A 2FQQB 4OZ5A 2A6OA 1BL0A 3CD6S 2DO0A 5KOXA 4N9IA 3MPWA 4LF5J 4QTRA 3DKXA 1DTQA 4BC7A 3BM7A 4KNYA 4NA1A 5CJ9A 1JJ8C 1XTAA 3KLIA 5KT5A 2DA1A 1B0PA 2W2QP 1HBNA 3CJSA 2R8GA 2C22A 1QRYA 2DISA 3FRZA 1HQ2A 4FPIA 2JX2A 3OR2B 2J0SD 4ECSA 4J9QA 4GO7X 3CMEI 3P9KA 4EK2A 2XF5A 4XSZF 1OQ6A 1J5YA 3MZHA 5DS7A 3HGYA 1W25A 1JLEB 2YWKA 2XS5A 2WADA 2MW8A 1NHVA 2WV1A 1HBUA 1C4AA 2QYOA 4XBFA 1TFYA 1QM9A 5M3FJ 3G2BA 4ECUA 2XYPB 2M0CA 1MDMB 2J7KA 3FXUA 1IJEB 1Y5LB 2ZBQA 2JWNA 1PAUB 4CCLA 1Q5YA 1RT1B 4RZRA 2ASLA 2CPJA 3FK6A 4R8UB 2L9VA 1R22A 3E8OA 4A6EA 2FHOB 1W7PA 2AX1A 4UY85 1VQ8I 3AA8A 1Z9CA 4QOTA 1C0UA 5F3TA 3Q2SC 4JI5F 3ZFVA 1V5GA 1EKRA 4OAYA 4KKOB 5M2PA 5KFKA 4DR1F 3G2XA 2VQLA 3E5UA 1JNRB 2DNMA 2OTJS 1JXVA 2MD0A 5DO2A 2MLKA 1DPUA 4MFEA 1Q53A 3Q23A 5CPRB 4RBUA 2Z5UA 4EATA 5FKOA 3G8QA 4JB8B 4FS2A 1I6HJ 2PFFB 3ZN0A 4G1QB 2DGWA 3MM9B 3J81K 1IJWC 3W64A 2QLBB 4XOTA 3QIDA 2LMDA 4C8MA 4PGHA 3W7BA 2RIJA 3QYEA 1WG4A 3MPDA 1WZ2A 1H3DA 1QAIA 1GXQA 1Z7UA 2HS0A 1IN5A 2CQ4A 1XQIA 3DU5A 4U7CA 4IRCA 3H2VE 3OJSA 2VA3A 3DYAA 3VTIA 3K4KA 1DP3A 2VPYB 1B64A 3GPAA 1F1ZA 4DMZA 3DPTA 2MB0B 4A3IJ 3QRPA 4UUTA 1UFLA 1CJUA 4MLOA 3LA7A 3G71S 2KKOA 4NWBA 4NOHA 3CESA 3H5UA 1OPZA 4TYAA 2XWYA 4CUGA 2NXEA 4IOAQ 5ICCA 1SH2A 1FVQA 3A03A 2PQ8A 1RHUB 2O66A 3ZP5A 4D3GA 4MEXF 3I4HX 4OHVA 2X1FA 2CV0A 1G3OA 4F8RA 4DSFA 3QLHA 1AFIA 4UV9A 3QT5A 3SQNA 4LG3A 3AY0A 3CJQB 2V8GA 4D3HA 2N82B 2K02A 2HNDA 3KEOA 1W36D 4J91A 3IAS2 2P81A 3CCSS 2D9PA 2XHWA 1GEHA 3CCMS 3VPRA 1QLNA 5LEJA 4RB0A 1L3KA 2VKZG 4J9RA 4PG5A 2ZHOA 4BBRJ 4LLLA 2OSQA 5H9EJ 3LW5C 3CUNA 1M90T 1T98A 4M5JA 2XY6A 1UPPA 1LFPA 2MY8A 4OYBA 4IO9Q 3I53A 2HAIA 1UJ4A 1N33F 4K7QA 4Q43A 3NMRA 3OR1B 4XLFA 3RBDA 2LTPA 1SL0A 2RT3A 5JVGQ 5D5WB 4IH7A 5L3GA 2RUGA 5GAHI 1XK8A 2OEKA 1X3UA 3MXHP 4GXOA 4IO9F 3H0DA 1SJQA 2XYHB 2HBRB 2P6TA 3WTSC 4OMYA 3F0CA 4MKBA 4F4ZA 3NBPA 1JKHB 3PW7A 3HZJA 4DR5J 3DEEA 2AQFA 1HNWF 2KZVA 3THTA 1YJ9I 1JXSA 5HDKA 2YR2A 4CLWA 4HI2A 3SSRA 1KU2A 4A8QA 4L74A 4ELVA 2LKPA 4U7UD 1KN6A 1WELA 4X4OA 2OELA 5IOZA 1S29A 5DZ6A 4IXAA 4E0DA 1MZBA 4IHWA 1S9GA 1FWKA 1F3FA 5B0BA 4CO4A 4P6QA 5FKNA 1X19A 