2L9NA

Structure of the human shwachman-bodian-diamond syndrome (sbds) protein
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
250
structure length
250
Chain Sequence
MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome maturation protein SBDS
publication title Uncoupling of GTP hydrolysis from eIF6 release on the ribosome causes Shwachman-Diamond syndrome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 44
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2011-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01172 SBDS Shwachman-Bodian-Diamond syndrome (SBDS) protein
A PF09377 SBDS_C SBDS protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.900 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l9nA02
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2l9nA03
3.30.1250.10 Alpha Beta 2-Layer Sandwich Hypothetical 12.0 Kda Protein In Nam8-gar1 Intergenic Region; Chain: A; Ribosome maturation protein SBDS, N-terminal domain 2l9nA01
3B78A 2J7KA 3E3XA 4QR0A 2KDOA 2XEXA 3B82A 4MYTA 4TNOA 2I0XA 2E1RA 1N0VC 4QR2A 1ELOA 2I8EA 4ES3A 4QR1A 1P9QC 1DARA 3ZZUA 3ZZTA 1N0UA 1ZM3A 1ZPWX 2CVEA 1T95A 2IVYA 3UI3A 3ZZ0A 1KTVA 4FN5A 3B8HA 2EFGA 3LH2S 4ES2A 2ZITA 4MAKA 4ES1A 5G4DA 4ZCLA 1ZM4A 3OQ2A 2WBMA 4MYUA 2BM1A 4ZCIA 1ZM2A 2BM0A 1ZM9A 3EXCX 1FNMA 2BV3A 1U2RA 4M1KA 2L9NA 4ZCKA 4ZCMA 1NYNA 1VI7A 2NPFA
chains in the Genus database with same CATH superfamily
3HOUJ 2YNFA 1X1AA 3IL2A 1OIAA 5LJ3Y 1HHSA 2CO5A 3OYEA 1WRJA 4DHVA 1LUJB 2V8HA 4Q45A 2CJYB 1SD5A 2Y0SN 4GKKJ 3IG1B 1Q7YT 1LXNA 3A0HC 4M9SA 1YFHA 2DFEA 2E7VA 4NQWA 4IXAA 4WXCA 4O4RA 3QYFA 4E7KA 1S1VB 2ATLA 4A8SA 3A13A 5KFLA 2IRXA 4DMZA 5F9NA 2B9EA 1ZM4A 4OWRB 2XMJA 1V5GA 2YWEA 1GTHA 3DLGA 3MKZA 3C14B 2OPRA 3VQSA 3EGWB 3DU6A 1CVJA 2XO6A 2XCAA 2M87A 1J2XA 2YNHA 3G6VA 2DCUB 5D4RA 2VT2A 1VQ5I 2WOMB 2A69F 1KONA 3QOEA 2LP4A 4CO4A 4GMKA 3W61A 4GRSA 1IG7A 2UUWA 2CPEA 1N4LA 1YJWI 3OXGA 3DLLQ 3EPZA 3CJQB 2YNIA 1WF0A 4EK2A 1W25A 1KSPA 5AXNA 2OPSB 2EZKA 4ZVSB 5IT3A 3LP2B 1XTZA 5E1XA 2FQ3A 2AXLA 4M73A 1VHIA 4MGRA 1S6PA 5CA5A 5GAEU 4IOAQ 4FZVA 1JTYA 4UVBA 1I94F 5DS7A 3TGNA 1WSVA 1ZYQA 3HI9A 1IKXA 2NNYA 2OIHA 4I09A 1J5EJ 1JLBB 5A76A 3SEZA 1WJAA 4FHTA 1MWQA 3MR5A 1WFXA 2MZSA 2L7MP 4A3JJ 5LHGA 1ROFA 2DNMA 3HOVJ 3PNIA 3DLHA 4JI6J 2GIFA 5B5EC 2YH1A 1BE4A 1JLBA 4GYGA 4MEXF 4USMA 1FRHA 2ID6A 3HUGA 1MWYA 3F73A 4HOBA 2QC3A 1UELB 3H1CA 3MEDB 4OHXA 4CLPA 1J5YA 4C0BA 4WK3A 3THTA 3KFWX 1H0HB 1MBEA 1MNDA 3F6OA 4LMZA 3JSMB 3TUJC 1JLQA 3HTSB 2VPLA 4WZQA 1VYAA 3B6AA 3MM9A 2VKZG 2OSRA 1N36J 5E33A 1DARA 5KT4A 3CDAA 4YEJA 1RWMB 3C16A 1LKXA 1GXLA 2F4MB 4EU0A 1AFJA 3QP5A 4LBPA 2BR0A 4UV9A 1UW9A 4CQ1A 5KOWA 1IBLF 1B72A 2OEJA 4A3CJ 3A02A 3TW6A 5A0YA 2V79A 1RLCL 2HFNA 4ZLNA 2IRYA 1YKWA 2BY3A 2LDIA 3CJ4A 2K8GA 2MYSA 1MDMA 2HZCA 3RTVA 3TDUC 3RW6A 3IV5A 3KHHA 5ETLA 3K1NA 1RAFB 4HF2A 3H7HB 2GHVC 5I3UB 3NGUA 5C4JJ 3FEZA 5CVVA 3PX0A 5IQ6A 4KGZB 1CQTA 5F41A 1W7PB 1ZZFA 4DL2A 1ZAOA 1NK4A 2WSEC 4IRDA 4OIOF 4X4OA 2RMLA 3OW2R 2ZM6F 2M2EA 2YVSA 4GC6A 1JNRB 3OUYA 3J7AN 1CC8A 4CI0B 2MQLA 4G1QB 3TOQA 3JSOA 3N01A 3QFWA 2HOTA 1VNDA 3BYRA 5J2NB 1E6VA 1O7LA 3FSIA 1XMXA 3PJRA 3M30B 4OHYA 1T56A 4AE5A 2RNGA 2ZXHA 5CJ9A 3R5JB 1Y0NA 5DYMA 1N32J 5J4YA 3HOYJ 1FF2A 1OCOH 1NZ8A 4F4AA 4A12A 1JQGA 3QMQA 2QWWA 5K7ZA 3M30A 1RUOA 4HT5A 3FSYA 1VDHA 3HZEA 4C6AA 4ECWA 3KHRA 3SXYA 3RDIA 2LY2A 2R92J 4I1TA 4HLXA 4FQGA 3ULQB 2VU5A 1D8JA 5HLFB 3SHFA 3TANA 5TISC 2J9DE 4K4ZA 2VJIA 4YB6A 4GVBA 2VH7A 3DRSA 3HRSA 2EB7A 4LREA 5CABA 1PKUA 2DNHA 1X4AA 2Q43A 4YFKF 4GGGA 2M7SA 1QVGR 2CPXA 1A35A 1T9UA 4F2RA 4QSHA 3PYEA 1SH3A 5FDLA 3D3CJ 2WVBA 3PFEA 4NPOA 3WTXC 2Q8KA 4KIBA 5A2QY 5DEQA 2QQ9A 3QT7A 2WBRA 1WHWA 4KO0B 3L1PA 1GHCA 4DUZF 4LLGF 1G3YA 5C42A 1UMJA 3J80Y 4MK8A 2EFVA 4R8UB 4A93J 1JT6A 4DS5A 2MLYA 2V4RA 1RZ4A 3UD4P 5E79C 4P9FA 1UVJA 4D7NA 3EPGA 1NAQA 4RW8A 1QAIA 4EBEA 1GXPA 2CW7A 3PRVA 2ZJRF 2R7XA 3O44A 2V0NA 1YK9A 4O44A 3DRYA 2V9PA 3RR8A 5HAOA 4IHXA 3EVWA 1IRFA 5JHUA 5HNHA 4H4MB 4NXNF 3M2UB 2RE1A 5HLGA 1PYTA 3DQVC 3BR2A 3MEGB 4IFYB 3TZZA 1N34J 2KIQA 3NQOA 3TJ9A 2HFZA 2IRFG 4DG1B 2R7UA 2KDOA 4PQUA 3GLLA 1S5ZA 1PP7U 3HTUA 3R6SA 4NA1A 2KIUA 4A8OA 3HVWA 1CULB 1E2XA 2FLLA 1MROB 2IC3A 2ZZTA 1TTYA 2JPBA 4FETA 1HBNA 2BE5F 3SCKE 3JR9A 2JA6J 3PIPQ 3IS9B 3H5YA 2LK2A 1KA8A 2QE5A 1ZR4A 3RU0A 1FJEB 2YUSA 4M5DA 2V4JC 5FB2A 3D1HA 4AXIA 3I31A 2J0QD 1YTYA 4KGVB 4O3PA 2M5WA 4OIXA 3MECB 2K27A 2DR8A 4OYMA 1G4DA 4ON0A 3OY9A 4CCNA 5B0GA 5MAOA 2CUJA 4HLYA 1FXDA 1R6VA 4LLLA 1XIQA 1RAOA 1QZZA 1NPRA 3QIDA 5BXIA 4ED7A 3H5AA 3FK6A 2A1BA 3CDBA 3HSZA 2F5CA 4AYBN 3LWFA 3F8NA 2DNKA 