2L9NA

Structure of the human shwachman-bodian-diamond syndrome (sbds) protein
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
250
structure length
250
Chain Sequence
MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Ribosome maturation protein SBDS
publication title Uncoupling of GTP hydrolysis from eIF6 release on the ribosome causes Shwachman-Diamond syndrome.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2011-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01172 SBDS Shwachman-Bodian-Diamond syndrome (SBDS) protein
A PF09377 SBDS_C SBDS protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.900 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l9nA02
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2l9nA03
3.30.1250.10 Alpha Beta 2-Layer Sandwich Hypothetical 12.0 Kda Protein In Nam8-gar1 Intergenic Region; Chain: A; Ribosome maturation protein SBDS, N-terminal domain 2l9nA01
1KTVA 1U2RA 2E1RA 4QR0A 2ZITA 1P9QC 2BM0A 4QR2A 2NPFA 3B82A 3E3XA 3OQ2A 2L9NA 4MAKA 4ZCKA 2KDOA 2I0XA 3UI3A 2IVYA 4M1KA 4ZCMA 4ES3A 1ZPWX 3EXCX 3LH2S 2BM1A 1ZM9A 2EFGA 4ES1A 4MYTA 1N0VC 4ZCIA 1ZM2A 2CVEA 3B78A 4TNOA 4FN5A 4QR1A 2WBMA 2BV3A 5G4DA 3ZZ0A 2I8EA 1ZM4A 4ES2A 1ZM3A 1VI7A 1FNMA 2J7KA 1NYNA 4MYUA 3ZZTA 3ZZUA 3B8HA 1DARA 2XEXA 1N0UA 1ELOA 1T95A 4ZCLA
chains in the Genus database with same CATH superfamily
4XQFA 3F6VA 5SUHA 3DBRB 4C4WA 2DQRA 1RKWA 4OAYA 3R1HA 3K5PA 1Y0HA 2MFZA 3WE2A 1FTTA 3BZQA 2IPOB 2BUNA 4QPXA 1RT4B 1HQCA 4OL8A 2E19A 4JYKA 2LH9A 4IXAA 1HBNB 2R7SA 3A8JA 4LMYA 3HCXA 2ZOMA 4DXLA 1RT5A 1BI3A 1OYEA 1G8XA 1TTYA 2QF7A 3KK3B 5GPAA 4DR4F 2PJPA 5J2MA 4I0BA 4J9KA 3JRFA 2QX0A 5LMNJ 4PJLA 1Q7LB 4LF6J 2CNKB 2DA2A 2V8GA 1TKZA 4CCKA 1P4XA 2CADA 1ZARA 3D28A 1NYNA 2BDPA 1UTAA 2J0QD 3A01A 1WEXA 5LLQA 2KQRA 1OQ6A 3PV8A 3E2EA 5DDQC 1U8SA 3OL3A 1ITYA 3RPQA 3HRMA 1S9FA 3HOYJ 3QYBA 3SCKE 2F4MB 5IC4B 3BR1A 2VF3A 9ATCB 1SFOJ 5MAOA 2F3JA 4CYCB 3MPUB 4ICLB 4DV5J 2M5WA 2FHOB 2H09A 1LWCB 5LSRA 4KSEB 2IS4A 3UW1A 3B73A 2AXTC 2FC8A 3H9QA 4YFNF 3HXLA 2HZAA 5IS2A 2RAEA 4FXDA 2UUBJ 3V8JA 4B3MF 1K1SA 3TZWA 3CJQB 3CCSS 3KP3A 4BJTA 4DWIA 3M6XA 4OZ2A 2Z5UA 4PQUB 1BR2A 1U25A 4EQQA 3OSPA 1Z3YA 2A6TA 2H1LA 2A61A 1RIOH 2GAHC 2B5JA 3CQZJ 4WE1A 2RHSB 1PCAA 3AXMA 5FLMJ 3JCUC 5EDNA 3TVYA 5J2PA 3AXKA 3GZ6A 2QKLB 4DV2F 3KETA 2C3UA 1ZTRA 2VBZA 1KFSA 4RW7A 1U9NA 3BF4A 5IOLA 3MMBA 4DSLA 3J7ZI 2IVMA 3GV7B 1U6GA 2EI5A 1SJ3P 4HOBA 2JJ7A 1YJWS 5J2NB 5B0FA 2ZJ2A 3ROUA 1IV6A 3LQQA 1KTQA 1BIBA 1ETWA 2RQKA 3E0JB 2JJ4D 3RRHA 2DHGA 2E9TA 2F4OB 5HVQC 3FM3A 2NREA 4QWDA 3EGWB 5J8CA 3RUBL 1KQGB 5JFRA 2H5IB 2ZNZA 3J81K 5EN1A 1GNKA 1T0TV 2JX2A 2GMLA 3IH3A 3AA8A 5M2UA 2HVHA 3D0SA 4DSIA 2E44A 1BW6A 2YNHA 4PWDB 3TANA 4CCNA 4C3MA 1E2XA 4X64J 1QNTA 2IA2A 1PJ7A 3BH7B 5HLFA 4AL7A 3EYIA 3VQSA 4ZKAA 2DA4A 3BQZA 1UCNA 4CTAA 4E4HA 3VAMA 1BGXT 3A3PB 2VHGA 1USSA 4GO7X 3R7SB 2GA1A 2E35A 1R0BG 4HEA9 1VQPS 2W24A 3CMAI 4L9TA 1CJTB 2V4RA 4AT1B 3GX4X 2K9LA 2PA3A 1DRZA 1RAIB 4IL6C 3E97A 1QUVA 2ZMEB 3G73A 1KYZA 4XMYA 3GTGJ 2YWKA 3P5JA 4YFKF 2F2EA 1VQ9I 1LE8A 2JRTA 2QSFX 3MEGB 3ABTA 4RW9A 4KFBB 2VUMJ 1U1PA 4DV3F 3HSEA 3PG9A 4O3NA 2WB1N 2RQQA 1ZGAA 1YQHA 3CD7A 3D6HB 3CDAA 2OQRA 5HLGA 2BVLA 4USMA 2HMIA 2KJCA 3PW0A 3AOBA 1U2CA 1YHQI 3H5AA 4YB1P 3H2LA 5DZ7A 5L46A 4P1WA 4QPOA 2KPMA 3J81U 1F9HA 2VC0A 3M9MB 3VZHA 2ETHA 1RTDB 3BR3A 4B17A 1N32J 1AUSL 2V7FA 1EHWA 2Y2ZA 4BWJA 2IW5A 3CVKA 2GIZA 1AKHA 2LCWA 4OJHA 1SUQA 3CXCR 2H5JB 1GMVA 3EPGA 2CQ1A 4IHYA 4U7CA 3D0HE 3TWZA 3ASOH 4DJBA 4HRIA 2FD5A 5AXKA 2H9ZA 2J5AA 1R22A 2DRDA 4HNUA 1SC6A 3K4CA 4EEYA 1RPWA 3I0SB 3F41A 4IPAA 5DETA 1AXQA 4HG2A 4S0HB 5J47A 2DMUA 5J8FA 4ZVFA 3TUZC 3J7YU 1S7IA 4X0GA 3KK1A 4PDKA 1M5SA 1ZPWX 2RF2A 3HSGA 1NK4A 4C7QA 1GLNA 2E5LF 2XASA 1QSSA 2HS4A 2KL8A 1RAHB 2OA4A 4A0XA 4RGUA 3RQ4A 2XM3A 4DLGA 4DG1B 1MW7A 5GAHI 3DFEA 1RI7A 1S7HA 3MZ8A 1K1QA 3IMQJ 3SV3A 4FYYB 2KXFA 2UXCJ 2KG1A 2R7VA 1XIQA 3UN3A 4CO3A 3DWLE 2DNYA 1FKPA 2HGNA 4NLUA 3G4SS 4HF1A 5EEAA 3D3CJ 3MMAA 5ILVA 2VKEA 1RWMB 2KM8B 4ZP6A 4NLXA 1LFBA 3Q23A 2MEWA 3W2WA 1F2HA 5IC6B 2WVEA 3MR2A 2ZBQA 4HBLA 3WX4A 4QYZJ 4ELVA 1ZG3A 1HD0A 4NL5A 1TK5A 4J00A 1X5SA 1QZYA 1DU6A 1X2MA 4U96A 2I10A 1UEUA 3MR7A 1REVB 2XYGB 1RTHA 2L41A 1B0VA 4UOHA 2WONA 2P7CB 1NXIA 1VQKS 5H6QA 1ELOA 4Q48A 2AKWB 4RNFA 2YNGB 3IRQA 4A3JJ 3H3VK 4LF8J 3U2RA 3IL2A 4Z6YA 1X4OA 3OYJA 1SJ1A 4W98A 5GP9A 3QQCD 3K1PA 2GIFA 2ELKA 1C0UB 1BI0A 2JRMA 2QEXI 1RK8A 1I50J 4JX6A 1DJ0A 4D9JA 3OYHA 3MAQA 3LQVA 3CIMA 1RCXB 3PIOQ 4LR8A 3AJ2A 3TDUC 1HSTA 4BE0A 3UKGA 2KH9A 4B09A 1N77A 4O3SA 4AYBD 5CYMA 4ZVPB 3HUGA 1G59A 2YPZA 2C2NA 1H74A 3PNYA 2XB0X 4WK8F 3AB4B 3R2DJ 5K9FA 2GJFA 2X1BA 3IRXB 1WC0A 3PHTA 4HLBA 3JSYA 5KFIA 2QG9B 4PJ0C 2LP4A 2JC1A 1KVKA 4BHCA 4MH8A 1JHFA 4G94A 3MGJA 1FXRA 2E1AA 3BOQA 3W3CA 2DEIA 3W2VB 4IRDA 5DS9A 2XKPA 4QW8A 1DHMA 1IKWB 2IC3B 3HVWA 3N97A 2MKIA 5LRSA 4NCGA 1VQ4S 2QM3A 1B7YB 3CJSA 2ZE2A 1HW5A 1SD4A 2RGVA 2IM0A 3FSXA 2IBKA 2UUCF 3V6KA 2DXEA 3PO2J 3OYMA 4FZVA 1OYDA 2EFQA 1LK5A 1T56A 2YKPA 3PW5A 4Q8EA 4JB8B 1UEVA 3CCQS 4UF4A 2IS6A 1H7WA 2CQCA 4LSNA 4EO6A 