4CO3A 2F3JA 2W4CA 2ZFWA 2PJPA 1CJUB 4ED2A 2DBBA 2YKOA 3RBXA 2OPPB 2XI2A 4P74A 2BJ8A 3F8CA 4G6TB 3DLJA 3FBFA 1C0UB 4IHSA 4DV0F 2CUYA 4BHQA 2XKOA 5BXIA 2V67A 2UV8G 1O8BA 1S72I 3FSXA 5KFOA 4K4SA 2GIVA 3TZZA 1R8CA 2C1EB 1R7JA 1K1SA 3TEHB 4DL0C 1N5TA 1Y6IA 4KY3A 3BZKA 1EIYB 3EDRB 1LWCA 2Q6BA 1R1UA 2ELKA 3W9IA 2HU9A 1EARA 4NLUA 2Y75A 3CTRA 3GZ7A 4L73A 1VK3A 2C2KB 3BN4A 4DL5A 3DBHB 2K3PA 4PG4A 1G4CA 3BH6B 4CT9A 2EH3A 4HACB 1S1TA 4RJVA 1A6LA 5DQHA 2R2SA 2IA0A 2G0EA 2FBHA 4WYLA 3R9LA 5I4MA 4PEOA 2AJQA 2H48B 2IRXA 1CULB 1UZDA 4R79A 3R4KA 2QLXA 4QR1A 4JX4A 5KAKA 1RWUA 1KQGB 4ZPTR 2HSEB 1EB0A 5KG0A 1J59A 3MVPA 3FMQA 1JB0C 4LR7A 3MZ8A 2ZKUA 5DJBA 3LP0A 1X9WA 2KN4A 4HVZA 3HKWA 3IS9B 1JTXA 2BMBA 2Y31A 3MCZA 1SD5A 1RETA 2AW0A 1NPRA 2ZITA 4OIOF 3K5OA 1UA0A 4QYZJ 2DXDA 7AT1B 1IUJA 3ISND 4ZTJA 3FKJA 4P75A 1JKPC 2BOPA 2E9TA 2D41A 3FXRA 2FMYA 4LIVA 2IDEA 2E2JJ 2AYGA 3KUHA 3N5BA 3NGDA 2FVQA 2UXDJ 3NEKA 4OYMA 3ZNUA 1Z77A 2NNYA 1HSTA 2BQUA 3DTEA 2JH3A 1KD1T 3VSKA 1UELB 1PUFB 1A9NB 1B7FA 5F6FA 2H4WB 4X4VA 3JRIA 3O5TB 1ZRDA 1WEZA 5HLIA 1ITYA 3GTQJ 2B0LA 2Z58B 1LK5A 3C1DA 2Z33A 1XR6A 4EMSA 3CC7I 3UN3A 1DQUA 4PRFA 3IG1B 1OCZH 1EF4A 1AOYA 1VNDA 1EQMA 4JP8A 2CWKA 3QAEA 5ETNA 4ILRA 2E5IA 3DEUA 3I0RB 4YG2F 5DV5A 1AW0A 2CRLA 1GH8A 2X7IA 2BEFA 4QIVA 4B3SF 1LNWA 4BWJA 2BHYA 3DHWC 1LDJA 1C1CB 2BV6A 2M8DB 1JLFA 2FHMA 2M8EA 3P3DA 2M7SA 2VPXB 3W2VB 1FJCA 2O3DA 4E7IA 1CS4A 4X65J 4YR2A 2RB7A 1FT8A 2DA6A 2R42A 1KQFB 5E3LA 1TELA 3MM5A 4O44A 4LSNB 2Y0SN 3QRRA 3RSNA 3V6HA 4AD6A 4KISA 2TCTA 1S0OA 2ZBRA 1FC3A 1UZHA 2B8QA 3ZZYA 2HZAA 1K8AT 3LTOA 3DOLB 3P6YC 2VPLA 4UOCA 2PGCA 1YIJS 3PYEA 1GQEA 1YX3A 2OCEA 2XMUA 5J1PA 2E19A 3FXMA 4C3JJ 4NI2B 5BYQA 1HSJA 2DA5A 4YFXF 2HHPA 3ZZRA 3M8FA 4ZYEA 1O3SA 1NHKL 2A5YB 5B0EA 3TX8A 3J7Z5 1DARA 1P6RA 4ATNA 3KP3A 3BSCA 1S4FA 1WPKA 1IKWA 1ZM9A 4HF1A 1FX4A 5B0AA 1D9FA 4HI1A 3SFZA 4JI2F 3WTZA 5CVUA 1F4KA 3JRCA 1KQ0A 3WHCA 2Z56B 2AS5F 4DV1J 4FYWB 3CDHA 3TI0A 2KVQE 4BBSJ 2HMIA 2DGXA 4C98A 5TGTA 4ETSA 1Y00A 4P71A 1YITI 4HACA 4F26A 1IKYA 3L2RA 3K1PA 1RT6A 4C8YA 1XTZA 4F7ZA 1PBAA 5F0CA 3TVZA 1VHIA 3S8SA 4DL3A 