4B08A 1NH7A 2ZC3A 2YNGB 3H0DA 2HAFA 4L9NA 3BEGB 2FPHX 3GIKA 2YX4A 5LMUF 3SBMA 4I7HA 1GXUA 1OYYA 4FXVA 3S3MA 3EJMA 2F7VA 1L3SA 3PIOQ 4PR6A 3UDLA 1SANA 1APSA 3AJ2A 1RUSA 2PEBA 2I5UA 3QQCD 2V5HG 3BM7A 1UWBB 3U1NA 2P0WA 3DEWA 3AB2B 3IKTA 4DQSA 4JOMA 2UXBJ 3RPUA 3AD9C 4XLEA 2W24A 3AL0B 1UWBA 2G2ZA 7AT1B 4I69A 3Q8QB 2NQPA 2BABA 3R5CA 2NUUG 2ALZA 5J47A 1F5TA 3EICA 2VQCA 4DV4J 4Q0BB 5HQLA 5E1ZB 2M70A 3LPEA 4DBQA 2AJQA 4YDDB 2CW8A 4M1KA 4CLTA 2DT5A 2ZUAA 3JREA 3DM2B 1HPZA 4IG0A 5HS9A 3OSPA 4EWTA 4YR0A 4Q8FA 4OIQF 1QVFR 5C44J 4C8MA 3BKFA 3ISPA 2KRBA 1RCOB 2XF5A 2DPDA 1MKMA 2R7DA 3HX9A 1AFIA 3H98A 1DTTA 3W2VA 2I8DA 1NG7A 4KNYA 3WTYC 3KOAA 3QRFF 3TMOA 4L72B 2C2EA 3D4JA 3CULA 3H9QA 1P8GA 1NDCA 1HSJA 4ELUA 3GCXP 1PBAA 3B54A 3D0SA 4HACA 3H3UA 2ILYA 2PBIA 2ZKTA 9RUBA 4TU9A 3EDRB 5ETKA 3BTJA 3V81B 4P96A 4IKAA 1P6TA 4Q47A 3OYJA 1VJQA 1PGZA 3H5NA 4ANEA 5BPIA 4Z7YA 4KUMA 1LFUP 3KUEA 4NLWA 2B0GA 1SIWB 3CMMA 1PAEX 1FBQA 4IQMA 3MZIA 4BBRJ 2DBBA 2FJEB 4DV5F 3M1EA 4USKA 4DSFA 2R42A 1X58A 1Q95G 1HW9A 2RJZA 4C11A 5IOYA 3SQOP 1QD1A 4BQOA 3MMYB 2HXOA 1S7IA 1XG1A 2VJJA 1ZG3A 3BCAA 1NB2A 2XMMA 1AXQA 2HS5A 1C2PA 3ZQ7A 1PYSB 2I1RA 3LAPA 3B82A 1LWCB 3WODF 4DSJA 1NDLA 2E19A 3JQMA 2GMJA 2F4VJ 5DS9A 1EKEA 1TKTB 3SSSA 3PX6A 3MI7X 3PO2J 1N75A 4NLYA 2EIKH 5A6PA 2FB0A 5J8CA 3PKYA 3NG8A 2OCEA 5CD4A 3DDKA 1Y1WJ 1Z4UA 3KCCA 4OL8A 1QM9A 3HOSA 3SQGB 3GLJA 4CT9A 1P4WA 5IT9U 1U0HB 1FMWA 4RGSA 1M0SA 2ECBA 1WI3A 4ECUA 1OPIA 3MWMA 3LSTA 4X66J 5HL7Q 5KCMA 4B3MF 2F40A 3NGRA 2GAGC 1U26A 1LWEB 3VALA 3J7A1 5A8RA 1P4AA 2CKWA 3DMJB 2XWYA 3PVXA 2SXLA 2HVEA 4HH1A 2EFNA 3M8ZA 4X4PA 2CAJA 4JK1X 2HQCA 2XF7A 4M9ZA 4IG3A 4ZS6A 4WFBQ 1LWEA 1WC1A 1T0FA 2E34A 3DPLC 1BIAA 4PFPA 1F5BA 3DKYA 3IHUA 3F3XA 2VG5B 2DHXA 1FY7A 2KRHA 2GVZA 4MYTA 5CYMA 4EVIA 4KFBB 4LSLB 4PFOA 5H6QA 5CXTA 3MMBA 2W9AA 5J1RA 1H0MA 4XLCA 2KFYA 3OTOF 2MGZB 1WWHA 2KT5A 1YOVB 4KGXB 3M2RB 2ETHA 1S0OA 2DT9A 2MSYA 5GAHJ 2HNYA 1TBXA 3H5UA 3TZXA 3SDBA 2JVHA 5EGYA 4WFYA 4JI1F 3CNQP 2BA9A 3M6UA 1SXLA 4G6TB 1SH0A 3CJKB 4LQ3A 1W2IA 1P7JA 3COAC 2MKHA 1VOMA 4DQ2A 1V5IB 5GMEA 5EEHA 2BQUA 1QBJA 4K0KJ 3VF0B 4F36A 3ESWB 2GMHA 3GZ5A 1KU3A 5KFKA 1H9TA 1JGGA 1S59A 2E60A 1QGPA 4NEYA 1YRXA 4ZMMA 1QSYA 4U9RA 3W5XA 3KG1A 4CYUA 4UQGA 2QLWA 2OGUA 1UL3A 2E2JJ 5J1PA 2O3FA 2FZKB 1U4BA 3KMQA 3DXJF 3V7RA 1TVRA 1TC3C 5JJBA 4AFFA 2BHZA 1I94J 5KT2A 4Y4RA 1SV5A 3KDOA 2PI0A 3SMZA 4HYKA 3RI4A 4AUXA 3LA3A 3TO6A 4NCGA 3GFHA 5HROA 1U5TC 2KM8B 3R7BB 1RHKB 4KJZA 1OQ6A 4F92B 5ADZA 4ZYDA 3KG4A 3A8JA 1WH5A 1HOMA 3CGIA 3MCSA 1YVFA 2UV1A 3KE2A 4B3SF 1ZYRF 3G3ZA 2CQ3A 5E3RA 1PIEA 1QAYA 3GYXB 2V9VA 3CMYA 6FDRA 2RGVA 3C2BA 3GTYX 4EJOA 3MD2A 4XN0A 2EBGA 2GJIA 2W01A 2X1EA 4FP9A 5KG7A 4QWQA 2P5VA 2XYGB 2R0QC 3PW2A 1JWWA 1R9TJ 3BREA 2ERRA 3OTBA 2K3KA 2W2OP 3U7JA 2JK3A 2P6SA 4ENNA 3MR7A 4DW6A 1RZMA 1JLEB 4EEYA 2ZOGA 3QGIA 1NNDA 2ZZNA 3ZZTA 2A5YB 5CH7B 2UU9F 4AD6A 2XMAA 2CQKA 2VKEA 3ILLA 4F26A 1TELA 4AUKA 2OHDA 4DL3A 4HI2A 1JLEA 4CO8A 1FYMA 2GGPB 2NZ4A 3OV7A 2NYIA 3FMRA 1IBLJ 4O6JA 1PJ6A 4ZJOA 2VL8A 4LIRA 4JBCA 4N8NA 4DQPA 3HEFA 1YG0A 3WZ0A 2E44A 1WOPA 1MSEC 3HHHA 1U8RA 2H8WA 4B09A 2VFTA 1Q86T 2KKHA 3HJVA 3MEEA 5LXYA 4ECZA 1BQNA 4FS1A 3H2VE 4OYIA 1YJVA 1C1CB 3BKUA 3A0BC 1G2HA 1I27A 2LXIA 2LKZA 1JTXA 4KHRA 4CXFA 3N5FA 1WWXA 2M0GB 3PDNA 4W92B 3J7AY 5AE3A 3THVA 2CQ7A 2ZM6J 2ZMEB 3VGTA 2ZH1A 4A3BJ 4B1RA 4PYAA 2I6WA 5JI6A 1MJ9A 2G0EA 3RB3A 2DR5A 3S2HJ 2XY5A 2RKHA 4ED5A 5CVUA 1OQYA 3A8IA 2ZJPQ 4DF4A 2D9PA 1WZ2A 2VHGA 4DFJA 2E1NA 2WADA 1T94A 1DAXA 1U2RA 2PGCA 2V9WA 2HHHF 4HEA9 2W00A 2RRBA 4ZHRB 4ELVA 1HWIA 3AFGA 3VGSA 5KFUA 1TUGB 3OIQA 2GX8A 3H5XA 2H5JB 3RBZA 4XONA 1BR1A 3K1PA 4DV3F 1J09A 4DL4A 1DQ9A 1QRYA 4EI2A 1U1OA 1VQ4S 4M3EA 3TVZA 4A8KA 4KSEB 2JEJA 4ZVTB 2WVDA 1O3SA 2EK1A 2XNRA 1PILA 3C3LA 2EBEA 3CDLA 1VFCA 3RAQA 3B73A 2DI3A 2J7WA 4EJVA 3E5QA 5DDRC 2JUGA 5HLTA 5D4NA 5FJ8J 2KZZA 2WAQA 2EK6A 5D0EA 4C3LA 4BUPA 3KK3A 2NS7A 1DQAA 3SZTA 1EB0A 2F5VA 2IPQX 3F23A 3SDEA 4NB5A 4QW8A 3MR6A 1HW1A 1RWUA 2W8LA 3ZTSA 3GIJA 2D45A 1X5SA 2UXDF 3M8FA 3A01B 4L73A 2ELHA 4QBUA 4DUZJ 4DQIA 4G1IA 2HBRB 3BZCA 4F91B 3MMCB 4EGLA 1VQYA 2H27A 2ESHA 1F9NA 3N0VA 4MH8A 4QWDA 4X65F 4J9OA 3OR1C 3FQLA 2P81A 4JP8A 4PWWA 2HQ3A 5FJ4A 5GP9A 3PR5B 3MUTP 5IT9K 4FVCA 2VIHA 3S2DJ 3QO9B 2DITA 3ZZUA 3OYDA 2ZHOA 1JXLA 2YKNB 3R7NB 1SUQB 3T1AA 2EW9A 4NXNJ 3MD1A 4M3DA 1LB2A 5A2QZ 4OHZA 2H48B 1S9EB 2M4KA 2RQQA 3RRKA 4ZK7M 3R0AA 3J80Z 2IP2A 1OS5A 2KHDA 4I6ZA 1TZLA 1VQMS 2NR0A 4B3OB 1BN5A 2FC9A 2GAHC 1XGNA 1S9EA 2ACYA 4PXDA 1IKYA 4HDUA 4NNJA 2RHSB 1REVB 2W9BB 3W3CA 4LVNP 5B08A 4DSKA 1FRLA 3H8YA 2L9WA 2AEJA 5FLMJ 1R49A 2CNNB 3T9NA 