4QTRA 2GVDA 2OFGX 1K0TA 3VYRB 4ZP7A 2CQDA 2A2CA 4GYIA 4FS2A 2QTWA 2DNGA 1EETB 3OOUA 3PNTA 3LAPA 2W4DA 1NK0A 4K0KF 3CF5F 4CGZA 3DGVA 3F0NA 4YQWA 2HFVA 4X4QA 3N4MA 3DQVC 2FNAA 2WWYA 2V4JA 2VODA 3MM8B 3OD2A 4UB8C 3H2UB 3ELKA 2CWKA 3D6MB 5C2CA 4BY7J 2RS2A 2XYHB 3E7LA 4CZCA 5FLXK 1PJRA 1WGXA 2OAUA 3UO0A 5K7ZA 4GYGA 4ZTFA 3TP3A 2R7XA 1R58A 1DTTB 4JV0A 1WC5A 5KFJA 3L2QA 1VTNC 1V9OA 2QMXA 2JSPA 1LKXA 2YUSA 3DGPA 1T9WA 2P8IA 1LK7A 2R7OA 2ASYA 4WZMA 1UP1A 4LOCA 3UCZP 2X6OA 1KP6A 1YRTA 1TT0A 5DLGA 2RU3A 4M5DA 5LL6d 2JL9A 5D15A 2CW8A 3NXZA 4R8UB 1YG2A 4I99C 3FK7A 1QPIA 2XY7A 1J0RA 2HQRA 1JXVA 2UVRA 4QWCA 2HFNA 1HBMA 3POTA 1JUPA 4NLSA 3CCZA 4R79A 4PSXA 1VI7A 3I55I 2VQGA 4ED6A 1I51B 1VBXA 1U8WA 3VVUA 1ZZNA 3R5AA 3HOXJ 3EDQB 4CQ1A 2BOPA 4NMXA 1Z0XA 2ZKTA 4TYAA 4NQWA 3C2PA 3QAUA 2RAQA 2YTCA 4N56A 2DIUA 5HQ8A 1GX5A 4URQU 2CRLA 5HMYA 4FHTA 3F6OA 1W26A 3TA0A 3CC4I 2O0YA 2MLKA 4LF9F 5DDGA 2ISYA 3ZMUA 1V3FA 4A8QA 4L73A 5FLXU 5DD8A 2WW8A 4ZC3A 4RB2C 1C0WA 3OJUA 1G3OA 3OTBA 4H4MB 1FD8A 1G3SA 3TW0A 3IWZA 2E5IA 2C2RA 4BS9A 1IKXB 1R0AB 2HQNA 4Y2MA 3D6TB 1DLOA 3SEQA 4YY3F 3HTSB 3V81B 3KCCA 2ZOGA 1VDHA 4JI4F 3FFIB 4LRDA 1N48A 4DSJA 2BEOA 4NI2A 4L72B 5IXUA 2WAQN 1ICEB 1GUUA 4C11B 4AUKA 1HHSA 1X4EA 3IC7A 1FJLA 3KZZA 1KNZA 1VQ7S 4U6PA 1RWUA 2DH9A 3OYAA 1T39A 3FRZA 5EEHA 1X4CA 1OWXA 5E2QA 1U8RA 1YBTA 5E3NA 3M1EA 2ZC3A 1XNRF 5HS7A 1FXLA 1Y8RB 4F3OA 4XL9A 2VIHA 2BW3B 5LHHA 2GZOA 1FWZA 3ZMTA 3JTOA 4MIAA 1N8RT 4L9VA 3AKZA 2ICWG 3SYTA 1YW7A 5L8RC 3FEXB 1R8BA 1UWBB 3SIPB 7AT1B 3CTRA 1X3UA 2KZVA 1ZYRF 1WJDA 1BLUA 1YTYA 3H2VE 4DR1F 3OR1C 5F08A 4GC7A 5K5RA 2MXYA 2EILH 5G0RB 4K4ZA 2VASA 2DO0A 4ZYEA 3H5YA 2XMUA 2KKHA 3E1SA 3CP8A 2A6EF 2VXDA 3CD6S 2MZ1A 2DYRH 2W82A 5DGBA 4TY8A 2JZYA 3HTUA 1FYMA 3HG9A 3HC7A 2VG6B 4NPOA 2OH2A 3CCYA 4OI0A 5B0GA 1FPQA 1HD1A 4O3QA 4G6TB 4E98A 5LGNA 1LVKA 2G0IA 1EV7A 3GZNB 1R89A 3C2HA 1JLGA 1YIJS 1UMQA 2BV6A 2KT2A 1Q78A 3CD0A 1NEEA 2QO3A 1C1BB 2JC0A 4MQVA 3SCIE 1X1BA 3TAQA 1BC8C 3GYXB 2HHSA 2HURA 2KDOA 3G2XA 4DUTA 2HPUA 2F8MA 2M8HA 3PW2A 4RLFA 4RUCA 4J9QA 4ZDOA 3MEDA 1HNXF 1FE0A 4AIJA 2DKOB 2ZBRA 1FKAF 1EX8A 5SZTA 2IM2A 1S1UB 4R25A 2R93J 1SL1A 1TELA 1A36A 4O3PA 1XDSA 2OTJS 3RTVA 4DW6A 9ANTA 4PG7A 2NRAC 2D1CA 5ETTA 2EZKA 2RC4A 2J9EA 2QV6A 2K02A 4ZJQA 4TQSA 2EA2A 2RUGA 2DN0A 3LP1B 3CJNA 4XLEA 1XN9A 3GR0A 2FY8A 2I5JA 4BEHA 2JLFA 3P5TL 2XC7A 3L2RA 4IO1A 1PGZA 3UN5A 2VT3A 4DV3J 4QIFA 1IBLF 3S1NJ 3M8SA 1RBLA 1R6VA 4I2QA 3QSYB 3CSKA 4BQOA 4I6WA 1SPBP 1FYKA 2NNNA 4XLFA 2IA0A 3CC2S 1GXQA 4PGHA 3BBFA 2EC0A 5KFYA 3AG2H 5HODA 2K3FA 4U8YA 3EUHA 1F9NA 1FK9A 4HDGA 1AZSA 4I76A 3R60A 4OJGA 4IRIA 5ICEA 4UOGA 4RR5A 1LEBA 1Z7LA 3GTKJ 2M9HA 4HV6A 2E2JJ 4RBUA 3E5QA 3ML6A 4DZDA 5F3TA 3MKZA 1SB6A 3R5JB 1REPC 4QJVA 3G96A 2F7VA 2RH3A 1G3YA 1JWWA 3KMQA 3C16A 4O44A 3LMMA 1K44A 4O3OA 3T1AA 2B9XA 5HI7A 5FGMA 1JKHA 2H27A 4YFUA 2PN6A 4RWXA 3PX4A 3OSGA 2WA0A 1PBAA 2RKHA 2K06A 4ZDLA 4LJZF 2E5LJ 3KUEA 2FUG2 2PFFB 2MLGA 2X1CA 3ZMSA 1WOSA 3LF0A 4GVBA 4PXDA 2V8PA 5K14B 4RM2A 4KHMA 1Y3KA 4A3FJ 4A8WA 4ANDA 1S12A 2HBZB 2LEBA 4B08A 2AXLA 2OAZA 4IQ4A 5E20A 1I5OB 4PKDB 4P96A 1NAQA 4N41A 1PC4A 4OYWA 5J1EB 3H59A 2E1CA 3AJDA 3DLBA 2HFOA 4JV5F 5EWGA 2BY1A 3CO6C 2NAZA 3TEDA 3QGGA 4PXBA 4UY85 2JUGA 3BN4A 3HD2A 2O6GE 3M4OJ 2PSZA 1H8AC 3CC7I 4ID8A 1QJHA 4FN5A 3UQSA 2WSFC 1NH3A 2AD9A 4UUVA 4ANJA 3HBLA 1NJYA 4KO0B 2W9AA 2Z33A 4UHTA 4C9YA 3PJXA 5KT6A 5H9FK 2YBVA 3ILOA 1YZ6A 1EB0A 1J9IA 1I27A 5L3FA 1T9YA 4QWBA 2XMKA 2ZXJA 3CCUI 3DPUA 3FMRA 3BKTA 2APOA 1YITS 4Y17A 2PJRA 1UG2A 1WVRA 2E34A 5K5QA 4FVMA 1CQMA 3H4BA 4K4YA 1WG5A 3LSHA 3V8LA 1TL8A 5H9EJ 1HWUA 5K20B 1XGOA 1HWLA 1J09A 1IXCA 4CYUB 3E5XA 4Y0FA 5F9LA 2VL1A 2L01A 2DGSA 4MJKA 2X1FA 3IWLA 4KQZA 2JEFA 3D5RC 4I0AA 2OELA 2ZH4A 3D9BA 1HW2A 3MPYA 5J1PA 3GXOA 4JOUA 3SEOA 3GILA 3QO9A 4R8HA 3L2VA 3F8CA 2C2MB 3PX0A 2L9WA 2DTRA 2ZWPA 1Q8BA 2AV5A 1NKCA 5F8HA 3OS1A 1SC4B 2GW8A 1HDDC 5M3FJ 4YMEA 3SFIA 1S57A 3C3WA 2AGOA 1A04A 3NGRA 2DGVA 2NVUB 2GXAA 2F5GA 4OX7A 3LSGA 4NZ7A 5JHFA 3SFZA 1W25A 4E2FB 2EVZA 3DXJF 3RQIA 2QVOA 4F04B 3MFIA 2UUCJ 2GIQA 1N0UA 4M9ZA 4KRWA 2DR9A 1S72S 2O8KA 1NHUA 2Q8KA 3DLGA 1FZPB 2GXBA 2BJ1A 1X4PA 1FOWA 3WZ0A 1SH0A 2PEXA 2NS7A 3ZNJ1 4XKCA 4DIQA 1LXJA 5CHCB 3EVMA 2DK5A 4K0KJ 1UG0A 1JLBA 1VIXA 1TFYA 2Y69H 4YIIA 2RQPA 3I56I 1VYAA 1B4SA 4G1PA 3MURP 3BDDA 1UFWA 2NYIA 1B59A 2FOWA 1FD2A 5H1SV 3EJMA 2NVYJ 2X6XA 2V2ZA 1E6VA 3DV8A 5KCMA 2HK3A 5J1NA 2DHXA 1J5EF 4BDZA 2ZFHA 2D9OA 5F9NA 2CG8A 4RUAA 3OXFA 1OQYA 1U2RA 1WWHA 2HDCA 2HHXA 1MBFA 3PDNA 3I59B 4YUDA 2VJJA 3MOZA 3DF8A 4I2PB 4DV7J 3IKVA 5EYRA 4P75A 2XAJA 2YWGA 1ZLKA 3F73A 2ALZA 4GKJF 3KG1A 3NP5A 2LDUA 3CF5Q 3RBZA 5DCMA 4HKQA 1F5BA 1HQUA 1RADB 5CA5A 3SXLA 4IG3B 2DJIA 4ED7A 1RC9A 4K59A 3VAJA 5HMWA 1Z1ZA 4GO1A 1DBDA 3BDEA 3GFIA 3H3UA 3T1BA 2FGOA 1LWEA 3I82A 1X9WA 1RISA 3IAS2 4KH0B 3K1MA 2EIJH 1N5VA 4HI1A 2LTPA 3ELHA 1ZTWA 4TU7A 5JVGQ 1JLCB 2LXFA 3EZUA 1S1WA 4QSHA 1S0OA 1BD6A 1VNDA 2HSEB 4IKFA 4USIA 3UI3A 4X84A 2HTSA 3GF2A 1UB9A 2XYPB 4C8ZA 1ETKA 2W7NA 4LUBA 3ZTQA 1B4AA 2GZWA 1GHCA 3IRWP 2ECCA 1OPCA 1IO2A 5IFMA 3RPUA 4HX4A 3BG9A 4LF9J 2L9DA 