4MMOA 1LEOA 3C16A 2DY9A 2DNRA 5CABA 1G3TA 3MMCA 3HHLC 4ZZLA 2FQ3A 1S57A 3FEYB 4P2FA 4DV6J 4QWQA 1NM2A 2F2EA 2KL8A 1YJTA 2L3MA 4CLSA 1KHWA 2DAOA 2AYBA 1TL3A 1D0XA 5E8GA 2ZJQQ 2EBGA 5J1RA 2IJFA 2RNEA 2HVZA 3VHQA 3M8PB 1SCJB 3S93A 1KR4A 4MKAA 3KJVB 3DFGA 3NXZA 3REOA 3K1NA 2B7EA 3OL6A 4F2SA 2MKYA 2F5FA 2CDQA 5D0HA 2HMIB 4ANJA 4E7JA 2PA3A 1LWFA 4DU8A 3DDKA 4JYAJ 2V2VA 4DR3J 2C2NA 3V4MA 2HQCA 4FBTA 4IQJA 3A8JA 4IQ4A 1WVRA 2VFVA 1U1QA 1BQNB 4BH9A 3ZXWA 2IYIA 3MWMA 1X7VA 2HHQA 1VBYA 2R7FA 4RUAA 4DV6F 5CKTA 1ZS6A 4Z37A 4ANDA 4ZVFA 3FDYA 4ZYDA 3M2VB 1XNRJ 2BACA 4F4XA 2HVIA 1X31C 3G4SS 3THVA 5CLSA 4CNYA 3O8HA 4OLOA 3OXFA 1HARA 4DCOB 3B54A 2NPFA 1ETOA 5JLXA 2BE9B 5KFEA 4X64J 3QJPA 3S7RA 5LMUJ 1TV6B 1Z7LA 2HQ5A 4B48A 1O7FA 2CQHA 2GO8A 4FF2A 3WDOA 2CU7A 1IM6A 3HHKA 3O6BB 1S1XB 3VGVA 3GFIA 3AD7C 2LU2A 5HLGA 2COLA 1X5TA 3DTKA 1VCTA 3DRXA 1TP4A 4ZHRB 1VIXA 4HG2A 3KLFB 5H6QA 2OGUA 2HWTA 4QU7A 1LKXA 2F4IA 1I50J 4HF0A 4RBOA 2QMXA 3N5FA 4XIDA 2DI3A 2PMWA 2QL9B 5HVFA 3DLKB 1C2PA 2WSCC 3BSNA 4ECQA 2YPZA 1QE1B 3Q8PB 1Z1ZA 3JSOA 2HGNA 1BXNA 5BPDA 1NJWA 1ON1A 1AHDP 4XONA 2Y0SA 4DBQA 1NG6A 4MIAA 3OYEA 2KLOA 4E7ZA 1FX2A 4C4WA 4YDXA 2YKNA 2OZUA 3C19A 4E2FB 4NCBA 2PG4A 6FDRA 3H9GA 1XNQF 3GR1A 3QO9B 3BGRA 2ZJPF 5J2PB 4D1QA 2BJ7A 4DF8A 3FQLA 4G7ZF 3DLGB 2HFVA 4DGWB 2FBKA 1QUPA 2K7LA 4N47A 3CB4A 3HBLA 3KHRA 2G9OA 3W2WA 3EYIA 5I42A 5CA5A 2V9WA 4YHHF 5LMNJ 1FWLA 4J9LA 4WFZA 1SFXA 4ZLJA 4NCGB 4F0KA 2MHEA 4UVBA 1M5KC 2DK5A 4KYWA 4EU0A 4L9TA 3C15B 2C3UA 3BZCA 4WX9A 4JI8J 1XWLA 2V79A 5D0EA 3OWTA 2A5WA 1FOYA 1G1XA 1HD0A 2JRTA 2L7KA 2EKNA 1F5CA 4ZPWR 3Q9SA 3HOYJ 3GF2A 5C24A 1GMUA 1U78A 4W97A 3DKWA 1IV6A 4DJAA 1DGWY 3JAMK 3KZZA 1UB9A 1L3TA 2QSFA 4C8NA 2ACMA 3GO5A 3GJSB 5DGBA 1HWIA 1S1VA 2QA4I 3PZPA 2KYXA 5DZ7A 2KT3A 1SUQA 2QQ9A 2VOOA 3HXLA 1WH5A 2UXDF 1QSLA 5DDRC 2X1CA 3P9IA 1IGNA 3NY0A 4ZHRA 4TQRA 3EGVA 2CQDA 1BOBA 4A6DA 5J4YA 4U87A 3GSIA 1Y11A 3CNQP 4JK1X 2A05A 1YBUA 3DN9A 5DEQA 5TISC 4C2MJ 1RT3A 3LWLA 2FA5A 3R7BB 3LGHA 1SQFA 1A6IA 2W4PA 2UU9F 3ENWA 3A3OB 3DYAB 4LVNP 5KG2A 4LLNA 2FNAA 2YSRA 2XGQA 4K2EA 1Z21A 2VKEA 3BPDA 2XZWA 1C0TA 