2N8GA 2YPZA 4J9PA 1J9IA 3W63A 3NLCA 3FX3A 4M8LA 4I01A 2V7FA 2J5AA 3FISA 2FHJD 2V34A 4NMXA 2YU9J 4K5SA 3CLQA 3TO8A 5C5JA 4LF8F 4MHGA 2A6MA 4YB5A 3I0SB 3JTHA 3BG5A 3O3KA 2E35A 1QA6A 1EJ7L 4TY8A 4A3GJ 3BJ6A 3T19A 4ZVUB 5LHHA 5LSRA 2FEZA 3M7VA 4X4UA 5M5WJ 2ZB9A 3BKTA 4A0YA 4Y2KA 2CZ9A 3BY6A 2IBKA 3AJ1A 5LMUJ 2G13A 2XYPB 3FBEA 2OA4A 1UB9A 4X4TA 4DV1F 2I5JA 1S99A 1KQ9A 2OD6A 3UE2A 4HR2A 4FF3A 3IR6B 2NPIA 4IO9Q 2K02A 4ES2A 4B02A 2BW2A 3OTCA 2DMPA 1K1SA 4BL0B 4LQ9A 1HWJA 1TNTA 3OIOA 4I99C 5ILUA 4UT4A 1UFWA 4XLPF 4Z2YA 2CDQA 3KNAA 1K4SA 1RT2B 4MQ9F 5H20A 5DM7F 3IKVA 2FJ1A 2QEXS 3NEUA 1SFUA 3M8YA 1S7EA 2VB6A 1NBEB 3ZZYA 4M5GA 3PL8A 1HKQA 1FKAF 4M5MA 2GOMA 5FKMA 3QIPB 5E7OB 3F0NA 3ZZZA 4RWXA 3RCOA 3GU0A 3FMBA 3X3UA 4DV6F 2JHEA 4OYPA 4R0EA 2G4BA 3GBGA 1F2GA 3G6YA 4G6VB 4DS4A 2K2PA 3V4MA 3L2RA 2OUGA 4J01A 4PUOA 4NXMF 3F22A 4J9UE 4WFAQ 1U6GA 3MZYA 4YY3F 5C3EJ 2W2PP 1K78A 3BG6A 5TJJA 2Y0MA 1Q1HA 4OYAA 1RT4A 1XGOA 2MLZA 3HOWJ 5D0RA 1R58A 2GW8A 4TVAB 4CP5A 2M30A 5CVIA 4U8YA 2YH0A 3GIIA 5B0EA 3CDEA 1ETWA 2ZXIA 3VPRA 2HVZA 5GAGJ 4QWEA 4FCYA 3P8BB 4F25A 3TUZC 1OKRA 1VQ4I 4ZIWA 4PWDB 2HS4A 4OOIA 5KFRA 3HJFA 2PQ8A 4LF6F 3CJ0A 1RBLA 3KK1A 2RU3A 2RNEA 2LREA 4U0YA 1HDDC 4RNHA 1B4AA 3WX4A 1U49A 3ABTA 4XL9A 5C2CA 1E3HA 1SQGA 2RUGA 4RAGA 2D3O1 5HS8A 4DV5J 5KG5A 2Y1RI 2RD5C 1QVUA 1OMIA 3NMRA 2X48A 1KOOA 4YB1P 2ZOFA 2A6TA 5FRMA 1YQHA 1MZBA 4ANJA 1JK9B 1BGXT 3SSRA 2HDWA 3T5LA 3HFVA 4H4KA 4OQJA 2KXNB 5HATA 4BHCA 2V68A 3H4BA 3I53A 3DRRB 4NI2A 4UUXA 1U8BA 3GIRA 4AVPA 5ETSA 1IN6A 4QCLA 5JLWA 4F4WA 4BGDA 5K5MA 3ZZ0A 2IY5B 3F0CA 3JSBA 3OVBA 2JN6A 2WHOA 2P8TA 3M6XA 3D9BA 3F8FA 3LSRA 2J6SA 1TAUA 1IN4A 3ZTRA 2VIXA 4AWXB 1HBMA 5K5OA 2MMYA 4UZBA 3NCQA 3OXLA 1JLGB 1HQEA 4ENJA 5KG2A 2MC3A 2FVSA 2WAFA 4EQQA 2W2MP 4XLHA 2ACJA 3W64A 1YJRA 2VE9A 1UHWA 2CMPA 3MQ0A 3VYSB 5A8KB 4B3MJ 3CJ3A 2M7BA 1RB0A 2JX2A 4P55A 3LSJA 3WC2A 2DDBA 5M5YJ 3GZ6A 4MKBA 4XO0A 4F93B 2PA3A 3CO7C 4HF1A 2DRBA 5DV5A 4FNHA 1TV6B 4CO1A 3GMGA 2XGXA 2LF7A 5L3DA 3UNGC 1I6HJ 2MH9A 2XMVA 1RHMB 3GCWP 4K2XA 3BTIA 5K1YA 1LFWA 2OD5A 1T05A 3S93A 5D3GB 2H3EB 4NLPA 1TNSA 5GADI 2OAUA 3BBBA 2WWYA 3CJ5A 1KR4A 3OTOJ 4D9JA 1RT3A 4ZYGA 4KH1B 1TAQA 2STWA 3ABLH 5HP1A 4F8RA 4M71A 3P5JA 2DEJA 3CVKA 3MUVP 4JI1J 2QQAA 4QIGA 2J6UA 1V54H 1RUNA 3LQVA 1RLDA 2AMCB 2D41A 2FZGB 5EHHA 3BTLA 4Y2MA 1S9GB 4ICLB 2JVGA 1YIJI 4I2QB 2KJCA 4BE0A 3V6KA 2WBMA 5AJ3F 5B0DA 3TWZA 3DLLF 4KB7A 2MYFA 1P6RA 5IT0A 2W85A 2R5YB 4DR6F 2Q2EA 2WONA 4I02A 1S29A 5J1EB 3LA7A 2QSFX 1EARA 2XGPA 4BWMA 4FASD 3I9V9 1FEHA 2XV4S 2AYMA 4O3RA 2QEXI 4C0OC 3LPYA 3TVYA 3KJVB 1UFMA 1OCCH 3BR0A 1Q8LA 4OAYA 3N4WA 4ZPCA 4IOAF 4ED1A 2W7PA 4QU7A 1H98A 3C2HA 1IR2A 2JC0A 1W2BR 4JV5F 5ETOA 2Y8YA 4HI1A 3MPVA 4OV6A 4ER8A 2ZWOA 4R79A 4AXJA 3KJNB 3H0PA 3ZMDA 1KBRA 5HN0A 1HHTP 2QUFA 2M4MA 3FRYA 4B3SJ 1IJWC 3FMWA 1HI0P 2BZTA 2V63A 4ZP8A 3EYYA 1FKPA 3VAFA 4FTHA 2BE2B 3R5DA 1IUFA 3KLGB 2GIQA 4IFVB 3BGFA 1B59A 1FTCA 5F8MA 1M1HA 1S4EA 3UNYA 5JVGQ 3ZQIA 2RN7A 1V55H 1LXJA 4D3HA 4XSZF 2E71A 3DLKA 2AHOB 3ISZA 3D5MA 3ADAC 2VBXA 1Q8IA 3L95X 4I98B 3AA9A 4ED4A 4ECVA 3FBCA 2UU9J 3RZDJ 1XSVA 1T3NA 1TL7A 4JI2F 3R2DJ 2KL4A 4J9QA 2M1BA 1VGYA 2HBZB 1T8EA 2V69A 4B9LA 3GTPJ 2F65A 2HQDA 3CMAS 4ENOA 4N0BA 1C1BB 1G59A 1IBKF 4BY7J 2BJ9A 4BC7A 3G1OA 3R7SB 5HBMA 2LQ5A 3ROUA 4LG0A 2GM4A 4JI7F 2H54B 1JHFA 3NEKA 2DNPA 5D6EA 3NWRA 1Q7LB 3OSFA 1HQUB 4WK1A 1D0YA 1V9OA 3L9FA 1RKIA 1SJFA 3MVPA 3TQNA 5H9EJ 5T7LA 3GMEA 2BKNA 1ULRA 1LWFB 5DGBA 4E8UA 4LVOP 2D7SA 3B6CA 3K2AA 4ZJZA 1IDYA 4PG7A 3R1LA 4CCHA 2AS5F 1OR7C 3OS0A 1RTJA 2IBDA 4YELA 3L2CA 1RT1B 1RWPB 2ZEJA 2WB1N 3C15B 3KLEB 4XAKA 2K3PA 3CXCR 3FM5A 1YRNB 3J80U 2V94A 4I2PB 4DL7A 1TL4A 3QOPA 1RWOB 3N6MA 3C66A 4M5KA 3O2PE 1X4HA 2VOOA 1YX2A 4M5IA 1VC0A 2V1XA 1K6YA 4ZTFA 2HHHJ 4N9IA 1TW2A 1J0RA 2KYXA 1BC8C 3DOLB 1HA1A 3CO0P 4B9SA 2IEKA 3DWLE 3OOUA 2YWGA 1T9XA 3VVTA 4DPUA 1NJIT 4DV3J 4M6YA 4KGMA 3MOJB 3JAMZ 2PI5A 2IJRA 5K14B 4TLRA 3AG3H 3HDDA 2W4DA 3O1LA 4E6KG 4ID5B 3RTRA 4FE4A 2IGMA 2BXYA 2MKKA 2EZLA 1TL3A 1U6BA 1E3PA 3CJRB 4RAFA 2A3SA 2XSDC 2G9OA 4RW9B 4P1WA 2A0FB 1OFCX 2ZOMA 1X2NA 5CVRA 1BI3A 2DLLA 2YWWA 4KY3A 2IYGA 4DR5F 4JI0J 5LSOA 3DKXA 2QSGX 3NKYA 2E7WA 2HYJA 4E98A 1QE1B 3I9ZA 2NRAC 3QWUA 4BE1A 3NOCA 1FYKA 2OTLS 2DMTA 1VRUB 3BDPA 3HVTA 4GFBA 4XQFA 5EJCA 3HRUA 3BPXA 4OZ5A 1TWCJ 3EVOA 3ENAA 2CWKA 2AWZA 3SZPA 2WVFA 7FD1A 1I5ZA 1RHUB 1SL0A 2MKSA 3L9ZA 5K9FA 5HJYA 2QLZA 2ZHBA 4LIUA 1ZPVA 2RREA 4X65J 2DHHA 2CPFA 1R00A 1D8ZA 3W2WB 2G1DA 4XLFA 2BANA 2MPUA 1Y5NB 1TKXA 3CJTB 3PM1A 4D7MA 3LMMA 1WF1A 2D9OA 2RDDA 4YHHF 1I1GA 1FXLA 4FYVB 3PKMA 3TYTA 4E7JA 4PPDA 1X5TA 3ZZRA 4FDFA 3KHLA 