2BHZA 2CQNA 3Q9VA 1SKRA 1S6PB 1K6OA 2W4CA 3L9ZA 4ZK7M 2PIIA 3CDHA 2EW9A 5F41A 2EFWA 3U1NA 3Q3SA 1G4DA 5L1IA 2E5GA 3BTCA 3ESWB 1JUSA 1U0HB 3R5BA 4U9RA 2W7PA 2KLOA 4BQNA 1SKUB 1RR8C 2IAJB 3GQCA 3RZOJ 2KHCA 3L7UA 3RKWA 1D09B 2E2IJ 4YY3J 5F8IA 2VUGA 4LVOP 4DFJA 4WFXA 4C6AA 1MJ9A 3R6SA 1RETA 4ENOA 5IT3A 4UZCA 5KFDA 4IHXA 4JI4J 1BR1A 3DP7A 1E6YA 2QA2A 1FIAA 2IMOA 3Q0UA 4KPCA 2MZRA 2K3IA 3K2YA 4FYDA 1O3TA 4HACB 2BEFA 5THWA 4P9SA 2HHQA 4PG6A 5GAEJ 5KHDA 1TL1A 4LVNP 2MKSA 4K4UA 1XNRJ 4ESJA 3Q5FA 3ZMVA 3HI9A 1NHVA 5KFTA 1XGNA 2AT1B 2L54A 4M6VA 1O7FA 2K1RB 3PFIA 2XHWA 2RREA 2ZVIA 5F0UA 2CUFA 5GADJ 2GOXB 4ZVSB 2L7ZA 4WJBA 4DPWA 3K70C 1NNDA 2EB7A 1HARA 4DR1J 1BQMA 4OHXA 4NCAA 1D5VA 2G9OA 3M2UA 4RLEA 1UJ5A 3BO3A 1LV5A 3AD8C 1NDPA 3TZXA 4AD6A 1U9OA 1V5VA 4MT1A 2GM4A 4XIUA 2C3YA 4YB7A 1XGSA 2P2CB 2XPVA 5D5XB 1Z4UA 2MA3A 4V19K 2IP2A 3K69A 1BE4A 2JVRA 3H8YA 4BXUA 1P2FA 1H0HB 1C1CA 2P4WA 3RBEA 3BSOA 2CU7A 1TWAJ 1FJGJ 5J40A 1RT5B 2Z2YB 2HXIA 4EWTA 3RB4A 1KC8T 3PNVA 3QPLA 3GIIA 3W5YA 1SC3B 5KFEA 4OIRF 2DT6A 3KZIC 1KKHA 4E0DA 5E8IA 4A4JA 1TKZB 2CUZA 3H42A 4DYCA 1R27B 3Q0VA 2HEOA 4IOCF 1WKJA 1JI8A 5T7LA 2ZWOA 3OR2C 4B9UA 4HT7A 1KQ0A 5G4DA 2UXXA 4B3SJ 2MLYA 4MQ9F 1HMVA 1S4EA 2VPYB 1NHAA 2R4GA 2AJ0A 3ZQ7A 1W2IA 4KAIA 4RB1A 3QATA 2DFIA 1KSPA 1VZ0A 3HB9A 1HBUB 2DH7A 1PP8F 1D0XA 3FQKA 1AFJA 3BV8A 3MCNA 4HH0A 3ZPLA 5IM0B 4DR3F 3HO1A 2R9LA 3DU5A 4A0ZA 4CO1A 3TW7A 2XQCA 4NXNJ 2O8XA 4DQSA 1RSCA 1W7PA 4XM3A 1U48A 2NYHA 2ZUAA 3GIRA 3QPHA 2GS8A 4QIWN 1HNWJ 3COAC 4WXWA 2MQNA 2VV5A 3PQKA 5ETOA 2X3DA 1IR0A 2B5JB 3W9HA 4MO7A 4WE1B 1JT6A 4V2FA 4OOIA 4WP3A 4XRMA 4I7HA 2AGPA 5BS6A 4A3BJ 4E7KA 4U0WA 2X7IA 2GQCA 4Q45A 4RW7B 4KE5A 2ASDA 2VG7A 3C66A 3MMBB 1RA6A 1YJ9I 2U1AA 3OUYA 3NMRA 2ZXIA 4Y00A 1I5ZA 2DA6A 1I6XA 3I9V2 3G6EI 5E3MA 3M2VA 3S3MA 4YELA 1TMJA 3ENAA 4RAYA 3MWMA 3H90A 4J9RA 3BO2A 1Q53A 1T9TA 2FVSA 4J9OA 2Z2LA 5JR3A 2QCOA 2QMUB 4IFVB 1VQNI 5A0YB 1HA8A 4ECQA 1RWKB 3GTYX 4C0HA 3C46A 4ZYAA 3BTLA 2NSCA 5I3UA 5HVGA 3PL8A 2FVPA 5A2QY 2CPEA 4NLTA 2DGQA 1TKTA 4QR2A 5EG0A 3SJMA 1JLFA 4KB7A 3RKYA 1B7FA 4LLLA 4ZCKA 4WTOB 3IFEA 2IVYA 5C44J 3GLJA 5HLFB 1Z05A 4ECYA 2CWXA 3QAEA 2J6TA 4YR2A 3NGTA 1SJQA 1S1XB 4CTAB 1IDYA 1OR7A 5DRKA 3FK4A 4ECVA 3IO1A 3EUAA 1KFDA 5LGTA 4P7TA 4O6JA 4J9VA 1AT1B 4HR2A 3QFHA 4JV5J 2DPUA 3F8BA 1RLDA 1VQ5S 2FU4A 4XRSA 5HNHA 2VQCA 4N76A 2CJQA 1HWIA 4OZ5A 1RKIA 1KEKA 3RB0A 1IXKA 3IKTA 2QUFA 1LE8B 1QAJA 1NU4A 2F9JA 2NXJA 3CCWA 2JT1A 2W9BB 4BWMA 1AA1B 3S8SA 4I69A 2ZFWA 3W6VA 2XO7A 5ETVA 1SVMA 3BCAA 2HMIB 2JPBA 4J9LA 2GFFA 5D4OA 2DD8S 1FX7A 4DR2F 3ZRGA 3ZZRA 1WKMA 1Y56A 2F6CA 3CCVI 1ROFA 2FPHX 2QQBA 1S6QA 1ZGJA 1KBRA 3DLJA 5D3GA 3F44A 4IH6A 2DGUA 3H5XA 2B8PA 4HX8A 1YJVA 3HOVJ 3AG4H 1Z6RA 2KXHA 1N5SA 2XDVA 1T9XA 3JW4A 1F9EB 1GQEA 1TLHB 3MZIA 2BBEA 2AQ4A 2D3ZA 2XZDB 2LNBA 3BKUA 2CQ3A 2RRNA 3NWRA 1MJBA 8ATCB 4UZBA 4ANEA 4QU7A 3LNQA 2V69A 2CNLB 2Y0SA 3HD1A 4O3RA 3PY8A 5AIPA 4F4AA 3S93A 4A8FA 3KK1B 4MKAA 2HS3A 2RF2B 1K4TA 2ZEJA 2WV0A 3OXGA 5LHGA 3QLHA 4LQ9A 1OPZA 4ES3A 5K5OA 2HBQB 1UMJA 2B6AB 4HNVA 4M9XA 2CYYA 3K0LA 5DG7A 2AIRB 2K4BA 3PRBA 2Y3YA 1CS4A 2A3SA 1FHTA 3TOAA 4JX5A 1FKPB 2JN6A 4NZ0A 3A02A 2FE3A 3C1DA 1RT4A 3N79A 5C5JA 4KHPF 4GMKA 3MMAB 4ZDNA 3SSQA 1P92A 3W2WB 3VV2B 5FLVA 4FP9A 3RJMB 2E9RX 1BJZA 5JHUA 3KK3A 3UFCX 5IYBJ 5ETSA 2F5VA 5DQGA 1LW2A 1SXLA 2D5VA 2HWIA 3I87A 5B1BH 2KRRA 3PW4A 3E3XA 4RW8B 1X1CA 2J6UA 1NSQA 4KV8A 4NC7A 1USTA 2V8DA 3E6MA 4QWQA 1TNTA 4AIHA 2DOFA 3FZBA 2Y1JA 2NXEA 5A8KB 1RAGB 4IRCA 1S6LA 4MFEA 2CIMA 4XSXF 3BYRA 2BE2B 3KFWX 3HZEA 4FNHA 2YQ1A 4W90B 2IRUA 1U5TC 2LOOA 2KN4A 3NS7B 2N8GA 3KIOA 3MFKA 1GDTA 4FF4A 3IP0A 2BVZA 3JRAA 4FXVA 5LJ3Y 4WPAA 2D69A 4IDKA 4BNCA 2OCCH 3R4KA 4IHSA 2JA6J 3CJQA 4JQFA 3SHFA 1XMXA 1YRNB 4P74A 3A4TA 2HRTA 1B3TA 3G1OA 3JSMB 3FEZA 5D4PA 3RRGA 1IRGA 1S59A 4TNOA 4FBTA 2N7CA 1X9MA 4F02A 2ZBKA 3OYCA 2EK5A 4DBQA 1T0FC 2AF6A 2YPYA 2Y1RI 3KPHA 3J81j 1JJHA 3MD1A 3C2GA 2WRMA 2V9VA 3GTOJ 5ETQA 3W5XA 4QBUA 2JA2A 2MMYA 3GPAA 2FGCA 2UUTA 2QLFB 1VR6A 1ERDA 3CEDA 1KGSA 3K7AJ 5J2NA 4HEA2 2KFZA 1FY7A 3PRVA 2CJJA 4B1RA 3MAAA 1UFMA 4CA0A 1JNZB 1Q79A 4NCGB 3SFGA 1NG6A 2EK1A 4IOAQ 5F04A 3HKZD 2ZE2B 1R8CA 4WZQA 1DURA 3BGUA 1O8BA 2KIQA 3HGGA 4BLGA 1Q82T 4W1UA 5H20A 4R0JA 2G2YA 2QJ3A 4MTEA 3BQ0A 4NXMF 4F7ZA 5IYDJ 2JMWA 3SZ2A 1BBYA 4BL0B 3ENWA 1JGSA 2IXSA 3BBBA 3NGDA 3QOPA 5JI6A 4NLVA 2M34A 1FJCA 4PYDA 5KFNA 2QLJB 1JB0C 2BA9A 1W5CC 3K4BA 3LL7A 3QIPA 3R9LA 2V9WA 3HOUJ 2EBEA 3S3NA 1X58A 2F1FA 3HYIA 2E1PA 1MNMC 1TWCJ 5H6RA 1POGA 4L75A 2V4JB 3SDEB 1CJTA 1NPPA 3KNGA 2IS2A 1ZR2A 4ITSA 1X5PA 2H8WA 1JTYA 4HF2A 5I42A 2ZMEA 1KLMB 4P7VA 2CV0A 2FIUA 2OZ6A 1RA7A 3KLNA 5HS9A 3C18A 4WBFA 1F60B 2CAJA 2CDQA 4DFPA 1VQ8I 1N5TA 2Z4PA 2GQQA 4K5RA 2YH1A 1S9HA 4J19A 4FNIA 2X48A 3EXCX 3TP0A 4M5DB 4ALZA 1KYWA 4Y3OA 5K8OA 3DRSB 1F5AA 4NLQA 3OL8A 1HL6A 3KG4A 1T9UA 3N5FA 4RBVA 2BQ3A 2NLWA 1DP3A 5CD4A 3DHWC 2PFDA 1RTDA 4HTIA 3POTB 4XLAA 2ZOFA 4EM0B 4MIBA 1R3NA 3DEWA 4ZHRB 5AIQA 3A0BC 2P5LC 2H5EA 4YHHF 3KYLA 1YHQS 1XR6A 4BBYA 4E8UA 2RNEA 1HNZF 4M9SA 4QWEA 5BQTA 4EVIA 3TO7A 3A0HC 2CUEA 1NH8A 2W25A 3I0SA 3LFUA 