3T5HA 3ZZ0A 3DDNA 4S04A 3PO4A 4FVCA 4A69C 3HRSA 4LVOP 4DR6F 3J7YJ 3HSRA 3D1HA 3UDLA 1R3NA 4E7KA 4ANCA 3PO3J 5DD8A 2RAQA 2CRGA 1RIOH 5D0GA 3RYPA 4MFBA 2Q6CA 4HQMA 4L18B 5KFBA 2CPHA 2BM0A 1IRXA 3M2RA 4KHPJ 2FZKB 2MKSA 2ZZTA 1S9EA 3QODA 1VI0A 1MG7A 3CD6I 4WCGA 2PFBA 2E1MC 3DF8A 1HQUA 3H36A 1B70B 4M63A 3MDFA 2WB1A 2ALZA 4AT1B 4XNFA 3OYNA 2KQRA 3AOAA 3MD1A 1T05B 2UUAF 3MMJA 4ZH4F 4DZ6A 5KFCA 4QPXA 2ZH2A 1YYVA 3QOPA 1A6QA 2VQFJ 2GS8A 3NL0A 3BR6A 1HI0P 2A07F 4DS5A 2MZSA 1LB2A 3QAUA 1R0CB 4OYAA 2J9DA 2FXAA 4LBIA 4X62J 1WRJA 2V8HA 1UJ5A 1RT7A 3D1NI 1RT1A 2KT5A 3ZMZA 1H2UX 4BHCA 3MMCB 1U24A 5L39A 1RABB 3K0JA 2K9LA 2X6OA 3OYIA 2CQCA 2Q1ZB 1MBJA 4JOUA 2GHWA 1PSDA 2KIFA 2EG1A 3ILOA 1E6VA 5DM7Q 1R8AA 2AYEA 1AWCA 2LBFA 1H7XA 3DI6A 2AJ0A 1S7OA 3R6SA 3OR2A 3L2UA 1JE8A 4PJNA 1G3YA 3PNIA 2IEKA 3C2HA 3TGNA 1HBMA 4QWDA 1MN7A 2YY3A 3US5A 3JQMA 2CSOA 1WWXA 5FKKA 4A8XA 1VOMA 5L3FA 3LOUA 3IRRA 2ACJA 3LA2A 2VFTA 2ZVSA 4RLEA 5KT3A 1VQLI 4ES3A 4E6KG 3TA2A 3W8PA 1HA1A 5E8IA 2PX9A 4WXDA 2CJAA 4QZVB 4RW6A 3P5JA 2G0JA 2V63A 4KQZA 5DCMB 2JPBA 3FKBA 2FSWA 1VQ7S 3FZBA 1GK8A 3PTWA 2HVEA 4KGVB 1N6QB 2MZTA 1KSPA 2B4PA 4ANEA 3FKIJ 3M9OB 3OOUA 5KFVA 5HAOA 1Q8LA 2DMTA 4WBFA 5DDQC 3T6JA 3DXJF 3T1YF 2M70A 5IOYA 1U47A 3U1MA 1QVUA 3S14J 3CLOA 3IP0A 3MCNA 2HHHJ 1NCLA 3W6KB 4ZVPB 2C2OB 4ZVHA 2J5OA 4J9MA 1FP1D 1VQMI 2MABA 2WRMA 5IS2A 1T05A 3QPTA 3X3UA 4M5MA 2IAJB 1KS2A 3GTYX 1F9HA 2MMYA 1KYWA 4M5DA 3S32A 4KPYA 1WOSA 2I2YA 1VQ8S 3LSTA 1BMQB 1JXEA 2G2OA 3C3WA 4BCAA 1FXRA 3BR9A 1RPWA 2CYYA 4B9SA 3CJTB 3E5XA 5GP9A 4PJ0C 3DCAA 1K44A 1EH7A 4XRSA 4JI2J 3MKWB 2H8RA 1Y8RB 1IC8A 3BDPA 2HRUA 3IRXA 1VQNS 1WQ2A 5D3GA 4Q0BA 2XB0X 4C11B 4NLPA 4LF6J 1K78A 1FFWB 2RQPA 3JB9k 2ZOGA 3RB6A 4FCYA 4OMFG 4HKQA 3L00A 1T94A 2IW5A 1D8KA 1RI7A 1RWOB 3G96A 4BJ6C 4ENJA 1EH8A 1HNVB 1Y0HA 4IVNA 4A3LJ 1X4CA 3OR1A 5F0WA 2HHHF 4HEA9 3WG7H 1PUFA 3G4SI 2DK2A 3BDDA 4NC6A 2R3VA 4A0ZA 1YE9A 5M5YJ 3HGGA 1KOHA 3I96A 4B3RF 3DTIA 2KDZA 2WSFC 3QRFF 1U49A 3H5YA 3MAJA 5E3AA 5GADU 4A3KJ 1RK8A 2P0WA 2ACYA 4X4TA 3JAMY 4YHHJ 1D0EA 4LF2A 3QBCA 1VQ5I 2YU9J 1SC7A 1UWBB 4DUZJ 1UVLA 3KG0A 