3O8GA 3E01B 1F6TA 9ANTA 3M4XA 2GBYA 2HRYA 2DA6A 2HGMA 3CJTA 4NLOA 3WBZA 2AZ1A 2NXNB 3GV7B 4NDLA 4HL9A 4CTAA 3TAPA 5DQGA 4CCLA 1B0TA 4DSIA 4ANDA 2RAEA 4RU9A 1FRXA 4B44A 2YKOA 1FNMA 3CDUA 4WE1B 4I7FB 2K1RA 1BOBA 5I42A 2O7OA 2QF7A 2WVCA 2EA4A 4OLOA 3AKZA 2Y75A 3LP1A 3OFFA 1N56A 1Q79A 3OR2A 4XTTA 3MAJA 4A6EA 3MMJA 3V8KA 2W7OA 3UVJB 3GV8B 2V4JA 3QU6A 4LF8J 5L8RC 1R89A 1K73T 4QR0A 1R5GA 3DLAA 2X7IA 1KVJA 4FYXB 3KLVA 1BW6A 3O6BB 2A6OA 2OZ6A 4IF4A 1XR6A 4ID8A 1BMQB 1G3OA 5BMZA 5DD8A 3FXLA 1S48A 4P7TA 2VUMJ 3GJRB 4WXWA 2OBPA 1M1EB 5EG0B 2ZH3A 3PIOF 4BQQA 1S1WA 1ZRFA 3CMAI 5GTIC 1O57A 3PEJA 1NM2A 3MHYA 2DYAA 4DPXA 2DEIA 1DTQB 3J81Y 2E29A 3N6LA 1LK5A 2ZH7A 3H20A 4ECQA 4R5PA 4DCOB 3VSLA 2ZJ2A 1HNZF 3W9HA 4XRSG 3R97A 2BBEA 1VQ7S 2HVRA 3M9OB 4ENKA 2IJFA 3QSYB 2CQ0A 2R8KA 5KOXA 5HDNA 2EJRA 2IMOA 1K9MT 4W1UA 2KYZA 1D1UA 4RLFA 3QQAA 4JV0A 4P6QA 1HWKA 5J2MA 1SC3B 4C30A 1FK9A 1N5VA 3E8OA 3ELHA 2HOAA 2OTJS 5IV4A 2XBPA 2Y1IA 4I56A 1P2FA 5DZ7A 4QR1A 2OEMA 5F0UA 2QV6A 2CNOB 3FCVA 3ICLA 2D1HA 4A47A 2VQFJ 4C2UA 4RJVA 4NXMJ 1OYIA 4AL5A 4A3IJ 2QCOA 3PJ9A 3E6BA 2LKXA 1SAXA 4NEZA 3KLIA 3DTEA 3HHLC 2ZJRQ 1ZTTA 1FLIA 4P2SA 2RS2A 1LDDA 2KG1A 2RQKA 4EGYA 1LOUA 3BLYA 2P5LC 1JE8A 1IW7F 1FD8A 4B43A 1X19A 3NRBA 2R8JA 5LLQA 3W9IA 2E5HA 3MM5B 3EUHC 4DL5A 1DBDA 1T08B 4USHA 4DJBA 1I1SA 4AIDA 2LU1A 1XN7A 1I50J 1FOYA 1HWUA 1Q81T 3LSPA 3RYRA 1ZM3A 1X1CA 4XRSA 1P1LA 4RAYA 4URQU 4DX8H 4LF6J 4WU3A 1M5VC 2EV6A 1WOSA 5LXRA 2ZXJA 8ATCB 3K1MA 2ZZMA 1K83J 2BX6A 2AJ4A 1EETB 2FJXA 4XDCA 4O3SA 1LJ9A 5E3NA 4DX6A 5BYRA 4CHUA 4JQFA 1JXEA 3ITHB 2QT7A 3LNQA 4UXNA 3VODA 4KYWA 2VA3A 3HKZD 3HM5A 3BQ2A 3FZ2A 4ELTA 1LEAA 2M5YA 2CUZA 4Y7NJ 1EF4A 5GPCA 4DSLA 4LJMA 3MR2A 1NTCA 2YKMB 2TDXA 2X1AA 2AJ1A 3R27A 3JYTB 3E6DA 5K20B 4HAMA 1VC5A 5LRRA 1JXSA 2QYGA 1LV5A 1YI2S 4HX7A 2WY7Q 1UHMA 4PK4A 1YJUA 3RPQA 3TDZC 1S9FA 2GVDA 2YKMA 2KQRA 1X9MA 2HBYB 3R3TA 4NE9C 1JKRC 2B51A 1K7AA 1HR0F 3H3ZA 3GTOJ 4ESBA 3IAM9 4U7UD 1JUMA 5E1WA 4PEOA 4LR9A 2O61A 2R7QA 3UPFA 2FOWA 3K5LA 1B4SA 2DIUA 1SMTA 3MM7A 3I87A 1VBZA 4ZCLA 1CF7A 3H5SA 3ML6A 3MM6B 1Z21A 3H40A 2WRMA 1JMTA 3VWBA 1TWHJ 3G6ES 2NS8A 3CJSA 4CA0A 3JTOA 3ET6A 1ACIA 3FXMA 2U2FA 5FGMA 2K40A 1APLC 2HQFA 3T0YA 3VCDA 1TZ0A 4G1PA 1TK8A 4FX0A 2BM0A 2MXYA 1R27B 4ZDPA 3KYLA 2W25A 3K7RA 2DJWA 1OCRH 4KT0C 4DV7J 3M2VA 4WXOA 3M32B 3ZC4A 1SJ3P 1IV8A 2Y8WA 4KRWA 1WF2A 3VV2B 5HVHA 3ZXSA 1YDLA 3OTEA 3C2GA 3CCJI 2G9WA 3MOZA 2B5JB 5A8WA 1MSFC 2GXGA 1ZRCA 4ETXA 2WTFA 2XAFA 3S7RA 3C6TB 4B3TF 2V8GA 4FX4A 2QYCA 4FYWB 3VZIA 2HFUA 1ZELA 3DDIA 3IRXA 5EF6A 1URNA 3TQ1A 2RIJA 2KIFA 2RRAA 3U1KA 5DCFA 1RGVA 1JJCB 1LFBA 2ME0A 3UDVA 2ZH2A 2QA4S 2EG1A 5AJ3J 4PJ0C 2D69A 3KJQB 4B3AA 2XROA 3MPDA 2DGTA 2YY3A 3ZTQA 1KTQA 3Q3SA 1HKTA 1XWLA 2BACA 5C25B 5HO4A 4DR6J 2PG4A 3NBPA 1R7IA 2XLKA 3BZ6A 3K9TA 1VQ7I 2CU7A 2CFOA 4K5RA 3NAIA 2LMDA 3TJAA 1EH7A 2C6YA 5HODA 4Y2AA 5DQIA 2IS6A 1FVQA 2LVSA 5E8IA 1Y1VJ 3FEXB 4DR3F 3NWTA 4JV5J 1NEEA 4IDKB 2RU9A 2B4VA 4QPQA 1MIJA 3L4BC 2OTJI 1DHMA 1FKOA 4NLRA 4PWUA 1BI2A 3S16J 3KP5A 1FT9A 4C97A 2FJVA 1CS4B 2DNOA 3GV5B 1SI9A 2JA8J 2B7BB 3GIMA 2VC1A 4BJTA 2ZBKA 3CEDA 3VAHA 3PX4A 2C2NA 1U5TA 4BXFA 2QRRA 3GO5A 4RLQA 2UUCF 4MO7A 3NGTA 5BYQA 1FERA 3JAMU 3HPOA 3NOGA 3Q0AA 3LALA 3GW2A 3QU3A 1YZ6A 4BDPA 3BGOP 5GAHU 3TARA 4LB5A 3KUHA 1FRKA 5E8GA 3VDXA 4RX6A 3C6UB 2CVEA 1D0ZA 2F5GA 2RF2A 3VZHA 4A8WA 2HNZA 1IDZA 3SFUA 3KLFB 3PO5A 2G0JA 3CUNA 4OV1A 2ZC2A 3OSGA 4RL1A 1D1AA 3FBFA 1FJLA 1N52B 3KUGA 2YPYA 1IBKJ 1I39A 1U47A 4NOHA 2HURA 2FD2A 3POTA 2QQ8A 3QAHA 1U1MA 5SUHA 2J5PA 3OXFA 3TX8A 4JI7J 1S3JA 2GCFA 4DI6A 2DTRA 3DNCA 4ES1A 3IH4A 3B02A 3W6KB 1ZQ3P 2RQ4A 5J40A 2FHMA 4UB8C 2ZKZA 4OZNA 5KFTA 1ZG5A 1R5HA 1FWLA 3DOKA 4A3MJ 4LSNA 1BW5A 3OJSA 4YFNF 2VV5A 2DGWA 2HPMA 3EGZA 1JJ6C 1IN7A 2PX9A 2K06A 3RBXA 2O8XA 1YI2I 3HSDA 1VBXA 5M2UA 4MJKA 1LDJA 2F8EX 2XAQA 2KIMA 4A8YA 1WI9A 2AV5A 3QT6A 3KK2B 3G2BA 2HK3A 4G12A 5LM7E 2QMUB 1R22A 2FNAA 1GV5A 2Y0BB 2RUSA 5D4LA 4C3JJ 2AZ3A 4RGUA 1M5HA 1LW2B 1HBOA 3FDYA 2ZJPF 1UTAA 4IHSA 2Z16A 4EMDA 1QTMA 4O4GB 2MKCA 3KEYA 4L75A 3R6LB 3ZNJ1 2HDCA 2CUYA 2VKRA 3G6EI 2R2SA 3DRXA 1FDAA 3J81K 1H7XA 4USIA 4O4GA 3K69A 4DU7A 1RTIB 1YJNS 3TP0A 2R8IA 1BJZA 2A10A 4G65A 4HX8A 2DK8A 4U8VA 2LSOA 1GUUA 1UAAA 3QPTA 2HHSA 2VONA 1TTHB 1RT5A 4IYQA 2GNKA 3OV8A 2FC8A 1HF0A 4ZVFA 3WQPA 1LWXA 4MFEA 1JXVA 3SEOA 3VAJA 4C8OA 4DR5J 2H4YB 4JI4F 1VTNC 5IYDJ 4V19X 3EXYA 4ANCA 4E7LA 3U1LA 1N5QA 3FFIA 4J9RA 4LLNA 4OFZA 2MQNA 3E7LA 3H5RA 1R7JA 3KZIC 3WIVA 1ZH5A 4LBHA 1S12A 3EM1A 5DG9A 4NZ6A 4HQMA 4HT7A 4WKYA 2QA4I 4KN7X 4DZPA 2HZDA 1E6YA 1NPKA 2M8HA 2C42A 2HNDB 4ZPDA 4ASNA 1QNTA 2VDIA 3HFZB 