4JI3F 3LAJA 3FCWA 3B02A 3JAMY 1QU3A 3FXOA 1KZHA 2E71A 2RDDA 2XAFA 4MMOA 1JLQB 1N5QA 5FROA 4OX9F 3TZYA 3M6VA 3R27A 3PHEA 1MDMA 2M3AA 2COLA 2HBYB 5H2FC 3OV7A 4ECWA 2HGLA 4HDVA 3ET6A 4EJUA 3U21A 1WKLA 1DLOB 1YZ7A 2R8IA 2XMVA 2MQOA 2G7UA 3MECA 1YKWA 3MKYB 1YDLA 3B54A 2P6SA 3OFEA 4M3DA 4CCMA 1H9GA 4NI2B 3H5NA 4L0ZB 4HTJA 1H2VZ 2HS5A 2ZUGA 4J9PA 5HROA 2M4MA 5L1JA 7FDRA 4OZ0A 4A12A 4ZCIA 3QT7A 2E60A 2KP6A 4UUTA 1D8JA 2HWTA 2VQLA 3K0JA 1IWAA 2GIRA 4C9DA 4GKKF 4V1Ak 3MXHP 1REVA 1OCCH 2DT7B 1HA1A 3HPOA 2HFZA 2W00A 4DQIA 1FKOB 1XDUA 5JJBA 1YJ7A 2YX1A 3PXGa 5D78A 2MQPA 4IG0A 2G1DA 3DM2B 3CPWR 4ZS6A 4UUWA 2LYVA 4PG8A 1V55H 1ZREA 1G2EA 4A8XA 1JJ8C 1Z3XA 4ZVQB 2HNDA 1S97A 1GH8A 4UNOA 4TY8B 4HVZA 4RUBA 2XGXA 4PXCA 4C8LA 3VAHA 1MMSA 3OR1A 3W5ZA 4C8OA 4DN9A 1ZETA 3HHDA 4I7FA 1FWLA 3UD4P 3VGTA 2RIJA 3H1CA 5AJ3F 2MTLA 4CUGA 1IZ1A 3W9IA 2E36A 1UZCA 3WQPA 4K2XA 3K5NA 3S2DJ 4WK1A 1FDDA 3O3KA 3J7AY 3IRXA 1HLVA 2M8GX 5IT9K 3JREA 5CQGA 5CVUA 5DCFA 2BY3A 2CUYA 2KISA 3D0IE 1AYEA 4DPUA 1S1VA 2DNMA 4XLNF 2MD5A 1FWPA 1SQEA 4MKVA 3MEDB 3QJJA 5FRNA 3C19A 1P6RA 3M9OB 1YW9A 5M5WJ 2N4CA 4ID5A 5I3PA 3V6JA 2QBYA 1XBWA 3I0TA 3W60A 1HSJA 1G6NA 1K9MT 4NLRA 3PX6A 3MQ0A 2NNYA 5KFGA 1VQMS 4I98B 1RQ0A 2YNFA 1W1WE 3UE2A 1JLEA 5KFVA 2IA6A 3AHPA 1NZAA 1JXSA 2M7SA 4K4SA 2XAGA 3WTYC 2OQGA 3QRRA 1O3SA 4BEHB 4ZN1A 1LB2A 4OJ1A 2CQ0A 1FX2A 3RG6A 2G13A 4USKA 1WQ2A 3TGNA 3S16J 2K4JA 2VA3A 1S79A 3D5MA 4NB5A 1FT8A 3RU0A 1TW2A 1EJ7L 3I4PA 4AWXB 4DR2J 2NUUG 2P9GA 3MR3A 4OQJA 4PG5A 3BPVA 4CLWA 3IWXA 4KGXB 4UY8T 2XSJC 1EETA 1AZSB 5ICCA 1NPKA 2AX0A 2ZCWA 4XTTA 3IBCB 3WBZA 1L3VA 2FHJD 1AU7A 3EZ5A 2DMNA 3PNIA 3MM8A 3Q24A 2VPRA 1WHVA 2WC2A 1F4KA 4DX8H 3R97A 4DR5F 1B64A 2A05A 2H4WB 5IT9U 1SL2A 2GXGA 5KFUA 4LSZB 1YJNI 2X85A 2UP1A 2D45A 2RNJA 3IP4B 3C16B 3BG6A 2PFBA 3RJPA 2HKEA 2P5KA 1JKHB 4BC9A 3GE9A 2ACJA 4IRHA 4FX4A 1R8AA 2FC9A 3QQAA 5IP7J 1S4FA 1FTRA 2FDNA 4C0BA 4P2SA 4GVBB 2Q79A 4R8UA 3CWJA 1UPMB 2DY9A 1Y5LB 5FJ8J 2VD3A 1V5IB 3E01A 4A3DJ 1YE9A 2W9CA 1YQAA 2LRDA 3KP7A 1PYSB 3NS5A 1B1BA 5U47A 4KHPJ 3KLEA 4BY1J 4LF4F 1ON2A 1F9FA 3PJRA 5KFCA 2EBIA 3FMBA 2FNPA 5DM7F 4DR6F 4ZLPA 1Q81T 3ZZOA 2F5DA 4ZPVR 2L3MA 2LA4A 1YI2S 5A2QZ 1FP2A 5JUMA 3VSKA 4K8RA 2G0EA 4DZJA 2VA2A 5E1WA 4LRBA 4NLDA 2JNJA 1UELB 4ETSA 3CLQA 3R5DA 1RWXB 1Y9OA 5E5NA 2L7KA 1DQ9A 5HLIA 2LP0A 2LQJA 4LRFA 4H4MA 2MY8A 1VK3A 1OJLA 4JI0F 1IKXA 3H35A 1R0AA 2CW0F 2PMZN 1WWXA 3D68A 2DFHA 1AUDA 1VQ6S 4P55A 2PJRB 3CC4S 4EFAC 9RUBA 2DR8A 3DLEA 1L0OC 2VC1A 1M1GA 1JKQC 4P73A 4DS5A 2B8QA 2LMIA 2DW4A 3D5LA 4P2MA 2ZH9A 2DMTA 3I58A 2D7SA 1VJWA 2R42A 1HW1A 3SQOP 2XAHA 1QZZA 3OFHA 2Y0BB 5GAGU 3EVOA 2RHQB 1RHRB 3UCGA 2UZAA 3IAM9 5GADI 2P7VB 3Q8UA 3SFUA 3QO9B 1IGNA 1KD1T 3C14A 4ZA1A 4Y2AA 1JXLA 2Y1IA 2OI2A 2XRLA 5IQ6A 3G6VA 2C2DA 4HNTA 5HN0A 4X1EA 4N4OB 4RW6A 4LREA 2CRGA 1UWBA 1U1KA 4U0VA 2HZCA 1SV5A 4ER8A 3VWSA 1U45A 1WZ2A 5DTDA 2GHPA 1D8YA 2AZ1A 2JOQA 2QGUA 4LITA 4ZMMA 1D3WA 4ABZA 1ETOA 5B66C 2XVCA 3CD5A 2WB1A 2FBHA 3NOGA 3FBCA 1UKUA 2XROA 2VFVA 1XSXA 2VG6A 4KY3A 2VG5B 4P9UA 4A0YA 4YEJA 2WTFA 1KR4A 3AG3H 3CLOA 4NXMJ 2QSFA 2L4MA 2DPJA 3MOJB 2RD5C 2MC4A 3ZTPA 4B9NA 4EBDA 2HHUA 2J8AA 4DQQA 4ZIWA 4TQRA 3I53A 3BCBA 1WACA 4S0MA 5FKOA 3RCOA 1N88A 4JI8J 2A68F 4DYQA 5FIIA 2VOPA 1JLBB 2B4PA 2FJVA 4I6ZA 1YSJA 4IH7A 1HYSB 1UVKA 4IEJA 1RAFB 3QRQA 1GT0C 2EFGA 3SXYA 2Y9ZA 5LMUF 2N82B 1AROP 2F4VF 4J9NA 4A3EJ 1K47A 1S1UA 1IBCB 3H7HB 2ABYA 1HXDA 1J5OA 3TA2A 3D54A 5KFKA 2DU9A 1WC6A 2KTQA 2E5JA 1X4FA 4A5MA 4O0NA 3Q2TC 4ENNA 1N36F 4FASD 2W7AA 3BQYA 2LMDA 4IRKA 4P9FA 1FNOA 2BE7D 2DNZA 4QIVA 2FD2A 1KN6A 2OJ3A 4EMSA 2PG4A 4RS8A 1JE8A 1RR7A 4J37A 5B08A 7FD1A 4EZ6A 3JSBA 2ME6A 1XGMA 2AYBA 1KOOA 1UVIA 5D77A 5M3MJ 6AT1B 1TL3A 3G6YA 2BYCA 2WBMA 5EX3A 4E6KG 4NYPA 1ZM4A 4AE5A 5DQIA 1YX5A 1M5HA 4Z2YA 4EO8A 4ED3A 2PGCA 3HKWA 3BJYA 3K5MA 3KX2A 1LWEB 5AE3A 3AFHA 3T6JA 3WTZA 1OO0B 2ASJA 4DV0F 2CFXA 3HGYA 1CLFA 1S1WB 4N8OA 1UHMA 1ACMB 3TBIA 2VL8A 3OYGA 4YHHJ 2HW3A 2CPYA 1HNZJ 4ECRA 4DV6F 2VFSA 1ZH5A 3QYEA 1W5TA 3GV8B 4P5OA 4MHGA 2HQAA 1VQOI 3F9KA 2OSRA 3M6UA 1SEUA 2HVEA 2IJFA 3HIFA 3GZ7A 1TMMA 3DDIA 3GBGA 3S1RJ 3LGMA 2DA3A 1P8GA 1S49A 3MR6A 2VBXA 2GMJA 1MD0A 4HHUA 4OX9J 1LDDA 3DRPA 2M70A 5LM7E 2UVWA 4NC8A 2GA2A 3CCSI 5CXTA 4Q5VA 2RN7A 4LIWA 3QU3A 4QCLA 2JFKA 3B4DA 1Q1KA 1O7LA 1U26A 1NJZA 2YR2A 4DSFA 1UZDA 3VAGA 3SMZA 5EJCA 3FWEA 2LQBA 3NOCA 1H2UX 2DLLA 1FA0A 2E29A 4G9YA 3LPYA 5B0CA 2AS5F 4R1HA 1SL0A 1E6YB 2ZO4A 5ILUA 1D8KA 3MTJA 2ZHBA 4C0OC 4EMDA 3QYFA 2K2PA 2K9NA 2HIQA 1YJWI 1RUSA 1BUXA 1FLIA 2GNKA 2LR8A 4MYUA 3VTIA 1NK5A 2W7OA 1QAIA 3I5UA 2ZC4A 2AEJA 4B44A 3MM6B 4DFKA 3I0RB 3H5RA 4GKKJ 2QQ8A 3BT9A 2Q2EB 4FKXA 2NZ4A 5KFMA 4PJJA 4WFAQ 2RDIA 3DTKA 2MLXA 4KO0A 3MR5A 1KQSR 3DLAA 3RIRA 5IWAF 4C97A 4X4VA 2X9DA 4KT6A 1YK9A 4QLCU 2QIFA 5C24B 3CUQB 2FLOA 3HVRA 2GV1A 5CLSA 4MKYA 3DMJA 2V1XA 4X4OA 3BR5A 3MZYA 3NRBA 1B9NA 2KL4A 4QYZK 1P6TA 5BXIA 1ULRA 3RSNA 2XMWA 3M8WA 2ISZA 1NK6A 5F1JA 4PGGA 5KK1A 2DEJA 1C1CB 3CCRS 2ZH6A 5J6XA 1W5SA 1VQPI 1I6HJ 3MCZA 5AJ3J 4ZYGA 2QA4G 3OMYA 8RUCA 2XGDA 3RRKA 5M5XJ 3ZQLA 1T05A 4O4GB 4MKBA 1U6FA 4MFBB 3MTKA 