1Q82T 5D5UB 4OQJA 1MMNA 3CDEA 1FVSA 2DR5A 1QDUB 4CYCA 5IYCJ 3SV4A 2QQAA 3R8YA 1NSPA 5DM6F 2ZMEC 2VBZA 3O1LA 3A0BC 2DPDA 2EXUA 2OPQB 2NVQJ 2UXBF 5HBMB 1RWMB 3MQ0A 4Y2KA 2XSJC 2R5ZB 2LEPA 3GMEA 4LFCF 5ETMA 2R2RA 1RZ4A 2EWHA 2W00A 4PFOA 4DQSA 2NSBA 3CCUS 3ZTQA 3OTDA 4LQ9A 3DBRB 4Y0FA 2KG0A 3KKFA 2GM4A 4M9XA 2D3O1 2PC6A 5FLXK 3GCXP 2M4MA 4P9SA 3T0YA 1ELOA 4R5PB 2BOLA 1FX7A 3MEDB 3BS9A 2WAQD 5F9NA 1VC5A 1FWZA 1UZCA 4FETA 3PKMA 1TWAJ 1XDSA 5GAHU 2HBZB 4N7TA 3O8WA 3HVWA 1LFUP 3RYLA 4CZCA 1X4FA 3CCRI 3RTRA 2ZH5A 1FKOB 1VRTB 1PVEA 3VB2A 1UCNA 4WF9Q 2ELHA 1TVRB 3H2LA 4ZVTB 1BJAA 2DDAA 3AHPA 4CI0B 1EZZB 2UUCJ 3VAMA 3AD9C 2HVSA 1ZARA 2A68F 1F5AA 3VZIA 4DV4J 2H27A 2QE5A 1TTYA 2EZIA 1YJWS 2NZ4A 4A5NA 1YIJI 2BY2A 1P2FA 3IR7B 4HW0A 4CLZA 2CV2A 2DR8A 5FDLA 1YGYA 2GAHC 2UUCF 2OUGA 4IOBA 5DLGA 1PCAA 2XUBA 2DXEA 3DRPB 4R25A 2EILH 4JUZA 5FD6A 1HPZB 2IFXA 3BJAA 4LLGF 2RDDA 3S3MA 1TV6A 1UVNA 2D2WA 2FTRA 4BKXA 5EF6A 2HLUA 3HZEA 2ECCA 2OQGA 5F64A 1ZTRA 1BGXT 4OYWA 2NRAC 2Y69H 3ABMH 2V4JC 4IOCF 3D1OA 3GILA 2ELJA 1DQAA 1RTZA 3SDEA 4XLHA 4IG3A 1Q5VA 4UQTA 2QC3A 2QJ3A 1MBKA 2JLEA 2ZFUA 1UVJA 1MWQA 2F5VA 5DGAA 4KHRA 2QX0A 4B9LA 3K70D 4FYVB 2DRDA 2OPTA 2AF6A 1NO8A 3KE2A 4DSLA 1VRUB 2GQQA 4M3DA 4PG6A 1BUXA 1S9FA 2V8DA 5LD2C 1DP7P 5FRMA 4P2SA 1Y1VJ 2YKPA 3QQAA 4C8ZA 1RR8C 4Y34A 4HX4A 3LGMA 2CA9A 2DNQA 1X1AA 1T56A 4M3GA 2HNDB 3PV8A 1KFSA 3G1MA 3R97A 1JGSA 1HHSA 2DQLA 5D3GB 4LITA 4EM2A 1SVMA 4NLQA 1D8JA 4OZJA 1SJ3P 3CMAI 3K6GA 1O7LA 4I4BA 4OHZA 2E1CA 3TJAA 3WBZA 2WB1N 3ZO7A 3FRYA 3CCTA 2JRSA 2CDRB 4URQU 4DV3F 2IJRA 4CDGA 5JMNA 1Z3XA 4O3NA 1IKVA 1JK9B 1SI9A 3T9ZA 1K47A 1FFGB 2UUZA 3ZR8X 2F6CA 2JDJA 1F5TA 4E70A 2CJBA 2NXCA 2HNHA 1Y1WJ 1U5TA 1Q1KA 2AHQA 1IDZA 1FK9B 4I7FB 3JRDA 5E1XA 3A12A 1CS4B 1WJ5A 5K7HA 5D8KB 2MH2A 2NXNB 1BHNA 1WKMA 2Y48A 5HLHA 4DV7F 3AOBA 4ZVEA 1LUJB 1EAYC 1NK0A 3HUGA 3KP5A 5J8FA 5ETVA 3PFYA 2P9CA 2ZOMA 4AYBA 4A5MA 4BEHA 1GTHA 2KISA 2MYFA 1LE8B 1F9EB 2ZJRQ 3FXLA 3KPHA 4S05A 4DV5F 2K8GA 5F8LA 2MQLA 2W1OA 2C3OA 2DMQA 1YW8A 2VQEJ 3HHEA 1QZYA 3ZMUA 1Y56A 3D0SA 4WXOA 1WCMJ 3BZ6A 3LSHA 1M1EB 2C2MB 2CPEA 1Z6RA 4BL0B 