2LYVA 2BOPA 4DL6A 1ZA2B 2OQGA 4XM3A 4KV8B 5DG8A 2OJ3A 4C2MJ 5IOLA 4C8ZA 4YHHJ 1Y6IA 3ZOBA 1ORKA 5ETNA 4RBTA 3OYBA 3NRVA 3RZOJ 4DZ6A 4HSRA 3HGYA 1IR1A 5B09A 5LJ5Y 3OR1A 4OJ1A 3P49B 3C46A 4C3IJ 3WTTC 3CWJA 4LF9F 1ZLKA 4PSWA 5J2PA 3CPWR 5LSLA 3E3VA 1NK3P 1HD1A 5B1BH 1RTHB 4Z6YA 2F4FA 1JLAA 4N7TA 2L9NA 2VQEF 1VI7A 4DF8A 4M3BA 2BXJA 2UP1A 2XY6A 4J5OA 3NWGA 1C0WA 3B6BA 2A18A 5F64A 5BJRA 1FX2A 3HP6A 4I0WA 5C24A 3LQQA 1VQKI 1WACA 2FQQB 3AB4B 3NNAA 3HPGA 2QGFB 4WWSA 4WXDA 3V8LA 5D6GA 2C22A 3O8WA 3D5LA 2UV8G 3ERMA 3FKBA 1XK8A 3BQ1A 3EMTA 4NHJA 1YRTA 2RS8A 4KR0B 2A6EF 2IXSA 3BGRB 2GA7A 4MNUA 3M9MB 4J00A 4OYBA 3OYNA 3BGUA 4LFAF 3HO1A 2C3OA 2ECCA 3MZHA 1UVNA 3HFKA 2XKPA 5DCMA 2JA7J 3I54A 4DCJB 1UA0A 4E0DA 3IAS2 4JX5A 1X4GA 4ZKAA 1W7PD 1MMAA 3BT9A 1JKHA 1KQKA 3O3LA 1NLKL 2K9SA 4PG5A 4WFNQ 3MFKA 4S05A 4ZPBA 3ZZOA 3JTNA 1BIBA 2DA2A 4AQYF 3FHNA 2HGLA 2QBYB 2U1AA 1H6KX 1VS3A 1Y56A 3PRDA 1HNZJ 3NGKA 5BOXA 4CZZA 3GJTB 1QHGA 4F04B 3GSDA 3I55S 1FDDA 2CQPA 4M94A 2NXJA 3BQYA 1IKWA 2L01A 2E1MB 1XCVA 3C1DA 4XK8C 2CVIA 3CCMS 5E20A 1VZ0A 3PUBA 4TNOA 1BA5A 4DV0F 3GFMA 1K4TA 2KMUA 4ZVPB 2FLNA 2XG8A 4KMUX 4CLUA 2KL8A 1SD6A 2JC1A 1Z0XA 2OPQA 2UV8A 2FOKA 1XSDA 5JHFA 3KDNA 1YE9A 1UA1A 3MAAA 1QZYA 2DISA 2DTJA 1W5SA 4FF2A 1J5OB 4OU0A 1VLYA 4DR7F 3NY0A 1X0PA 2CPDA 3ILOA 1R8HA 2GIRA 3SCJE 2DTZA 2CNKB 4PXBA 2CA9A 3DRPA 4XOPA 5M3MJ 3PNTA 1KFDA 3HVAA 1TMMA 1FX7A 3R2CJ 4WXHA 1UEKA 3ZP5A 1JB0C 1E3OC 3ERED 4UW2A 2FX0A 2XSJC 3IH3A 4U0VA 5DM6Q 4QLCU 3ZTPA 2NS1B 3CQZJ 3M3YJ 2WAQN 5FLXY 2PEHA 3FJ2A 3U02A 2HQNA 2CG4A 2EFWA 3I96A 1J75A 3U27A 5KNLA 1MU2A 4OAZA 1HMVA 2NCKL 2DN0A 1TR0A 3VOEA 2MY8A 4PPZA 3H25A 1UZCA 4FYYB 5IFMA 2HZVA 1RI7A 5F8HA 3QYYA 1EP4A 4FBTA 1FZPB 4C3MA 2CJ9A 1FPQA 3FWEA 2YWHA 1JX4A 3RJMB 1RWKB 3KIOA 3WDOA 4U67Q 3TOBA 4UUSA 5GADJ 1KTVA 5F8LA 3ZMZA 2UZKA 1WD6A 2CGPA 5HVFA 3CCRS 4Y0FA 3GR0A 4CCMA 1A36A 2MDAA 4LSZB 5AIQA 3I5CA 3A3PB 2RKIA 4MFDA 1WUUA 2FHKA 3C8YA 2BE7D 3RKXA 3TR5A 1HR0J 3K59A 5JVTA 5EGOB 4RBOA 1NZAA 3NS7B 3KKFA 1Q8KA 2IA6A 2CYYA 1NRKA 3KHGA 3OMYA 3WTWC 4DUYJ 3UD5A 3RGIA 1Q78A 2ZBPA 1S0NA 1ACMB 3TJ8A 5K8MA 5DDOC 1H8AC 1KN6A 4JUZA 5HMXA 4L18B 2H1YA 3PW7A 3P6YC 3NNHA 3QJPA 2GAUA 1RR8C 2VG6B 1AW0A 5GAGU 1HNVB 3QGGA 2K5CA 2ZVIA 3IR5B 3CCVS 1FHTA 4ZOSA 4TV7A 2BUNA 1RNLA 1RKTA 2Y9HA 4DFPA 2CS3A 4ZLLA 3F21A 4DSEA 1PUFB 5CAAA 5H6RA 1JLCA 2DPIA 3TW7A 2LQ8A 1UVLA 4Q43A 3LSGA 1RE1B 3PFYA 2LBFB 1VMBA 2CIMA 4IJAA 1TKZB 3G6XA 1DU0A 2Y48A 3N5BA 5EEGA 4B9MA 3BGLA 1FWKA 4WU2A 1U45A 5EN1A 3FUYA 1NK9A 1RU1A 3U9GA 4BQAA 3M8QA 4RLEA 3T8RA 1D9DA 1Y8RB 2JFDA 3K7AJ 3CD7A 2KTQA 4ZZLA 2L02A 4F3MA 4B3TJ 1TL1B 3RUBL 2IVFB 5ICGA 2LMIA 2Z99A 3OLAA 2UVUA 3CF5Q 3I9V2 3RIRA 2V9KA 4DDFA 4ZPWR 4QPTA 1MMGA 3TKYA 1ZAWA 3K0JA 3IH2A 1CJVB 3LWLA 1IJEB 3HLUA 4LG3A 2XPVA 2DDAA 1ZM9A 1B0PA 3MGJA 3PYDA 3PQKA 2JRTA 3OS2A 1WTFA 3DGPA 3N05A 2CRLA 3L2UA 3F6VA 4WFZA 3F44A 1H2VZ 2NVQJ 4BBYA 3TOAA 3I55I 1PVEA 3BH7B 3WTVC 4BEHA 4J9SA 4QIWN 3DU5A 2XC9A 1J59A 2DR9A 3NNCA 4H4KC 3WE2A 4MK7A 3H42A 1SCJB 2D3OR 3PYFA 4QYZK 4DR3J 3R60A 5FO5A 3N6NA 4O3QA 5L3EA 5LGTA 3QYBA 3L3CA 1S6LA 5D78A 1DP3A 3PUFA 3L7OA 3UQSA 4TY9A 1XMQF 2HAIA 2W9CB 4WBFA 1U1LA 2AGPA 2VLAA 3TX0A 4PQAA 2QFIA 3PHTA 3M8PA 1STZA 2R7SA 3KP4A 1KYWA 2ADCA 3V6DA 4K4TA 3CIZA 2KHMA 2UUCJ 1VF9A 3PJWA 4DPYA 2ADBA 5JVGF 3NMAA 2DPJA 2QIFA 3TO7A 3BPDA 2KZVA 4LFCF 3I5UA 3WX8A 3FGVA 4PAAA 1N54B 1Q4RA 2H65B 2LOOA 1FE0A 5FKLA 1JJ8C 3PFIA 2I10A 3CO9A 3ZMUA 1P92A 1CJTA 4B3XA 2L3MA 2YNFB 2FHJA 5G0RA 1BBYA 1WSUA 4EJUA 4WPAA 2GA2A 1AUDA 2GS8A 1X8DA 2VPZB 3G4SS 4J9MA 1U1PA 3HPHA 4GRIA 2CQDA 1U8SA 1HLWA 2HTSA 4NQWB 3GSIA 3HULA 1K8AT 2VQGA 5F0CA 1D8YA 2UUAF 2C1EB 5AONA 5DRKA 3L2QA 2AU0A 3CUQA 2LLZA 2ZH5A 3RKQA 1WHVA 4X1EA 2NXUA 1R3NA 1S1UA 3DLGB 2OPRB 4FT8A 5IS2A 1D0EA 3GFJA 4ZPTR 2BW3A 3HKWA 1X1DA 2ELKA 2O5DA 2BVZA 1X9SA 3PNYA 2VPYB 2F9JA 2YNHB 1YZ7A 5H1SV 1SJRA 3D1OA 6FD1A 2C2RA 2CQHA 3P4UB 2A2CA 1HBUA 3EXCX 3DFGA 3R5AA 5CD4H 1FCAA 1IC8A 3K4BA 2QL7B 3OSNA 4HKQA 1D3WA 4KHPF 5IPAA 1ZZNA 1OR7A 4XKBA 3AJDA 2XS7A 5L3GA 2YNIB 1GVDA 2WCXA 2UUZA 3OL3A 4MFBA 3BQZA 1RJJA 2CQ2A 2DQRA 5IYBJ 6PAXA 3T8TA 1QPMA 1H89C 4Y28C 1JUSA 4ZZDA 3I71A 4GYIA 3DI6A 1WVRA 1XB4A 4RM2A 5JR3A 4DL0C 4F52A 2EKYA 4P2XA 1S6PB 3E3XA 5CYJA 5B7WA 2E2HJ 2BVLA 3T5HA 3H9GA 5KFAA 1NDPA 3SQNA 2FU4A 3IM9A 5JXSA 3O8HA 2WVEA 1CLFA 1KFSA 1IKXB 1LE8A 4PG8A 2YKPA 3D0IE 1ERDA 2R2TA 1L3KA 2NOJB 4DFMA 1ODDA 2HQ5A 2LCWA 2M0CA 3PSIA 3BZKA 2B9YA 4TQSA 2OH2A 1JLFA 3LO3A 4CYDA 2K3FA 5IWAF 4NLDA 4CH1A 3LAKA 2QN6B 2ATCB 3RB6A 3J7YI 1YS6A 3HUGB 3QNWB 1F9HA 2B6AA 1DZ5A 3K5PA 2ZVSA 1FO1A 2LU2A 2LDUA 4AU7A 5I4MA 2ADUA 4F4ZA 