1XMKA 3FBFA 1NO8A 2XWXA 5E3CA 4CLUA 2IVFB 3G1MA 3PYFA 2GOMA 1X1AA 3WU1B 2E5HA 5T7LB 4IYQA 1WI8A 4FYWB 2M8DB 3GCXP 1EAYC 2KRCA 3T1YJ 3EYZA 1FOXA 1HMVB 3JAMK 2LKXA 1BL0A 2H6BA 2D9PA 2HVIA 4WK3A 3HHLD 1TVRA 1ONVA 4JK1X 3O2PE 5ETNA 2E1MC 1S6UA 3OYBA 3NGKA 4Z7CA 3BS9A 3CJ2A 3F3XA 1TL5A 4KIAA 1I94J 1AW0A 2DY1A 1H2TZ 3M8ZA 3AG1H 2XAQA 2HVZA 1RLCL 3GVAA 2AU0A 4LJMA 3OPKA 2V9KA 1ZM3A 3NMAA 1SVLA 4ECXA 1XNQF 2CQXA 4C3JJ 1UZHA 4RW4A 1NKBA 3NGSA 3V7CA 3LSIA 4YR3A 3ZO7A 5HSPA 2UV1A 5CVRA 4D0PA 4IH5A 4X65F 1R5HA 2G0JA 2VG7B 4LMZA 4FE7A 3T5LA 1X4HA 1RTIA 2V2VA 1D5YA 4V2GA 5D5WB 2J7KA 3FHZA 4RGSA 4KJZA 2LY2A 4MLOA 3KUGA 2ZH1A 4DR5J 2HXOA 4M3FA 1WFXA 4YEAA 2LY9A 3M2VB 2JEJA 1SBRA 2HNYB 3QJPA 3I59A 3ILJA 3GJRB 2MKHA 4F4ZA 3BY6A 1UAAA 1PAUB 5DJBA 3H25A 3JAMU 2M3DA 4USJC 1OYIA 2R7TA 4LBIA 2GX8A 2QFJA 3KEQA 3G4SI 1PIEA 3DLLF 1LXNA 1D1CA 3G1LA 1CC8A 1U6BA 1TKTB 1JLFB 1QBJA 3ZZTA 1MH4A 1TV6B 3IH4A 4DV1F 1ACIA 3H9JA 5E3QA 3EICA 5H9FJ 4I67A 2WAQA 5LBQA 4U7UK 2LEPA 2A07F 1QGPA 5L3BA 3J80K 3WHCA 5E79C 1UVMA 1RAAB 1H9TA 3I9V9 1YW8A 1S0NA 4H0EA 3NRVA 2HK2A 4URGA 3GMGA 4DR6J 1KU9A 5L3DA 2KYXA 5HAOA 3M30A 3MEEB 4OINF 2DNOA 1P9QC 3KEYA 1WH7A 2I5UA 2EBGA 3PO3J 2IDLA 3U9GA 4LF5F 2JEGA 3IA0A 3FNNA 2XV4S 2DYSH 1RHQB 1JJCB 3FBEA 2O5DA 2C2ZB 4I1TA 1CQNA 3OV8A 2FZGB 2VDIA 4FE4A 2DXFA 1JKOC 1A6LA 5F8GA 1XMOF 5L3CA 2AX1A 4ZCLA 4QR0A 3C8YA 2YH0A 3WODF 2J5PA 3HSRA 4JI0J 3FX3A 2HQFA 4FX0A 2ZSIB 2JHEA 2B7CB 4ED4A 1AHDP 2IAJA 3HOSA 2HYGD 1KOHA 5DM7Q 3CUOA 2EZHA 2MJUA 1VRTB 4XRFA 2JFDA 2JA5J 5D3GB 4RO0A 2FOKA 2MKCA 2YKMA 1MJAA 4TLRA 5GMEA 3PTWA 3NAHA 3JTHA 4M3EA 1OSCA 1LWFB 4DL7A 2WY7Q 5E3PA 1HF0A 4C8NA 4XSZF 4IF4A 3P9KA 3RYPA 4OI6A 3Q8QB 4X6AJ 3PYGA 1K73T 4RAFA 1YX3A 2Z0GA 4MTPA 4CLYA 3D67A 5KAFC 3QAHA 2B63J 5CYQB 4BJ5C 1XTZA 4LIRA 3J80U 4J01A 2CJAA 3GCWP 1DQAA 3J7AO 1VQ4I 4AYBN 2OCEA 2GJ2A 4DUYF 3AQPA 4H4KC 4FDFA 3N28A 1B72B 3OIPA 4C3IJ 3VGSA 4DF4A 5EWFA 1DPUA 1KU3A 5ILSA 3G8QA 1ZAVA 3NWSA 4ZLNA 4JP8A 4HX7A 4BC7A 2GC8A 5AE2A 3FCHA 3R6GB 2DDAA 4OZJA 4U87A 4USHA 1ITPA 2Z3YA 2E7WA 1CS4B 3M1VA 3MPDA 4IOBA 4X62F 2RQ4A 1H88C 5GMKa 1QA6A 3PFOA 1RUNA 2CPIA 5JMNA 1FVQA 3TO8A 1NKEA 4WWSA 3GLXA 3QOEA 4M71A 4ENJA 4WCEQ 3VYUB 1VOMA 4JI2F 2HHHJ 1LW2B 1MKMA 2HU9A 3IXQA 3D1QA 2ILZA 4KGVB 3LANA 3ZN0A 3RB6A 2RV8A 3G8TA 3IS9A 4IHVA 2KB2A 4KV8B 3QIDA 3NKYA 3KLHA 1OKRA 3FZVA 2OPSA 2F4VJ 2XCAA 3HRTA 3DXBA 2DGXA 2V2QA 2HFSA 1ZRDA 3CB4A 5DGAA 4EM2A 4HLYA 2FLNA 1K7AA 3A8EA 1J5YA 3BTJA 1RHUB 4KIBA 1HBUA 2C3MA 4XDCA 4XBFA 4X4SA 3FDYA 5B5EC 3HHLC 2PA8D 3BC8A 1EH7A 3V7SA 2LDIA 5IM0A 2CQPA 4CCJA 2R92J 4IDKB 1A9NB 3E51A 5BR8F 5CVIA 4AFFA 2FA5A 1VCTA 1Z2LA 4F67A 4JI5F 2HG4A 1U5TA 2M45A 1ZLJA 5BOXA 1AWCA 2J8SA 3MUMP 1CEZA 1RT1A 1RUOA 3TEHB 4QPTA 3V4MA 4Q2MA 4XN3A 2L3DA 1F5TA 4DV0J 3FSYA 2DR7A 4RMNA 1G6BA 3H4DA 5KT4A 2RILA 2YQ0A 3OJSA 3D1OA 4NYZA 2EFVA 3GSDA 3IC1A 4KISA 5L39A 3TZZA 1YWXA 1TT5B 4UVBA 3J7YI 4RNMA 4NDLA 1XX5A 1GVJA 4XPCA 1KLNA 4DV6J 4FETA 6PAXA 1SC1B 3OFFA 3MAAB 4PUOB 4OI4A 1T0FA 2HYFA 1ZELA 3LSRA 5IQQA 3IBFB 5A8RA 3PSFA 2EG2A 3N6LA 1R49A 1RU2A 3KDOA 1U24A 4IFVA 2O3DA 2DNPA 5A0YA 3MFHA 3Q8RB 1T11A 1RZMA 5FB2A 4WFNQ 2ALYB 1FJEB 2LBFA 1VQ7I 5E41A 1U0SA 3QT5A 2PI0A 2HRUA 3OBIA 2B4OA 1MSEC 2M8EA 1RCOB 4Y6IA 2VICA 2Y75A 4ZN3A 2GWRA 1SQFA 2VDHA 3WHBA 4X66F 2DRAA 3ZCOA 3ABUA 3MF5A 1WC3A 3PRDA 2FQQB 2RQMA 2E1RA 1X0PA 4Q47A 3QIPB 1S1XA 3OSNA 1C4CA 1X1PA 4RGRA 4KITB 3WIUA 1SFEA 4UQTA 4I09A 5J4YA 2MZSA 4ED8A 2AHQA 2JVGA 3QPIA 3SZPA 1T7PA 2LKPA 2RE1A 2QENA 2VFTA 2D3O1 5BYSA 2BXZA 3OVBA 5I42B 4TYBA 4ILMA 4V19J 1WSUA 2OTLS 1FWKA 4XDDA 4O23A 4NNJA 1GXPA 2X1GA 4JI6F 3MVPA 4EI2A 3QNWB 4I64A 3G9CA 1VI0A 2BANA 2W9BA 1VK8A 3MM9A 5CPRB 4CCHA 1NSKL 3PJ9A 1PUFB 4MFDA 4ZOSA 5IWAJ 2BKOA 4BS2A 5KFXA 2A6OA 2BMBA 1JHHA 1WG4A 4JBAA 3TAPA 2WB4A 4LFCJ 3ZTRA 5F1RA 5LXRA 1P1LA 3V5RA 5F0HA 4N9IA 1J59A 2XIGA 2OPPB 3VGVA 2YWEA 3ABKH 2YQ3A 5K5MA 2PD1A 2D2WA 1LDJA 1IUYA 3JTNA 4WIQA 2OMOA 3CCVS 4ZCMA 2FJWA 1GTHA 2LF7A 4PZVA 5IOYA 1MG7A 3HOTA 3GJQB 1IN8A 2OTJI 2XC9A 4UY8I 2HS0A 1T8IA 2ATCB 1AA7A 3UNYA 1HBXG 3T5KA 3BR6A 2PI4A 2IS1A 4IUFA 2NVXJ 4RBTA 1BR4A 5E3RA 1XMQF 3VDXA 1U1OA 1SJRA 2XZTB 5GVQA 4I56A 1MDMB 2ZM6F 2G1HA 2CQBA 5H9EK 2J9CA 2QL9B 3AFGA 1YG0A 4II2A 1VMBA 4ZYDA 1Q86T 3TQNA 3ET6B 4OI3A 2B6AA 1GAOA 3CC2I 1EH8A 1T95A 3ZZPA 3M2RA 2DR6A 2YVSA 4KN7X 1RAOA 3RR7A 1E3PA 4A46A 3FVYA 3MECB 1QSYA 4URSA 1VLOA 3PCOB 4TKTA 2VFUA 3TAMB 4QOTA 3BJOA 2FVRA 4LG3A 1D1UA 4G3IA 2VKDA 1HC8A 3L1PA 5HROB 2KHMA 3VPRA 1DU0A 4GCVA 3M8PB 1K83J 2MQQA 1PBUA 4BDYA 3BZKA 1JX4A 1NK2P 2W4PA 3CCTA 2O9LA 5E3OA 4RW8A 5L3GA 1LQ1A 2N3LA 2ZH8A 1R1VA 3DRRB 1JT0A 3O6QA 2AJFE 5GTHC 1K61A 1IWGA 2GO9A 2QC3A 3BQ2A 2VQEF 2QZ8A 1O5JA 3O8WA 4IG0B 1S7AA 5A8KA 5F27A 3S1TA 4LQ3A 1VBZA 4P72A 4OX6A 5ERIA 1KQ9A 1ZQ3P 1VGYA 3QBCA 4EGLA 1RDRA 2L7FP 2BE2A 4LR7A 1FRIA 3HSZA 1WCMJ 2HVRA 3FK6A 1I6JA 2FHMA 2HNDB 4DPOA 3M8QA 2ZNYA 1HKTA 5M5YJ 3GFYA 3DKXA 2K85A 1NDLA 3UVJA 1BC6A 4AUXA 2VT2A 4ZPBA 3Q9SA 3UN2A 1J75A 5KAIC 3OR1B 4Y2KA 2JH3A 3R0AA 1YRNA 4I7FB 4IFYA 2GO8A 4EBEA 3W66A 3HOZJ 2YU9J 4HW0A 3JSMA 2QYGA 3S6EA 1NK3P 3OTCA 