5B08A 3RBEA 1J9IA 3AG4H 3RJPA 5J6XA 2CJYB 2R0QC 2CPZA 1TKZA 4DPUA 4CNZA 4TU7A 1JKRC 2JA7J 3U02A 1D5YA 3LUYA 5AXMA 3WC0A 4O5VA 2BHZA 5FDLB 1SC1B 1WJFA 4DZDA 5LHHA 2KHDA 2P8TA 3NAUA 2VICA 3KG4A 1TQPA 4I02A 3VAIA 1FOXA 1CQNA 1FTCA 3ISZA 5EZGA 1FTZA 1D1BA 3BC8A 5F8JA 5CD4H 2FJBB 2UV1A 2V1DA 4PFPA 4KPCA 4M72A 1RHRB 1CJKA 3HHHA 3VFZA 3UVJB 3JRBA 2NUHA 1XGNA 1H2TZ 1RP5A 4X4RA 3QAHA 1TL1B 2XY7A 2ATLA 3VAFA 4KT0C 4PDKA 3TAQA 3WX8A 4DR7J 4UOFA 3KJQB 2EQRA 4R5PA 4H4MA 4OZLA 1X0PA 1U2CA 1V3ZA 4X4QA 5L1JA 4J9NA 1T3NA 4JYAF 3ZNJ1 2QEXI 3V6JA 3E6MA 1ZG3A 2FJEB 2DTJA 2QTWA 4Y2MA 4WXCA 4II3A 1GLNA 1HFEL 3NCRA 3LSPA 3RRKA 3K5MA 2B9YA 5E33A 3DNCA 1TKTB 1TKDA 1DJ0A 5A6WA 2IA1A 1X2MA 4DHVA 4OIPF 1N78A 1O5JA 3SSQA 1A04A 3OUYB 5KG6A 5ILSA 3NGTA 2VBYA 1F2GA 2XS7A 4FYXB 3GWCA 1WJ9A 3DOKB 3DXSX 2QUFA 4AFFA 4J9UE 1VQ7I 1QUVA 3H90A 1FKPB 4HQEA 3D28A 3HB9A 1AROP 2BBEA 2RRBA 3K69A 2V9VA 5KT7A 2OC6A 4IQMA 4DSIA 3HRTA 1HLVA 2HWVA 5HQ8A 5DUIA 2UUWA 1XN7A 3PUBA 4OZ3A 1U48A 4KJZA 2BABA 4U95A 1P6TA 4L9NA 3MR6A 3JREA 2STTA 1H7WA 4A3CJ 2DA7A 1E0EA 1GMWA 3HSDA 1FRXA 1GXUA 3ZQGA 1NZAA 2K5CA 4J7CA 1S0MA 1S9GB 2CPFA 3H4DA 1UHWA 3R5CA 5MAOA 2ZXHA 5L46A 2XF6A 3SCLE 4TLQA 2CQNA 4BY7J 2HGLA 4YEAA 3LNQA 1ERDA 1GMVA 4I69A 1S1VB 3NRBA 1KHVA 3CTAA 3QWLA 3PG9A 4FX0A 2LR8A 3A02A 4DX7A 3HO1A 3GLLA 3HI9A 1UEKA 5EYRA 4DF4A 4LFBF 5HDNA 3DLEB 4IOCQ 4JI4F 1OY9A 3IKVA 3AJ1A 3L9FA 5IT9Y 1FBQA 5KFDA 5GADI 2J6UA 1F43A 1EKSA 3DP7A 1VBKA 1RWXB 3PNTA 1JT6A 4MYTA 3TANA 2R7OA 2K4BA 4ZYGA 3NWGA 2AJFE 3VALA 2D1VA 1RB0A 3OYDA 1NDLA 5JI6A 2AJ2A 3D6MB 1U1PA 3LAMA 3OYAA 2Y9HA 5ETTA 2P6SA 5HS9A 1P8GA 2VKHA 3CJ4A 2XBPA 1VQ9I 4PQUA 1RKIA 3G8TA 5E1ZB 1FRLA 1NK8A 1X4OA 2J8AA 3K4NA 5C44J 2YNGB 3J7AN 3Q2TC 1RYSA 2J0QD 3PXGa 5E18F 5C3EJ 4ERDA 1KEKA 4NYPA 3QNWB 1T08B 2XAGA 1FFSB 3K4BA 3W6JB 5EEAA 1L3LA 3ICLA 4JI5J 2H8WA 1FD8A 5LEKA 1F3VA 3PYGA 2PFDA 5B0GA 4DR4F 1ZAWA 1F36A 3HPHA 4OFZA 4RUHA 2QYCA 2L7FP 3P9CA 1F0XA 3LSMA 1X4DA 2M7BA 1WF2A 3NOCA 3CCES 1SEUA 2JL9A 1OO0B 2VC1A 1SANA 4MQVA 4LRAA 3N6MA 4ZLPA 4YB7A 3I5UA 4LJMA 3H35A 2XG8A 2DXIA 1TT5B 2MQOA 3KUGA 4CDIA 5HP1B 