1B9MA 2VA2A 1M5KC 1FYLA 5EX3A 4JI4J 3WG9A 2D1CA 3X2QH 2DA1A 2R7WA 3D6MB 1JLQB 3MCOA 4S0HB 2CPHA 4A46A 1EH8A 1RESA 1Z3XA 5ICEA 3TA0A 3GF2A 1V3FA 3MM9B 5HOOA 4PYDA 1YQAA 1W36C 5FD5A 2UXXA 3K70D 2HHPA 3DHXA 2ZFUA 3C16B 1T98A 1FXRA 3PNVA 2JLGA 2BJ1A 3IC7A 4JBAA 3BP8A 5FLVA 2MHEA 3KTQA 3MZ8A 3LP0A 3EYZA 2IJLA 1B72B 2OF7A 3GLXA 1Y3JA 3PQJA 4ZITA 2DOAA 4IR9A 3F9KA 4URSA 5A0YB 2BKPA 4HTJA 4CIOA 1UPMB 4UV8A 4ZYHA 1MDMB 1D9AA 1QO0D 2O03A 4WTOB 1S57A 2X3DA 1GMVA 1L5UA 2DNQA 4IH6A 2UVRA 4KKOA 2AQEA 1IXSB 2IAIA 1I3OB 2P5KA 2GZOA 3VYUB 1C0UA 2JZYA 1R0BG 2HMIA 4KTQA 3US5A 3IN5A 2Z2YB 1NKEA 3IMQJ 4QIEA 1LK7A 1YW8A 3M8WA 4CM0A 3LSHA 5K8PA 2RNJA 1SL1A 2DXFA 2VQEJ 2HTJA 2E1PA 2JL9A 2ASLA 5FLXK 2D74B 4WYWA 3OUYB 5M2RA 1U24A 2DXEA 3R61A 1A5JA 1Q16B 4C4WA 2ICWG 1T95A 3B8HA 5D6FA 4ZN3A 4EFAC 1E6VB 2VDHA 3DOMB 4HDHA 3RQIA 3CC7S 1WJBA 3UO0A 2UZAA 1O8BA 3FXOA 1N5YA 3M8EA 4H0EA 2DT7B 3CD6S 1GX6A 3PO4A 1ONVA 5HVQC 3L2WA 3I59A 2EZIA 1T9VA 1G6BA 4HHHA 5L1LA 3DOMA 2EXUA 1R1UA 2RB7A 3QP6A 1Y0HA 1H2TZ 1T11A 3PR4A 3AL0C 2BM1A 3G82A 4LFAJ 4OMYA 2IAJB 4Y33A 1F2HA 1EKSA 4ZVGA 1FA0A 2RDIA 4HHUA 2Y1JA 3WHBA 2JMWA 3KLNA 2OJED 1Z77A 1CQNA 2FMLA 2YQ0A 3G4SI 2VFVA 2A6HF 5LEKA 1IQTA 4PJNA 2IAJA 1YLFA 2O01C 2CV2A 1VBKA 2ZD1A 1TQIA 1UCNA 2PT0A 4GVBB 3DRSB 2MA3A 4RNMA 3IRWP 2AYBA 3E5XA 3F8MA 4AQYJ 5SZTA 1OISA 2OPPA 1Q53A 3VAKA 2DYRH 1HQCA 5FDLB 3AY0A 1FTTA 4FYDA 2F8MA 1RKJA 1WJDA 3OYCA 2KZGA 4L0ZB 4D1QA 4PG6A 3B4MA 4LRCA 4N41A 1CJUA 4CH0S 2DCLA 2NXEA 1HW5A 4JI8F 2LLKA 3HRTA 1RYSA 1IN8A 3ZQCA 3UW1A 4RDUA 2NAZA 4HX4A 1WGXA 3RRHA 5C42B 2VG7A 2XY7A 4OX9F 4F4YA 5H9FK 4AVZA 3V7CA 1LEBA 2BKOA 3FBNB 3LGHA 4DV0J 2MABA 5E3OA 3S32A 1DU6A 1JUPA 4FNIA 3CCLS 3OL6A 3E2EA 3FIWA 2QLXA 2BBYA 4UUTA 5U47A 2BY0A 4RW8B 3GJSB 4PGGA 1TWAJ 1A6LA 3U2RA 4CYCA 4DX5A 4O44B 3IRQA 2BY2A 4HDGA 1V3RA 1RT6A 5E5NA 3V6HA 4KDPA 5D0GA 2YWFA 1F9FA 2C2DA 1UETA 1FBUA 1BQMA 3H2LA 3GG1A 2E5IA 2PA8D 1FWPA 4PQUB 2FNPA 1IKVA 2FJAB 4Q5VA 1LKZA 5RUBA 1IXRC 1Z2ZA 2IC3B 4OIPF 2L7ZA 1HBNB 1XTAA 3Q0VA 2XB5A 2V2ZA 1SFXA 4A2UA 2IM0A 3CCTA 2R7FA 3HD2A 3OVAA 3H36A 3HHLA 3PCOB 4M5DB 2DHSA 1IJFB 4ETZA 3OR2C 4BHQA 5F6FA 1A7GE 3S6EA 1U02A 1HKSA 4L5EA 3HDSA 5IP9J 2B63J 1R8PA 3D5RC 2AD9A 3EUHA 1XPXA 2V8VA 1IM6A 4BQNA 2GOXB 4WJBA 3ZQLA 1REPC 3D5SC 4AT1B 1S0MA 2HXIA 4L3KA 3K17A 3K4NA 2MD0A 1GT8A 4EM0B 1WORA 2CWEA 2PMUA 2LR8A 1JT0A 2OI2A 2X1GA 4BXUA 1YG2A 1Y11A 4RUCA 2AYEA 2FF4A 4KFCA 5ETPA 5E3PA 5KT3A 3RB0A 2RRNA 5D5VB 2W84A 3UCGA 4LITA 1UJ6A 1IN5A 2XQCA 3OWTA 1PJ5A 2ZNZA 3SXLA 4L9TA 5LEJA 1RBAA 2WA0A 4IH7A 4V19J 3K10A 1MNMC 2FGOA 1BUXA 4M9XA 4B9NA 3L7UA 3HXLA 1S4FA 2H6CA 4C8LA 4FS2A 1UEVA 2N3OA 1LPQA 3MTKA 2F4IA 1HFEL 4WYLA 2VFUA 2BJ3A 3OPKA 3SDGA 2DNYA 3RBEA 3GUDA 3LF0A 1EQMA 2E5GA 1DGRM 4ERDA 4KGKA 3KZYA 2NZCA 5IY5H 4KMFA 1OPZA 4PZJA 1S0VA 3CW2C 5IM0A 2GFFA 4CO0A 1M1GA 2PJRB 2Y9ZA 5KG1A 4QJVA 1HPZB 3BOQA 4IG0B 1JKQC 5FIIA 4RBVA 2MC4A 2DGXA 2ZFHA 2F3JA 1U48A 4UB6C 4J90A 3G8QA 2QJ3A 3WHCA 2PJRA 2FIUA 3EGNA 5FRNA 4ZC3A 2NPFA 2OV7A 3CC7I 1A31A 2ASJA 5E17F 4MEYF 4NZ0A 1ZA1B 5F8GA 1RPWA 5C4XJ 1DTTB 2MKIA 4JI3F 3W2VB 2AYGA 5F8JA 1VQ6S 1MN7A 1Y4ZB 1NK2P 2C2ZB 2G7HA 3LL7A 5M3FJ 1HYSA 4HACB 1ZLJA 5IT9Y 5DO2A 2KT0A 1K61A 2ROPA 1X9WA 2QYOA 2R7TA 4Z37A 1L0OC 4B9VA 4RAZA 1FE4A 4Q8EA 2BJ8A 3DYAA 4C8NA 3K70C 1Q0NA 2COMA 5IT4A 5GVQA 1BJAA 2ZHAA 1MSWD 4ED8A 4YQWA 2XGEA 3BR6A 2L7KA 1G4CA 2NUHA 2KM8C 3DFEA 3A12A 1D09B 1RAJA 2MY7A 4FF1A 4C11B 5AXMA 3EUKL 1GNKA 2HFHA 4W4MA 4UUVA 4RPFA 3SYZA 1F3FA 1GMWD 1W0TA 4X62F 3Q8UA 1TL5A 5HNFA 1T03A 3VVUA 4EBCA 3CCLI 1BR2A 1XCBA 1LQ9A 4NLXA 1SC6A 3JRAA 1A0OB 5L39A 2QSHX 4ZDNA 4RNFA 5D0HA 4KJIA 1Y39A 1Y3KA 2PMZD 1XMQJ 3HRMA 1WEYA 3PM9A 3E1SA 5KFNA 4AIHA 1XR5A 1REGX 4G6DA 4P5OA 1IGNA 4BDZA 1HNIA 1NJYA 4UZCA 1BQXA 2GIVA 2Y0SD 3GB0A 4ED0A 2X0LA 1O0PA 2IM3A 1SPBP 3KP3A 5CQGA 2L08A 1B7FA 3TP3A 1KU2A 3AG4H 3P7NA 1D1BA 4NC7A 4W97A 5HQ8A 2JZ5A 1OMSA 3SFIA 4Q5SF 2ASDA 4X2BA 5A8RB 2Z56B 2HRUA 4YB7A 3V4IA 2VE8A 4WF9Q 1OYWA 2GQQA 4Q4ZF 4EMSA 3CD5A 4IG3B 1SKRA 4RZRA 3KLHA 4IL6C 1OWXA 4YOEA 5DETA 2OEKA 1B64A 1Z6RA 1NK5A 5E0OA 3W7BA 2GVZB 5CYMB 4K4SA 2L2OA 2XZTB 2EEYA 3MMBB 2CJXB 4IHYA 4NRTA 1SC1B 2V8DA 4IH5A 5KFSA 3FXKA 1O3QA 2UUAJ 2ZMEC 1LW0A 2AQ4A 2HNYB 1HL6A 1WKLA 1MMDA 1F60B 1DQ8A 2J7KA 4K2JA 2DGSA 2WAEA 2E1CA 2STTA 1P9YA 2DW4A 1U7LA 4A5NA 1H38A 2LFBA 5CKTA 2HVIA 2Z2MA 1TQMA 1OYEA 2FSWA 1DLOA 2DMQA 1NCLA 4RA2A 2G1HA 5B0CA 1N32F 5KG3A 1U6ZA 4RBUA 3M4OJ 5ETQA 4EZ9A 4LRBA 1RC9A 2PMWA 4KHPJ 3ILIA 1TL8A 3IO1A 1WC0A 4PCQA 3OL4A 3MCMA 2F1FA 3HGGA 3CC4S 1IAWA 2XAJA 4FE7A 4ZVEA 1EH6A 2MD5A 2R5ZA 4ILRA 1MBHA 4CYUB 2H09A 3NL0A 1EIYB 