2HVQA 3GV5B 4JX4A 4AL5A 2B3TB 1X2NA 3A8IA 1X7VA 1S1VB 2WBRA 2KRFA 1T8EA 4ZPTR 1TP4A 3CJ8A 4OV1A 2DA1A 3B78A 3MKLA 4MNUA 1RT3A 2K7LA 3FXMA 2J7UA 1KQFB 3MZHA 2KJVA 5D0EA 4I02A 2YKQA 3V7RA 4C30A 1WEZA 3DI6A 3MWBA 3L7OA 4ID5B 3DLLQ 3NCRA 2QBYB 1YRUA 1TC3C 3FISA 3EE3A 1KS2A 4DUZF 1YITI 1K78A 1BI2A 3EXYA 1IM6A 4NC6A 5DM6F 2YNFB 2YPRA 2LQ8A 4LF5J 1JLEB 2B43A 2VQHA 2BW7A 2QKMB 5DUKA 3MMCA 4PUSA 1RKJA 3GYHX 3PM1A 1TP7A 5D6GA 1LJ9A 4UTGA 4QZVB 3P8BB 1BQNA 4DS4A 2UU9F 3E6DA 2VBYA 5IPAA 3UPFA 1VF9A 2NYXA 3TARA 2FJBB 4BXFA 1KTVA 1RHJB 5TJJA 1H73A 1XMBA 2ELJA 4OYMA 2Q6CA 3ZTOA 3IRRA 2OUMA 3SDEA 1MN9A 4ED1A 3DTIA 2VQFJ 2DVIA 5DG8A 2GVZA 2FMYA 5FO5A 4Q44A 1KLMA 3OS0A 2PDAA 1B70B 3G87A 2K27A 2LXIA 3ERMA 5JVGF 4ED5A 5F3ZA 3TKYA 5M2PA 3IGNA 4D3HA 4DUYJ 4EYIB 1KU2A 2P0WA 4Y52J 2Q0OA 5EGOA 2EQRA 3DN9A 2QYCA 1FF2A 1X4AA 2AYMA 4G1QA 2ACYA 3ITHA 1EA3A 3G86A 2BJEA 3GFMA 3J81Y 3WG9A 3VB2A 3DRSA 5KFOA 2R0QC 2IRXA 2AQFA 4JUZA 2CG4A 2V0NA 4F50A 1SKWA 2KI2A 2W8LA 3E01B 2EFPA 3JQMA 1Z2ZA 3SCLE 2QGFB 2W9CB 1U0JA 2LU1A 2KO1A 4DEZA 1RWOB 3H0GJ 2IYIA 4ZHRA 2GMHA 1CBKA 1WI9A 4A48A 4ZPDA 3KLEB 4HPQA 3QRFF 4EJWA 2DA7A 5HMZA 4P2FA 2K5CA 2OKQA 2C28A 2O3FA 4OZNA 2NCKL 2CV1A 5AXMA 1JKRC 4XO0A 2XY6A 4LLGF 3GG1A 4UT4A 3T6BA 3JRIA 2I2YA 4DU7A 4DR4J 4L74A 2MZTA 5BNGA 4OI2A 4CLPA 3CGIA 1PDNC 4RX6A 3P5BP 2OJED 2IPQX 2L0KA 1WH5A 4RAZA 1RKTA 1JLQA 3IR7B 4XKBA 3LGNA 5JXSA 2JLEA 1OFCX 4I6YA 1HQEB 4OLPA 5LEKA 2Y0MA 3F72A 4DV5F 1UHSA 3UDCA 1T3OA 3FF5A 2CZ9A 3OT9A 2KT5A 3S15J 3GFZA 3EUHC 4A47A 1RTJA 1HHQA 1U1QA 2XNQA 1N75A 3PUBA 3DLEB 2MYFA 4FT8A 2IJRA 4DSEA 1Z1DA 2OZUA 3N01A 1R7JA 4DU8A 2ZBCA 5C4XJ 1A0OB 4B3MJ 5HS8A 1ZA2B 2WVCA 2HQCA 1A6IA 2FB0A 3GWCA 2Z1DA 5B1AH 3FUYA 4I2OA 4DN0A 4FCYA 3V4GA 2XS7A 2DIVA 5GAEU 4XLPF 1MMDA 3CO9A 3QYYA 2DISA 3JS9A 4GC6A 2QN6B 1IW7F 4DV2J 2P6TA 3CDIA 3C14B 5FKNA 2M2BA 3R61A 4ATNA 3AL0C 1FKOA 3L00A 1PKUA 4RW6B 3LA0A 2R7FA 5D4RA 4DL3A 2M87A 3DM2A 2GIVA 1SV5B 3TYTA 3T8TA 5LEJA 1R9TJ 3ZC4A 1CC7A 4MGRA 3THVA 3DBLB 2ZZTA 2COBA 2CMPA 2EJRA 3OY9A 3UWTA 2EINH 2ZKUA 2W01A 2A6MA 3NARA 1U1MA 4DL2A 3LAKA 1Y8QB 4K7QA 4K50A 2L9VA 5BMZA 1P1TA 2W2QP 3CCJS 3BGRA 3F22A 2BQRA 4FXWA 2C22A 4CO8A 2V6CA 2EG1A 4LB6B 2LDYA 3DCAA 1ZZFA 4ETZA 2ME0A 2CPDA 5LSOA 2Q1LA 2XPWA 2KHDA 5J3LA 1T02A 2LC2A 2EH3A 3PM9A 4C2MJ 1OCOH 1X4BA 3WC0A 4C3KA 4IQXA 2AYGA 1B0TA 2D3OR 3NEUA 3ZGKA 4F8RA 4DFMA 2HZDA 1J5OB 1Q8KA 1YJUA 4DNCA 4OYXA 1GMWA 3E6CC 4I6AA 3M32B 5K8PA 3HRUA 4N4NB 4BBRJ 3JRDA 1STZA 4TXSA 1VHIA 2B0GA 5ETMA 3ZP5A 2Z8QA 2W48A 3LP2A 4M72A 1JK9B 3BSNA 4IO9F 3E8OA 5LFAA 1TR0A 3DOLB 1U4BA 3RKXA 4JI6J 4CH1A 5BJRA 3ABMH 4FPRA 2DTJA 2M4KA 1YBAA 2XMMA 1PJ6A 4DF8A 2FF4A 4M5NA 3GTJJ 1TL3B 3ETMA 5KT5A 4YP3A 1RWNB 2DCEA 5D6EA 2NPIA 2SXLA 2XI3A 4YFXF 4ZP8A 2DNKA 3CP2A 2OEJA 3J7AN 2H4YB 3M05A 5KFFA 1N56A 3P3DA 3B82A 5KFAA 4II3A 1KA8A 4EJVA 3GFXA 2FXAA 3NAIA 3I9ZA 2AEMA 3EZOA 4ILLA 2FJEB 4RA2A 1TWFJ 4HYKA 2H54B 4L76A 5CQEA 4XIDA 3BROA 2XWYA 4YR0A 2EZLA 1JJ2R 1RBOB 5K7HA 1TUWA 2QLWA 4EATA 1R5ID 3FMQA 1K4SA 3DU6A 1W7PD 2DTZA 2Z2SB 3JXOA 1IBKF 4Y13A 3BH6B 1FXDA 3DRPB 2FHJA 2Y30A 1Y3JA 4M5GA 4B9MA 1Y5NB 2ZM6J 3CULA 2BYVE 3RB3A 4E70A 1RT6B 2ID3A 5C25B 2XUBA 1QUPA 3D5SC 3UR0A 3T41A 2UXCF 3L7PA 4ESBA 1FRKA 3BG3A 1TQPA 2BRLA 2Q1ZB 1RESA 1M1EB 4BJ6C 4CO5A 1YRXA 2VONA 4BUPA 4KMUX 2IFXA 3X2QH 2DFFA 3V2UC 3K1NA 4Y2IA 2AP6A 5T41A 4K2EA 5EX0A 1QSLA 1FOYA 4RU2A 2XG8A 4PR6A 2F48A 1Y4ZB 1Q5VA 2DODA 4B3OB 4OWRB 2V94A 4S05A 3BKFA 4NRUA 3A2KA 2R4FA 3GONA 3BDPA 1X3ZB 3MCMA 1EKRA 2XMTA 5D4SA 4Q43A 3JB9k 3ILIA 3IAM2 1CSJA 2PEBA 1WD6A 2Z2MA 5FLXY 4RNNA 4WF2A 3CMEI 3CDBA 4QU6A 4NEZA 4F0KA 2DGOA 2BRKA 3C6TA 4HLXA 4F52A 3C6UA 2L5QA 4YIRX 2W57A 4LF8F 3A12A 1R6RA 2VQEJ 3TX0A 3GTLJ 1GXTA 4OYIA 4DZ6A 2FBIA 4C3HJ 1CJVB 1XD7A 3ZQHA 1T94A 1RZ4A 3CJRA 4OU0A 3DMJB 3D4JA 3BB5A 3B6BA 3DDKA 2M4GA 2UWMA 1SC7A 4ZVRB 3E5UA 1MN7A 3AOCA 2NXCA 3H5UA 4A3CJ 5HL7Q 4A3MJ 4QYRA 3VYTB 1VBKA 1M1KT 3ENVA 3S8PA 3WC2A 1NB2A 4KKOB 3WU0A 2D1VA 1A7GE 5J1RA 3ASNH 4Y7NJ 4U95A 1T05B 1QO0D 1F3VA 1BN5A 3ZZYA 5IV4A 3CUNA 2OV7A 4X2BA 3EMTA 2FQ4A 4E7HA 1XWLA 1XMAA 1N54B 2KIUA 3WDOA 2BV3A 1B6AA 3H98A 3ZZ0A 1W36D 3SBMA 3HM9A 3K57A 2XRNA 1NHKL 1TVRB 1VHFA 3G71S 1FEEA 2OPRA 1DGWY 1P7IA 3GTPJ 1S5ZA 4DZPA 4A93J 4ZZLA 4DUZJ 2M7BA 3QRPA 1E3OC 4C3LA 2NQPA 4ZVTB 4JP0A 3PFEA 4KNYA 3OR2B 4C8YA 4TV7A 5HVHA 1RJJA 2VG5A 4D5CA 2RDJA 3GTMJ 1URNA 5CVVA 2ROGA 1SFKA 3M8JA 2ZH2A 1V6HA 2DOAA 2Y0SD 2MH2A 3GP9A 2PE8A 4LSLA 1OMSA 4LBPA 4W92B 4RW4B 1OIAA 3R8YA 2K40A 1HWJA 2MQMA 2JRSA 4NHJA 3IBWA 1SQGA 5DM6Q 1S29A 2V1NA 1SH3A 3W62A 1HYSA 3W64A 4RLQA 3KJNB 5LJ5Y 1R00A 1RTIB 2VBWA 3FXQA 2JLGA 3FKJA 4MTDA 4BU2A 2YY3A 2CO5A 2L02A 5D4NA 2NXUA 3BEGB 3EGNA 2M1BA 2YKNA 3OYEA 2POKA 4XAKA 1SIWB 3GU0A 1Q8IA 2XI2A 3WTVC 2QRRA 2W84A 5HLHA 1YO5C 4X4PA 5J2QA 2DB1A 3GIKA 2H1KA 1N34F 1QHHD 1ZPVA 5D8LB 4KPYA 2BKNA 3NGUA 2EIKH 3EWGA 4IOAF 4CRJA 2R8KA 2HLTA 4YDXA 1S1TB 3ZXWA 1BM9A 4XORA 1U1LA 1YLFA 2IIHA 1UCRA 5LGUA 5HJYA 3E6BA 2PT0A 3WTUC 5GTIC 4JI7F 3S1QJ 3IHUA 3DYAB 2MYSA 3W8PA 4TU9A 5K7FA 5CCLA 3AAWB 2DXDA 2L08A 1IR1A 4NMLA 2O1PA 2XGPA 2QWWA 1F1ZA 