4NPOA 1H8AC 1G4DA 1UVKA 2MKJA 4LRBA 5J2MA 3V6DB 1D09B 3DLAA 2MXYA 1K9MT 1SMTA 3I0SB 3D66A 1VRUA 4XICA 2ZC3A 1O51A 3EUKL 1WF0A 5I3PA 1FJGF 2J0WA 4IKAA 4FF3A 1HKQA 2HTJA 2EZKA 6FD1A 3SHFA 3KLEA 1RAHB 1ZETA 2CNNB 1NTCA 1SQGA 4PXBA 2B6AA 1MBGA 1KLNA 5THWA 2DRAA 2VB6A 3LANA 5KFXA 3KXDA 1HLWA 4FNIA 1M1GA 1N5QA 1BQXA 3EYYA 1T03A 2V1XA 3WIUA 2CQ3A 2XRLA 2JVOA 3AAWB 2DFIA 3CC2I 1UAAA 1FRKA 2LKZA 5AXKA 1AB8A 5ETRA 5CYMB 2P5VA 3TUPA 2DR6A 1SJRA 5KT6A 3MEEB 4IJAA 3WTXC 2YKAA 5BYSA 2JRMA 1QHGA 3CC4I 1WTFA 1BQNA 3M2UA 3QP5A 2X9DA 5M5XJ 2GZOA 2I5JA 4RUCA 2AU0A 3ZOBA 3J80K 3GZ6A 4FVMA 3B6AA 5L38A 4EZ6A 2DFHA 4IFYB 2XGPA 1XJWB 2FY1A 3BP8A 1WGXA 4LOCA 4R8HA 2HEOA 2MKHA 1XSVA 2LY1A 1NK3P 2HNYA 3B82A 2R4GA 1N75A 4W4MA 5L1LA 3DLLF 1SC3B 4L5JA 2OTLI 2UVUA 1N88A 3KP7A 4E8UA 2ZMEB 3DC2A 3QFWA 3EZUA 3GP9A 1M5OC 5K8MA 3EUAA 3BBCA 5GPAA 3K4MA 4U8YA 1IWAA 3SFUA 2VG7A 4IH5A 2EZHA 1HBUB 1NPKA 4NLXA 4Q45A 4G7HF 3FCHA 1WJDA 3VAGA 3WTTC 1QTNB 3G1OA 2BE2B 4U6PA 2WZ1A 1T38A 2O6GE 1RTJB 4AUKA 4EV0A 5E3OA 5C2CA 4JV1A 1HWUA 4JI7F 2IC3A 1VQOI 3SZ2A 3F8MA 3VAHA 2JVHA 2XZDB 1HWJA 3W8GA 2H9ZA 4CLYA 4BXUA 3PYFA 4OX7A 1HDPA 4I1TA 2FVPA 3A3NB 4C8LA 5C7PA 3BR5A 2PLYA 4B43A 2L08A 2RILA 4ZDPA 4HLXA 3L2VA 1W5SA 2CIMA 2RHQB 3MMAA 5CCLA 1P7IA 2LDIA 4KMUX 4USIA 1R36A 3HHGA 2X1BA 4PPZA 2VPWB 2E66A 5EWGA 3OHBA 1WJCA 4KKOA 4KIAA 1UTAA 1OYIA 2AT1B 1ZELA 3M8PA 2A2DA 1RT5A 2V8PA 2VDIA 5ETPA 4I56A 1IO2A 1SVOA 2F9DA 2K85A 2R3SA 1QVTA 3KLOA 2DNGA 1REVA 3GYGA 2XAQA 3NMAA 1ETQA 3I4NJ 4Z7CA 1U2FA 3DOLA 4R0JA 2YNHA 3EYZA 1AT1B 2O8XA 2DD8S 4KFBB 4Q44A 4OINF 1MIJA 1VQOS 2PMZN 2GZWA 3TR5A 5IV3A 1R0AB 2JEIA 1QBJA 1FPQA 4P2MA 4HHHA 3LSIA 4Z7YA 1HYSB 3T5KA 3N97A 3TVYA 1ETXA 1Y5IB 2IYGA 1X58A 3H3UA 2XSJA 4EWTA 2R7DA 3K7AJ 3KP6A 3WE2A 2H1KA 3HCXA 4RA2A 2BY3A 4LIUA 3BF4A 1D1CA 5B0FA 3SCIE 4LRFA 1LWEA 4DG1A 2KXNB 2BBYA 4LF4J 1J2VA 1LXJA 1CSJA 4A3MJ 4U88A 4HNTA 3QO9A 2Q43A 1O3RA 2DCUB 2K86A 2DA3A 2NQPA 4NQWA 4UHTA 4AIDA 1LDKB 4LSZB 3V8KA 3CCEI 1VBZA 2VJ4A 1YI2S 2FOKA 2GIFA 5ED4A 1O3QA 1IKVB 4DPXA 3RW6A 2LECA 2BYCA 1YO5C 1XSXA 1K79A 5ICGA 5CCMA 1Z0XA 2YUSA 1X60A 