4TYBA 1SVMA 8RUCA 2EK5A 3NGDA 4QWBA 1TVRB 4OI0A 1SV5B 2HVDA 2LEPA 5D8LB 4F3OA 3HT0A 1ZKGA 1B70B 4NCGB 3T41A 2VPRA 5HROB 4CICA 3KG0A 3DBLB 1K47A 2GO8A 4Y52J 2XI2A 4OHWA 5KTQA 3F8CA 1O5JA 3AFHA 4L5IA 5IWAJ 1URRA 2CJJA 2JEIA 4CH7A 4QYRA 3UR0A 2AW0A 3AHPA 2ZH8A 1DY3A 2CPZA 3IP0A 4OX7A 5DD4A 4GVLA 4IRHA 1RHRB 3SJMA 4BACA 2Q0OA 2PO4A 1KLNA 2CJQA 3NS6A 2H5EA 1O3TA 4DR2F 3BZQA 1AZSA 2XSFA 1Z7LA 4E7HA 4HH0A 1Z9CA 1IXCA 1Z6TA 4YFXF 4X84A 4LUBA 1GVJA 1R8CA 2QM3A 4G6QA 1KQSR 1OCTC 4Y6IA 3FM3A 2QLJB 5FD6A 2V6AA 3AA8A 1R1TA 3TI0A 2V6CA 1EJ9A 2IBOA 5CCLA 4GXOA 2MEWA 2QL9B 4XNFA 3C18A 1P1TA 3ULHA 3HKZA 4IO1A 2ZBCA 1R31A 2DH7A 2P9EA 4ZLJA 4NWBA 1NSQA 1WG5A 3GTGJ 1P4XA 4C9YA 2L41A 3GTQJ 3GG0A 2JTVA 4OYXA 5MLCV 3GFLA 3MEEB 3GWCA 1BQNB 1GX5A 2OAZA 3R5GA 5LGNA 2ZSHB 4RW4A 2F5FA 3QLHA 2ROGA 2FUG9 4B48A 4BYYA 1XDSA 3M7GA 1RWWB 4ED2A 4G7ZF 4O0IA 4B4CA 5GPAA 4L5JA 5D5XB 2JRMA 4ES3A 5KFXA 3QATA 5AE2A 4BNCA 5D4SA 1U09A 4OJ3A 3L09A 4I6YA 3FXQA 2CJAA 1W0UA 3ZMTA 1ZREA 3P9KA 1RDRA 3SEQA 2HOSA 3D0GE 3FKIJ 4UVAA 4NC8A 2EC2A 3LOUA 1YW9A 2YS9A 5LD2C 4B9UA 2C2KB 1VQ5S 2BYVE 1MWZA 3ASOH 2HEOA 4D3GA 2KPMA 3M1VA 3S15J 3I0TA 1YJWS 4IEJA 5E18F 3TAMA 1C0TA 4TLQA 5B0FA 1IBCB 2VBYA 2KB2A 1PYVA 3CCES 3OYKA 1TFYA 3WC0A 4P2MA 4DV4F 2M45A 3DCFA 3PTWA 1YITS 2D5VA 2Z0GA 1Z3YA 1G8XA 2M3AA 3KJFB 2NS0A 1T39A 1Y0UA 1CJKA 3RJPA 1PJRA 2CQCA 1NU4A 4YN3B 2CNLB 4ENMA 3AXKA 3KK3B 4ECSA 2HQRA 1YJ9S 3A4CA 3SDEB 3M9NB 1XQIA 4N76A 4V1Ak 1UZDA 1CPZA 2EG2A 4RW7A 2NREA 2EFPA 2D3UA 2Z9OA 5EWGA 2EPFA 2CZ4A 2AGQA 4DR4F 1J27A 1SD4A 4EV0A 4ZLPA 3HZGA 1H73A 1S1XA 3VGUA 2J0SD 2HHXA 5E2QA 4OX9J 2JPCA 1WCMJ 1HQ2A 2UVWA 2MH2A 1UVMA 5T41A 1P9QC 2QO3A 1FSHA 3I32A 1KQGB 3EUAA 5B1AH 3BC8A 5DJBA 1VQPS 4C3KA 3P9IA 4H4OA 1IWGA 2C3UA 4DZJA 3J81j 3CC4I 2A5WA 2GWRA 1F4KA 4LIWA 4CLKA 3DLEA 1WKKA 3BH6B 4AL6A 3Q9SA 2OMLA 1SEUA 4P72A 3Q8YA 2XAGA 4IQJA 4R8HA 3C7JA 3G8TA 1JKOC 5IXUA 5J1YA 1U2CA 3SI8A 3BTCA 2KJVA 4B17A 4EO6A 3CP8A 2HVQA 2WV0A 1IKYB 4AYBD 3OT9A 3K57A 3MMAA 2Z4PA 3MEKA 3R8YA 3IR7B 2CW0F 4DWIA 4J9NA 3WTUC 2NLWA 1FNOA 1ON1A 2HYFA 1R23A 2V1NA 3LAJA 2MB0B 1HI8A 2O0YA 2OPTA 1DUXC 5DM6F 2Z5UA 1B8IA 3H4DA 1F5AA 4NYPA 2MJNA 3HSEA 4RS8A 1SVOA 1YSJA 4PUSA 4TY8B 3G9CA 3CD0A 2EFOA 3FKJA 5F1RA 2XSJA 2PFFB 1S1TA 4Q7AA 2OMOA 4PJLA 3C2PA 3QGHA 4UNOA 4ILLA 1ZAVA 8AT1B 2WZ1A 3NGSA 4MTPA 2JT1A 4ITSA 2I5JB 2BQ3A 2DA5A 4QWCA 3BYPA 4WCEQ 3GFYA 2AJFE 3FCWA 2XS2A 4LF7F 4ZVHA 4N4OB 2CPJA 1AKHA 4XIDA 2BJ7A 2QX0A 3D68A 3Q0UA 1BY9A 2MZRA 2CV1A 4KICA 3ZMVA 5J2QA 4XMYA 3CTRA 4M63A 1UJ4A 3N4MA 2ZSIB 1RABB 4FXWA 1NB7A 2IVMA 2O5RA 3ASNH 1ZN2A 1KQ8A 3FBIB 5LMNF 3FDSA 1SC4B 1WEXA 3IG1A 5LT5A 1LNWA 1YX5A 2XI3A 4Y34A 4PUOB 4PXEA 2IRUA 5EDWA 4ZH4F 3PY8A 1R43A 1S1VA 3CB4A 4KBIA 1K78B 4JI3J 3L2VA 2E5NA 2DXDA 1UMQA 1RT4B 2BMBA 3BG3A 3C14A 2K9NA 2ELJA 1WTBA 3BO3A 4K0KF 3MN2A 1MBJA 2IDEA 2EV5A 2MLGA 4WIQA 1QJHA 1PC5A 1GXQA 2W48A 2HZAA 4G7OF 1XDUA 2WOMA 3CF5F 4H54A 4DN9A 1PJ7A 3NCPA 2MZQA 3CCEI 2IVYA 3IRRA 1YBTA 4YR2A 1XMAA 3A2KA 1FP1D 3OFEA 3CJQA 3BSOA 2IA1A 4HNVA 1YITI 1MLAA 4USWA 5GADU 1HLVA 3KK1B 2OPSA 3A3OB 3PV8A 2YKQA 1LQ1A 3BN4A 3LP2A 1L3TA 3G96A 2AQFA 4GO1A 5J4VA 4R0JA 1BD6A 5EX0A 1YJ9I 5IT9Z 3RSNA 1GQEA 5KK1A 1EHWA 3HSJA 3BO2A 3ISND 2W8KA 1R5ID 2HZTA 3SIPB 1TW3A 3LTOA 2A05A 4QTRA 3NP5A 3CMES 1H88C 3K2YA 4X62J 2RDJA 3ZR8X 2B9WA 4MKVA 4NI2B 3AD8C 5D77A 2MBFA 3MTJA 2LQBA 4ZTJA 4NLQA 3K8WA 3M6VA 5ETRA 3C3WA 1OQ3A 1PYOB 3LA2A 1IO2A 4NC6A 3R5BA 1VQPI 3ZQHA 2R4FA 3IP4B 2R3VA 1S7OA 1ZGWA 3S8PA 3MEDA 2Y31A 1HBMB 2V8PA 2MQOA 4ZVQB 4GO7X 1WC4A 3EWGA 1ETKA 1HQEB 3JSMA 4X4RA 2PSZA 4L74A 5KVRA 4HV5A 3LFUA 3P96A 2FVPA 1BC7C 1N5SA 3B78A 1FX4A 4ATNA 5KFDA 3JSPA 4KPYA 2XAHA 4KYZA 3JXOA 3NAHA 2APOA 2EH3A 3KYDB 1FEEA 2Z2LA 1W5TA 2ZH6A 3JB9k 3J7ZI 5KFZA 1VQMI 3IGVA 4OZ3A 2KU7A 1V3SA 1XMBA 3CJNA 2K9MA 4I6AA 2KRFA 2E66A 2QENA 2JJ7A 2I2YA 2AGOA 2XTJP 5LL6d 4G3IA 4LMYA 1UHSA 1X7VA 2EFQA 1BHNA 1T05B 2DPUA 2Q66A 5DGAA 3FC9A 2W1BA 1VQ9S 4N77A 1WJCA 2AKWB 4NA3A 1UWAA 3ENVA 4IUFA 1N77A 2YU3A 5I3UA 1D0XA 1ITYA 1KOHA 4ZP7A 1TU0B 4WP9A 3WU2C 1RT3B 5E3CA 1F36A 4OX8A 4U6PA 2HRTA 3P45B 5HP1B 2DK5A 4QW9A 2X51A 4YIFA 1JKPC 3CCSS 1VRQC 1W7PA 5GAEI 2YPRA 1VIOA 3HC7A 4F7VA 3UN3A 4F7ZA 3I0RB 3BG7A 2DR7A 3HHGA 3J7YJ 3CE8A 1R4MB 4N47A 4N56A 3K5MA 4K2EA 2BQRA 4G1QA 4BHPA 4CZCA 1FEXA 4RB1A 2CQQA 2GIZA 1R8BA 4HG2A 3I0RA 5J2NA 1ELOA 2QSWA 3UN5A 2HLTA 2VFRA 5EEAA 1HNWF 5J1NA 5L3FA 3GZ7A 2VBWA 2Q2EB 2WONB 3TBIA 2LY9A 1Z1DA 2DK2A 1FTRA 3K4CA 3IWXA 2J5OA 2PLYA 4OJHA 2M8DB 5JFRA 4F3QA 3QBCA 4CO5A 1HC8A 5DUKA 3GTJJ 2H6BA 2M0MA 1TP7A 4BC9A 2KLOA 3RKWA 4QR2A 4IOCQ 1MNEA 3CUOA 1WJ5A 4OZ0A 4W90B 