2J0XA 3M30B 1H72C 3CJKB 2ELHA 1C0TA 5KFLA 3BJAA 1D3YA 5J4VA 3W63A 1BC7C 2Z30B 3PYEA 1I39A 2IRYA 4X4NA 1S0VA 2EPFA 1KHWA 3OQ2A 1L3UA 2R7WA 4BQAA 1NMEB 1Y6IA 4IQMA 2CQGA 1O3QA 2DO4A 2OGUA 3HXMA 1YGYA 1XTAA 2HAFA 1ZYQA 3WHIA 1VQOS 2LK2A 3TP2A 1J27A 1U8BA 4UV9A 1HHTP 2R7RA 1D8ZA 5LOQA 2YKMB 1PYVA 1WJEA 1NUEA 2A1BA 3I96A 5HBMB 3HJFA 2H6CA 4KH1B 1OCZH 2HQDA 3O8GA 2JQ7A 3PQJA 4UUXA 4AXIA 2RUSA 1S76D 2OPQB 5E8GA 5CVJA 3AY0A 2DYAA 1T3NA 2QLZA 1HNVA 4OZ1A 5AE1A 5HP1A 3MM6A 3I0RA 1R1TA 3I4MJ 3R7BB 1ZM2A 4E7JA 2Q2EA 3LGHA 5RUBA 4OYOA 1RYSA 3DOKB 4G7HF 2V26A 2XKOA 3G82A 1SFUA 4P6QA 2E5NA 3U1KA 3LSJA 3TVZA 1R36A 3NCPA 2CWEA 3D1NI 2G2ZA 1MIJA 2CV2A 2O5RA 3Q8YA 3P96A 5C24A 3N6NA 3CUQA 3TRGA 2MKKA 4MEXF 3UCUP 2WY8Q 4X4TA 3PACA 3SCJE 2BACA 2A2DA 4H4KA 1OQ3A 3EM1A 2UUZA 4EU0A 4P2XA 3M1VB 3IR5B 4FYXB 3BYPA 1OR7C 3MM5B 4F92B 2X1EA 1WJ9A 3CCLI 1IVZA 3VODA 5FD5A 3S2HJ 1MMLA 2CJXB 3MEXA 2E5ZA 2V6EA 4BQQA 1WJFA 3T9ZA 5L38A 3HKZN 5C7PA 1I3AA 2FSWA 2ZC2A 3I4NJ 5TGTA 2G7HA 3QT6A 2MY7A 4D1QA 2P5VA 4O4GA 1EP4B 1HR0F 3J81Z 4MFBA 2KVIA 4JV1A 3IS9B 1D9DA 3RW6A 5T14A 1TTHB 1Z77A 3KLIB 3KLHB 5ITHA 3A4CA 1HNXJ 2OPSB 4WXHA 5HDKA 3HJVA 1YOVB 2BQUA 3TO6A 1Q95G 1Z21A 1LKZA 4QIGA 2HNZB 1ZN2A 1W36C 1YYVA 3BO4A 3HSDA 2F9DA 3V4IA 4DL0C 2O61A 1EQMA 3W8GA 3SI8A 2GHWA 4OMZA 1SH2A 1S77D 1QAXA 3RZDJ 2WVFA 2MW8A 5F0FA 1IBLJ 4LF7F 2JA7J 2DITA 4OAZA 4RM3A 1TZ0A 4CLSA 4RKUC 3T9NA 1Q1HA 5DLFA 5F0WA 1W4MA 3VWBA 3O3LA 2R2TA 3DFGA 1U5TB 3CO7C 3CDUA 3HHLA 1HPZA 4XK8C 3X1LB 1HWKA 5FDLA 4FISA 3KJVA 3TQEA 1RT1B 3BP8A 4Y4RA 5E33A 2BOAA 1URRA 1UFLA 4CI0B 2HDWA 4FF2A 1CVJA 4IO9Q 1M5KC 4XICA 1R43A 3K8WA 3KHRA 4OYPA 2W4SA 4UV8A 4IRGA 2A5YB 3HVTA 4NLGA 2JDJA 2XHCA 1EF4A 2HNYA 1W7WA 3MKWB 5A8RB 3CJ5A 2KMUA 3SQGA 5DS7A 5KNLA 1Y5IB 3CE8A 4B9TA 2XLJA 4EUVA 2DRBA 1X4DA 2V67A 3LW5C 5JVHQ 3W61A 1TFWA 1IBKJ 4WU3A 4QR1A 4K4WA 2DNRA 2PMZA 5KFSA 2CQ7A 2ESHA 5KFZA 2JWNA 2LBFB 5AONA 1SJ4P 2BW2A 3HDDA 1DQ8A 1XS9A 1VFJA 2XSFA 4BHQA 1QVGR 1TV6A 2I0XA 5AXLA 2AW0A 5B09A 3GTQJ 1X60A 3AD9C 2VXZA 4H4OB 1UWAA 2CPFA 2DNNA 2FY1A 2I9SA 1R4MB 1Q7YT 1YIOA 1YX2A 2P81A 1DDNA 1D1BA 1R31A 4DLEA 1IJWC 1S3JA 2CQKA 5HQLA 2OF7A 1B99A 3LOUA 1IRFA 2ZFUA 3K4LA 3MEEA 3IH2A 4WKRA 3S7RA 3O1LA 5L1LA 1UVJA 3GR1A 3M8FA 2VLAA 2KVQE 2EC2A 3QT8A 1Z6TA 2AMCB 2AO9A 5IOZA 4F3QA 5A8WA 2BANB 3Q22A 4U67Q 3M8RA 2CJYB 3MM9B 4U0YA 2STWA 1KWMA 3LA7A 3KK2B 4A8MP 2YS9A 1JKPC 1S9EA 3KKFA 1BOBA 4BE2A 1GEHA 3R5CA 1RWPB 4ES2A 4CO4A 3R1LA 2BX6A 2BZ2A 2R5YB 3MI7X 1VRTA 4ILRA 3KG0A 4JYAF 1YVFA 1WHXA 1CF7A 3FKBA 1TL7A 4DX5A 5BYRA 3S01A 1RBAA 5CZXA 3CCEI 4RNOA 1LWFA 3SV4A 2KZZA 2EV6A 3VSLA 3NWGA 4ZITA 2V8VA 4BAYA 5FKLA 3FBBA 1VC5A 3LSPA 2H48B 2AHOB 3WU2C 4RBOA 1MU2B 2M0CA 4WXOA 2RT3A 5CYQA 2KFNA 1VRUA 3V6HA 1IF1A 3GB0A 2PEHA 1FRLA 1VQMI 1U2WA 2WCXA 2V1UA 3QJLA 1NJXA 3QFWA 1B72A 3WTTC 4Q0BA 1L3TA 2CZ4A 1MMNA 4HF0A 1GTEA 4HT5A 2VOOA 2JZ5A 2KDZA 3IWFA 3TJ9A 5IYCJ 2BJ7A 3A3NB 2F4FA 3JTPA 2NS1B 1WNEA 3OYDA 3LWLA 2OD5A 1BXNA 3NL0A 4DX6A 5KT7A 4ZVHA 2IRFG 1WHWA 4EV0A 3VVTA 2AZ3A 1UEKA 1HDPA 3EDRB 3JSRA 3M2RB 1WOOA 5HQMA 4NYOA 4M94A 3P7NA 2IT0A 2L48A 3PJWA 1JLAB 4P10A 5E18F 3GIMA 1IN6A 1FDBA 5GAHU 2X3GA 3RYRA 3DLHA 2PMWA 1FBSA 3I31A 4HI2A 1UJ8A 2L9SA 4C2TA 2VJUA 2Y8YA 5AT1B 5HDNA 1O57A 3BWGA 4NLYA 2I8EA 1ZG5A 3F8FA 1XN7A 1H98A 5EGYA 2ZMEC 5DUIA 3D0GE 4ON0A 2V68A 1X9SA 4JBCA 4CDIA 4KA4A 2GAUA 1QD1A 3K6GA 4IR1A 2M2EA 2HFUA 5CYJA 2RJZA 1IQZA 1BI1A 4R0EA 1JQGA 5IT4A 2M0GB 2BM1A 5IT0A 3H20A 3W7BA 4O4RA 2ROPA 4PYAA 4OIQF 2Q43A 3CMQA 4N5SA 1J5EJ 3I4HX 4B43A 4BE1A 3O2IA 1RACB 3M9AA 4YOEA 2QQAA 5KG1A 3QWUA 4DV7F 2ZD1B 1S0MA 3Q8VA 6FD1A 4HHHA 3UR3C 2GQ2A 3M8QB 3SDBA 1TAQA 1T98A 2YU3A 4GKJJ 3NCQA 3UVJB 1U49A 3GZ5A 4PPZA 4H54A 5FLXZ 2V2KA 2X0LA 4WCGA 1R1UA 5IY5H 3OL6A 1RWVB 1N34J 4IFYB 1FI4A 4AD9A 3OLAA 1E0EA 1S9GA 5E3AA 2HOSA 1NCLA 3HPGA 3P9IA 4MYTA 1GK8A 3NAUA 4HL9A 2AJQA 1CGPA 1YI2I 2ADBA 3N9UC 4DX7A 2CA9A 4G12A 5HOOA 1JUMA 3CO0P 2CFOA 4J7CA 4JI7J 1HW9A 3HX9A 3B6AA 1TQMA 1RT3B 3FHNA 5JLXA 4A8SA 1JTXA 4CLLA 4KR0B 1TAUA 1WI6A 3HJEA 3MCOA 3DI6B 3FXUA 3JRHA 2XMAA 3RDIA 1PAEX 2EKNA 2KT3A 4LGWA 2ADUA 4PUOA 2KIFA 3NNHA 2HPMA 1D1AA 1OS5A 1K78B 2YNIB 3RGIA 1VQ6I 3ZNUA 3GMEA 4M63A 3CCMI 3QPTA 2Z57B 2F4IA 3DCFA 1X0FA 4PJMA 4KT5C 2BABA 4MIWA 3MMCB 2L2OA 4G65A 4L5EA 1D0ZA 3D2WA 1A5JA 4E7IA 1WHUA 3FMWA 3QGHA 3Q0WA 1CPZA 3HPHA 1J7KA 2QA4I 5CH7B 1BQXA 4UVAA 4CYDA 2KM8C 1FNNA 2XB5A 4CO2A 2NXNB 2B9SA 2RKIB 3MPWA 1BQNB 1S48A 2P9CA 3MUVP 3WTXC 5A6WA 4ELTA 4KBIA 1OPIA 2VPZB 1V4RA 1I3OB 4CICA 1V5EA 2A6HF 1SVOA 4KDPA 2NUHA 2E9ZA 3ISZA 1L3LA 1R23A 2O67A 3KYCB 2E2HJ 1FDAA 2LG4A 4B9SA 1HOMA 3UDEA 3IN5A 2WB1D 1LQ9A 2GVZB 3BN7A 5CD4H 2XSJB 4LFUA 2P8TA 3DOMB 2KJWA 1EKEA 2B51A 4JI1F 3QZ8A 5F8JA 1MZBA 1T6SA 4ZYHA 4GO5X 2G4BA 2EA4A 4GRIA 3NS6A 2FX0A 2VKZG 4UQGA 5EGOB 3CMAS 3MHYA 1YFHA 3CF2A 4ESFA 4ZLJA 4G1QB 1PUFA 3ITHB 1ZK8A 1N5YA 2AYEA 4M1KA 3QU6A 3HK2A 2IBOA 4KIGA 2I1RA 4IZZA 4B3XA 1PILA 1OYWA 2IAIA 3MM7B 1VQ9S 1VQLI 1U09A 1Z67A 4QQBA 4KTQA 1FYLA 1T2KA 4AVPA 2PO4A 2RQCA 4F4YA 4DQ2A 1ZOTA 2J6SA 2OPPA 3BJ6A 2DCLA 1QRYA 4RB0A 1FJGF 4XNFA 3J7A1 2OEKA 