2HNZA 2HS3A 3OIOA 4DR2F 2EPIA 1QVGR 1RTHB 2C2RA 1SJ4P 2WVCA 2WOMB 2CPIA 3J81j 3QWUA 3BJYA 3T6BA 1OCTC 3F73A 3NQOA 4ED8A 4DUZF 3E6CC 3RZOJ 4NUBA 1VFJA 3FF5A 1DU0A 2W9CA 3VQSA 3ZPLA 1KP6A 4X66J 1KZHA 1ETVA 1KLMA 4OYIA 1WI3A 5KFWA 2Z1DA 3TO7A 2XASA 2KIUA 4ID5B 2P7VB 1WTBA 4RPFA 2W9BA 4DQRA 2VG5B 3F56A 1G6BA 2CG8A 5GAGU 3E51A 4B8XA 1Q1VA 1AZSA 1APLC 2XCAA 4OZ2A 4LQ3A 1CQMA 1M5VC 1WOPA 2NS1B 3IUOA 5HROA 2VKVA 3CCLI 2V9PA 1TQLA 3OYHA 4GYIA 1B8IA 2BW7A 1N52B 3BBFA 3EPIA 3DMJB 5GVQA 3ABKH 4WU3A 1ZHFA 5F0HA 4LR8A 1DRZA 2I1RA 1UJ6A 4A0XA 3Q8VA 2V6CA 3WHBA 5C42A 2H5JB 1TNSA 4WKYA 2ZZNA 2Q66A 3QYFA 2QZ8A 3OYCA 2J5PA 2ADBA 1R5HA 5DD4A 3VYUB 1XGSA 1S49A 3SDEB 4MT1A 3CJ0A 2V4JB 1BIAA 1B9NA 2HRYA 3EDQB 2XHKA 2GQCA 5IY5H 4PWDB 3V81B 2IS1A 1UEVA 1W7WA 1U9OA 3FEXB 2ZSIB 1EHWA 3MGJA 3I55S 3GJTB 3DWLE 4AC0A 4RB1A 2ZH4A 3LAPA 2F8MA 4ZCKA 1RAAB 4NCAA 4I98B 4M73A 1VRTA 4QR2A 4TYBA 5KAFC 2FQ4A 1WDDA 3EJMA 2LH9A 4OZNA 4ZVUB 3M8QA 4HZFA 4A4JA 2RV8A 2AQEA 4QPTA 1SVLA 1V6HA 3S6EA 3E0JB 2FJXA 3KHHA 2BQRA 3G8SA 2D1HA 3LFUA 2IGOA 3CZ6A 3HKZA 3BDEA 4NLSA 5BQTA 2HQDA 4EGYA 5FRNA 4L0ZB 5K8NA 2BX6A 5FO5A 2L4AA 3MN2A 5HJYA 1FXDA 3SEOA 1X5OA 4EYHB 3CPWR 4F4YA 4FKYA 5G4DA 3Q0UA 1OCOH 5B7WA 3NBPB 4OLPA 3HM5A 4I0AA 4OU0A 5CYQA 3DMJA 3MPYA 1UA1A 1YITS 5HNFA 1VI7A 3J81Y 1WSRA 4RNOA 3ZMVA 3E2EA 5HROB 1Z67A 3AL0C 4JV0A 3H2UB 4DWIA 4C9DA 4A3FJ 3CIMA 4DCPB 2E1NA 4DIQA 4CYCB 3EVWA 1V5VA 4GO5X 5D15A 1QY7A 2Z30B 3TOQA 2AZ3A 3DFEA 1RWWB 2DPUA 1JLQA 3CQZJ 2ZM6J 2ZMEA 1UL3A 2GQ2A 2I9SA 5C4JJ 4HSTA 2M87A 2VL8A 1RLDA 1N34J 4RGRA 3W66A 1NH3A 2ME0A 2DHAA 4O44B 3MWBA 4QWCA 2QLWA 1M5SA 2TDXA 1CJTA 1E2XA 3E3XA 2XLJA 3JSYA 1GT0C 2FGOA 1TUGB 3I5AA 3RB0A 3OD2A 2COBA 4B3TJ 2DT9A 4GFBA 1RTIA 4QIGA 4RGSA 4F55A 5I3QA 4IR1A 2M88A 2FJAB 3DRSB 2DH9A 4XIUA 1U6GA 2PMHA 1WC4A 4FQGA 3KLVA 1UVIA 3BPSP 4MQ9F 1WFXA 2LYCA 3JRHA 2DB1A 4GRSA 4WJBA 1I39A 1XMQF 2JEGA 2CW0F 4ON0A 2EPFA 2WW8A 3CULA 4MKYA 3CMMA 4H4KC 1FMWA 1HKSA 1S1WB 3LGNA 1AU7A 3HUGB 1WHVA 2WSEC 2G0CA 1TZLA 1RJJA 2HZCA 4PWUA 3G6EI 4RWXA 3JSPA 1SH3A 5BR8F 1RE1B 2ICWG 1LV5A 1J75A 4JV2A 4KN4X 1LW2A 4LF8J 3FCVA