1RHKB 4ZJLA 2WV1A 3EYYA 3ZOBA 1JJ4A 3RAXA 1IKVA 3SDGA 1XQIA 3N05A 4LT6A 2DMQA 1HR0J 1V5FA 1SD5A 3ULHA 2KYZA 4MEYF 5D0GA 3J7Z5 5HO4A 3LP0A 2HFHA 4Y65A 4B3SF 1XSVA 1D9AA 2GJIA 5DYMA 3NNCA 4AQYF 5IZHA 1LNQA 1D0YA 2E1OA 4Y33A 3HDSA 3WTWC 1Y1VJ 3KHGA 4NZ6A 1MWYA 1T08B 2A69F 3C2BA 5I4MA 4LRCA 5JVTA 2C6YA 3BREA 5KG7A 5EZHA 1ZR4A 1RTJB 4X4RA 1U78A 1IXRC 1RRJA 3ISND 3GWZA 1H3DA 1HI0P 3U27A 4G7OF 1N6QA 1WJAA 2AJ1A 3TAMA 1EJ9A 4DR3J 4DSKA 3OHBA 4NXNF 5B7WA 4LF7J 4A6EA 3MMYB 1WTFA 4ZVGA 4NASA 2G9WA 1ZRCA 1K8AT 2QLBB 3M8PA 2B4VA 3FCVA 1HNWF 3A03A 1GMUA 1AB8A 1LEOA 4WYLA 1ZGWA 3NBPA 1H6KX 1LFPA 3CJ4A 3MCSA 3O8HA 1ZAOA 3RW7A 3D66A 2CS3A 4LK0F 2ZHAA 2LY1A 2YKAA 3EPZA 4E7ZA 1RXOB 4EYHB 3DRRA 2M7AA 2NS8A 2FTRA 5ETLA 2A0FB 2UVUA 1ON1A 1G2HA 2EXUA 2CJ9A 3H3ZA 2AJ2A 2UZKA 1MROA 2H8RA 1TL4A 3OYIA 3JSPA 4Z37A 1NK8A 2VU5A 1BHNA 2FJDB 1SD6A 3WGHA 4ITVA 3V6DB 3J7YJ 2VFRA 4QW9A 4B47A 3K2AA 3IWNC 3UDLA 1IAWA 2ADCA 4TVAB 1UVLA 2H51B 3IGVA 1NK9A 3DLKB 5LD2C 4M5JA 3T5XA 4CT9A 2IA1A 1F43A 4YS2A 2MD0A 4CH7A 3BGRB 2BM0A 4F26A 2QEXS 1V3RA 3K9TA 1RAJA 1RAEB 4IVNA 4OYBA 2UUAF 1RYRA 1HKSA 3T1HF 5CJ9A 2HNHA 1OY6A 1ZS6A 4PZJA 2PX9A 1NLKL 1A31A 5KFWA 5DDOC 4F4KA 1CQTA 2BBYA 1SMTA 1E17A 2HYJA 3HHHA 1IN0A 2FYXA 3JQKA 4AYBA 4EGZA 2F40A 3CMYA 2UXBF 4IR9A 1Y11A 3JRGA 3GJSB 1R0CB 3LP2B 5EWEA 3K70D 3H92A 5B3SH 4R5PA 1W0TA 2BGCA 2DAOA 2ECBA 3VR1A 1WF0A 2Z2ZA 3MN2A 1ZRFA 2ZZNA 5HLTA 5HMXA 2LQ5A 2GAGC 1R7IA 2WVDA 4F3MA 3OW2R 3DKWA 1NJIT 2KRHA 3CCRI 2R8JA 1HI8A 1CULB 5HDGA 4F0MA 4XRSG 1J2VA 3OYFA 4XN0A 2Q66A 2IGNA 4YB5A 5ETPA 4L3NA 2MLZA 1MMGA 2J76E 3LQRA 2DH8A 2EV0A 4JYAJ 1KHVA 1F36A 5GAGI 1REGX 5FRMA 4WFYA 2GGPA 1KVIA 1LFUP 1QY7A 3QGIA 3OTDA 4F4WA 1Y0NA 4ECTA 3F23A 1YJRA 3KLOA 1CJUB 5HANA 4AC0A 2R3SA 4CLZA 1KDNA 4DI6A 2MH9A 3FIWA 2O66A 3PUFA 2QE5A 2DK8A 3KUHA 3MAHA 2MC3A 2E66A 4QWAA 3ICLA 3D3BJ 4A8YA 4LG0B 3MPVA 4A69C 3KLFA 1BWVA 2R3VA 2ID6A 3VZIA 3N4WA 3RR8A 2CDRB 1KU7A 3AH6A 2PBIA 1VIOA 3CTAA 3MEKA 4A3KJ 1Q0NA 2MHNA 1S6OA 2IGKA 1TK8A 4GGGA 3S3OA 3L09A 3BPXA 2RSQA 3P49B 3ILLA 2DOEA 4NCBA 2LECA 3ZZUA 1QLNA 1TKXB 5FFXA 3FXLA 5A2QK 2B56A 4KUMA 4PEOA 3ZXSA 3K4NA 4J5OA 2PMHA 4BYYA 2XBPA 3ZTSA 3MMJA 3IM9A 4EJTA 3BGLA 4M5IA 3ZMZA 4RZRA 3CJTA 1N4LA 3M1CA 2K9SA 3TQ1A 1PC5A 2GCFA 1FC3A 1RWWB 3TUPA 3CZ6A 3KP5A 1U02A 3I55S 1U2FA 3GEZA 4I01A 1P4AA 1OCPA 1UW4A 3QGPA 1MSWD 2V5HG 3C6TB 1YBUA 1N33F 4BH9A 3I5AA 1AFIA 3C6UB 2CVEA 2IHR1 3QZ7A 1HQEA 3THTA 1IBMF 1SMYF 2WZ1A 3DTEA 1FT9A 1GX6A 4Y2CA 4UB6C 3K10A 4XK4A 2WAQD 1SKSA 2STTA 1OLTA 4CDGA 1HBOB 4HQMA 3CJRB 2OD4A 5L1KA 5F64A 2MDAA 1WELA 3KHHA 1F2GA 1R8HA 4ENKA 2LYCA 1SD7A 1XG1A 2DT9A 5KOWA 1BOAA 3BBCA 3HMJG 2YX4A 2BZTA 2R7ZJ 2VKRA 2N3OA 3LALA 1NTCA 1IJEB 4UUSB 5ED4A 5I3QA 5D6FA 3ISNC 3WTSC 1QE1A 2VJ4A 2VE8A 2ZSHB 3HHGA 2EWNA 5A2QU 1PJ5A 2LVSA 2FZKB 3JR9A 4USVA 3WX8A 5KVRA 1XPXA 3KLGB 2IBDA 4RL1A 1FCAA 4G7ZF 2R2SA 3UNGC 1Q16B 3AOAA 2XF5A 3H0PA 4L6V3 2DO7A 3I71A 2K8GA 4WIIA 4ZVOB 3P6YC 4Z7YA 1U1RA 1Y00A 2EEYA 2OPRB 2MGQA 2DI3A 3BR2A 2HAIA 4G6VB 4Q8FA 1NDKA 1QTNB 3JYTB 4A3LJ 2CQHA 2PC6A 2EFNA 4N0BA 4F4XA 5DQHA 3KHLA 1NZ8A 4OYAA 3M3YJ 1OY9A 1UAWA 3D1HA 2AJ4A 3K8VA 1L3SA 3VAIA 1BJAA 3GG0A 2O03A 5DO2A 3DEEA 4F25A 4UXNA 2UVVA 2E1MB 4DPTA 4WP9A 3GFLA 4LSLB 3T5JA 1MMAA 1RT2A 4NA3A 5D8HB 5K8MA 5EUHA 3L2WA 4WXCA 1NB7A 3HOWJ 1B8IB 1SAXA 2M88A 4WWCA 5ADZA 4GRSA 2C2KB 5C42A 2B9EA 2A3JA 1K0VA 4OFZA 4LBHA 4USWA 3EGZA 3RBDA 1FFWB 4BBSJ 4ECSA 4C8KA 2MHEA 3M32A 4PABA 4NX9A 1G4CA 2JWTA 3WGIA 3KE2A 2YKNB 2C42A 1I1GA 3F21A 2R7QA 4WXDA 4U7UD 1T03B 4K4XA 3NEKA 5MLCV 4JI1J 3DOLA 5J2QB 2MPUA 2W8KA 4OHZA 1ULYA 3DKDA 3U1MA 4ZPAA 4ZIVA 2Y48A 1RT7B 1TWGJ 2LD5A 3K5OA 2KG0A 4DL4A 3MUTP 3FDSA 1O51A 3BTIA 4G6QA 2BY2A 4NOHA 3F56A 4L0YB 5KG2A 1X8DA 1YS7A 3OFGA 1S7OA 2KFYA 2EK6A 3SYZA 4WX9A 2A10A 5A6PA 4FQGA 5E1ZB 3PO4A 2DXIA 2HI3A 1PYOB 4PQAA 3GUDA 1DFDA 2YWHA 4N9HA 2VKVA 3C15A 1AOYA 2V6AA 3THPA 1NJWA 1G3TA 2HEKA 2MSSA 1HNIA 4CT8A 1DP7P 2WTEA 5IT9Y 4M5HA 3HL2A 3HULA 2H65B 2K3KA 2NS0A 4LIVA 2XULA 3OS2A 5J2MB 1UA0A 1Y10A 4KJIA 3H5SA 3AAFA 1C0TB 5E3LA 4JI3J 4B9VA 3L2UA 3PSIA 2XAUA 3A01B 2KT0A 5B0DA 2DHHA 3GIJA 1UJ4A 3PYDA 2HKOA 3N0VA 3W9JA 4AQYJ 2R5ZA 4FTHA 2H1YA 4ZVUB 2Q6BA 1XR7A 3W3SA 4MK9A 5KFQA 1RT6A 2CQQA 1FO1A 5C25A 2WADA 3I6PA 2MQLA 5FD1A 2N7YA 2MKJA 3TA1A 3LH2S 4JV2A 3HHEA 4U88A 1IN7A 4CHUA 1HIYA 1MWZA 3DC2A 4LLNA 4E7LA 1X5OA 4DR7F 2G0CA 2ZITA 4Q2LA 2GHVC 4CIOA 3RAQA 3G8SA 4ECUA 2HWHA 2YKOA 2W2OP 1Z7UA 4AU7A 1R4NB 3TI0A 4B3OA 3TDZC 2DMPA 1UVNA 1IC8A 5DDRC 3R6LB 2V50A 4NUBA 1HNVB 1ZG1A 1X31C 3SZGA 3LUYA 1F0XA 5HP1B 3ZQIA 5J2PB 1OMIA 5B0EA 2W1BA 3ZQQA 3LFKA 3RTRA 3O6BB 5HVFA 3HEFA 3T8RA 4YRVA 2XGQA 4DL6A 2L4AA 4RB3C 5CABA 4LD5A 4KHRA 3JQJA 4NWBA 3PR5B 4DQRA 1FE4A 3G82B 1KONA 1FNMA 3TJAA 4TY9A 4MK8A 2QT7A 1Q4RA 3DRXA 3CC7S 3GCMA 4G8XA 1CJVA 3IG1A 1M5OC 1RE1B 1QPMA 1RU1A 3CMES 1D0EA 4B48A 3IM8A 4XKVA 4W97A 4YG2F 5LXYA 2BHYA 3TR5A 5KG0A 3LSTA 4ED0A 1LW0A 2C3PA 2MGZA 2WOMA 2BJDA 1D9FA 3K17A 5EF6A 1LWXA 2C1EB 3RKQA 2BY0A 2OBPA 3BG5A 2ZKZA 4M3GA 1OCRH 2YNHB 3CCUS 2ATLA 1SJFA 4O0IA 4KKOA 3Q83A 1LFWA 2CUJA 2XPUA 1QDUB 3KXDA