4EYHB 4EZ6A 1Q1KA 4C2MA 5HLFA 2OCCH 1RQ0A 2W4SA 3S1MJ 3SV3A 1O4XA 2XWXA 4IQXA 5CZVA 2BDPA 3DHWC 5KFGA 1U1KA 2L7FP 2LY1A 1FKPB 4ZDOA 4DYQA 3JRIA 2CADA 4X64F 5BS6A 1KD1T 2Z3YA 4C8YA 2R7ZJ 2GQ2A 3W9JA 2OLWA 2QSFA 4DR2J 3KXDA 1Z1ZA 3W5YA 1RETA 2I9SA 4KO0A 3DLKB 1M5PC 2C3MA 4NCAA 5KFYA 4R8UA 2N4CA 2KT2A 1OJLA 1LEOA 4HNUA 1SAUA 2Q6CA 2VL1A 3CC2S 2VUGA 4RUHA 1TL7B 3M07A 2HS0A 1AWCA 1UP1A 2EPIA 2BEFA 2R7OA 4UQTA 4DIQA 3GTKJ 2FTRA 5LHIA 4H4MA 3OLBA 3M2UA 2QQBA 3MEGA 4IFYA 3KPHA 2WK4A 2XCPA 2Z8QA 4NLTA 4IOBA 4DG1A 5HBMB 4LG0B 4MYUA 3CUQC 4UY8I 2E9ZA 3PO3J 2DGVA 3OYHA 4KN4X 1CULA 1HSTA 1MROA 3T1YF 1FD2A 6AT1B 3OHBA 4USTA 4P75A 2RH3A 5T7LB 1S6UA 2DGQA 3AQOA 3CMEI 3CDIA 3IS9A 1AU7A 1G6NA 1S10A 2N3LA 1VQLS 4CLYA 3FXRA 4IQ4A 1RTJB 1H72C 2ASYA 1OSCA 1XS9A 4CLLA 3MECA 5F9LA 4DYRA 1F43A 3V2UC 1YX3A 2DFHA 3UN2A 4DQQA 2LF8A 3ETOA 5DDQC 2VBZA 3ZN0A 1TKDA 4DUTA 2HGNA 5A2QU 2KXHA 2QGUA 3GYGA 2JVOA 1X5PA 5JLXA 2L9RA 2YNGA 4JB8B 5FD1A 2HG4A 2DAOA 1MJBA 3P3DA 1HKAA 1NHVA 2W2NP 3NWSA 3QGPA 1WPKA 2FRHA 4EM1A 3M6WA 3X1LB 3TVKA 1G3SA 2B7EA 2LA4A 2N7CA 5KFEA 4DNCA 2R2RA 2XPUA 3MEXA 4NYOA 2KVIA 4PRFA 5HMYA 5L38A 2K86A 5ETMA 1R6RA 3IBCB 1V5VA 1FRJA 1VQ9I 3I6PA 3KX2A 2K85A 1F1ZA 2NVUB 1TL3B 5ILSA 2C3PA 2AJ2A 4FVMA 4J91A 3W8GA 1ETVA 4Q0BA 3Q22A 3WHIA 1NK6A 4ZA1A 2DQLA 1F3VA 4TXSA 3LA0A 3CCSI 3H92A 1U1RA 3ABUA 4KISA 3E6CC 1UJ5A 3SFZA 3ISNC 2R9LA 4E7ZA 4DR4J 3DM2A 3HVTB 2XDVA 2NYHA 2NNNA 2GJFA 3AQPA 1I3QJ 4K4XA 4LRDA 3IWFA 1QPIA 3KLOA 1F5CA 1X1PA 3LANA 3H35A 2P9GA 1WC6A 2UXDJ 2BANB 2HSEB 3OYAA 1TKXB 1MG7A 4MTEA 1MH3A 2B8PA 4RKUC 3UR3C 3OYLA 3MR3A 3ECOA 2EWNA 1RTDB 2QLFB 3L7WA 3HG9A 3S1TA 3BDEA 1N25A 5HI7A 3PW4A 2JEFA 1IUYA 4L0YB 1AROP 4URGA 3RKYA 3T5KA 1RTDA 3HXMA 1DQUA 1DURA 2Q6BA 1GV2A 2JUCA 3V81A 1PP8F 4CTAB 2XUBA 2H1KA 1HWLA 5KAKA 1A6IA 3RAXA 1VR6A 2EA2A 2G2OA 2K1RB 5I42B 2POKA 2VI6A 1USTA 5FKOA 1TQLA 4AL7A 3LP1B 2RQCA 2P7VB 3OR2B 3IA0A 1X0FA 1ETQA 2FLOA 3QT5A 2IS1A 4RB2C 2DIVA 2X1BA 4HYEA 2V4JB 3CT9A 2J8SA 3K6GA 4BS9A 1XGSA 4Y3CA 2WV1A 4OJGA 4GDFA 4XPEA 3UI3A 3JSYA 3I64A 3LGMA 1NHUA 4HF0A 2COLA 1VK8A 3HT3A 1FIAA 1GXTA 2EBIA 1LWCA 4PDKA 3CC2I 4WFXA 5HLIA 4LF5F 2BOLA 3UFCX 4IHTA 1HD0A 3QWPA 1TKTA 2YSRA 1MW7A 3EPIA 1S1WB 2FD5A 5JMNA 5C7PA 4BLGA 3GFIA 4PJMA 1JI8A 2F6CA 1ZRDA 3BS9A 3SQGA 3GYNA 4LF7J 3GVAA 2PE8A 4U95A 2VJVA 1ZTWA 1U0HA 4R5PB 3ZGKA 4DV1J 3E97A 3N97A 1Z7UA 2K9LA 4MIBA 5TGTA 1AHDP 5TRDA 2TRTA 2FBIA 4NBQA 3AAFA 1N0UA 5FFZA 1XC9A 5F0FA 4NLUA 2BJEA 1FJCA 3HHDA 2VKHA 4WX9A 5J6XA 2JSPA 2ALYB 1XGMA 3DMJA 4M3GA 2F9DA 1WJEA 1VQLI 2EKNA 2DB1A 5J2MB 4OZ1A 1FK9B 1AT1B 5LMNJ 3LAMA 1R71A 1HA8A 3S1NJ 3VWSA 3TP2A 2IA2A 4OX6A 1EZZB 2B8QA 3GWZA 2MG4A 2P9CA 2VG5A 4LRAA 2JFKA 1TQPA 1FFGB 2FVCA 4DQRA 4D0PA 4KFBA 4LSLA 1MMLA 1H9GA 1FDBA 5B66C 4DV6J 4WCGA 3ELKA 4X4VA 1BI0A 1NHAA 4UUWA 5HSPA 1LNQA 2MGZA 1MGTA 3M2RA 2N4DA 2JDJA 5KFIA 2OD4A 2KDZA 3W5ZA 4QPXA 1KHVA 1X5OA 3Q23A 3UD3P 3HOZJ 3KLIB 4TQRA 3HL2A 3PACA 3BR3A 3JCUC 2PFDA 4U87A 2W82A 4LJZF 3BROA 1GEHA 2BV3A 4QIFA 4YY3J 1IF1A 2HIYA 2KZMA 4I4BA 3CJKA 5EUHA 3LFKA 1OLTA 2FE3A 2HVHA 2EV0A 2V1UA 3FBBA 2L9VA 4NLVA 2WTEA 3PXGa 1YHQS 4B3RF 3NARA 4Y00A 1QAXA 1Q5YA 1FOKA 2XYHB 4C8KA 5ED4A 2CZVC 1WEZA 1K0TA 2D2WA 2CQGA 2MZJA 3DLJA 3B4DA 1RAHB 4NMLA 2NVXJ 3D7SB 4P71A 2LVWA 4K50A 4YDXA 2UUTA 1IV6A 4MKYA 3F41A 2HFOA 1U9NA 4Y13A 3TEDA 1RSCA 2HPUA 4M5HA 3T1HF 2V2VA 3HHEA 2MQPA 1SFKA 2ACMA 4J9LA 3DP7A 3TZYA 2Z58B 2LG4A 2HHVA 2EINH 5A2QK 5CYQB 3HBLA 3OS1A 1DP7P 2OTLI 3D3BJ 5CZXA 4GCVA 3T5JA 2JSCA 1RK8A 3J80K 2DHGA 2XF6A 1JNZB 2CPYA 2DNGA 3R6GB 2LECA 2GVDB 3W1YC 2X9DA 3HD1A 4V2FA 2L48A 5CYQA 5B0AA 5E41A 1UEUA 3Q5FA 4A4JA 4LT6A 1XJWB 1ZPWX 1IQZA 3K5OA 2JH3A 4ZN1A 2HWHA 2RHQB 4WTYA 1G2EA 2AHQA 4DR1F 3R9LA 2BE9B 2KISA 3U1DA 3MM7B 1CF7B 2QG9B 4YUDA 2HLUA 2DOEA 3OFHA 5KHDA 1H2UX 1V5FA 2WB4A 4IRIA 3FMSA 1XNQF 3WU1B 1UFKA 2ZDPA 3SFGA 2XVCA 1T9YA 2ZWPA 3BR9A 1W5CC 4M3FA 2LKPA 2LXFA 4BDYA 2GGPA 4ECYA 4IZZA 2HPIA 2Y9YA 3ET6B 1M5OC 3ETMA 1J7KA 2EWHA 2HHTA 3SYTA 2VQLA 5EYRA 3IWNC 4U88A 1Q5VA 2B4UA 2LA6A 3AOBA 2IW5A 2YXLA 4N5SA 2XLJA 3NAUA 2FLPA 3OFGA 1T38A 4RO0A 4YRVA 5E3MA 1NJXA 2M3DA 3M2VB 3UDCA 4XLNF 4HTIA 3DEUA 2EILH 3VYTB 4U7CA 1UVIA 2BEOA 2X1CA 3ZQQA 1AOYA 1N5TA 3UKGA 4U7BA 1C1CA 5A8WB 5T14A 5EWFA 3AH6A 2JNJA 3LSKA 3VAIA 4G8XA 1RADB 1U1NA 5ERIA 3JAMY 2M88A 4ZVOB 3VGVA 4D5FA 2DT6A 3IRXB 4CCJA 1Y10A 2DA7A 3GP9A 4DX7A 1OYDA 2V50A 1GH8A 2ZMEA 4WP8A 2RILA 2CQIA 5L3BA 5CCMA 5DG7A 3BV8A 3ZCOA 4XLAA 2IHR1 3MCZA 2DNLA 1XMKA 4XRFA 5F08A 1Z67A 3ZRGA 4BXXJ 5K8NA 4F55A 1HNWJ 4ZYAA 4F50A 1WNEA 2NSBA 1FESA 1BM9A 1YBAA 3NBPB 2XHKA 4Z7CA 4QIVA 4FPIA 4ZHRA 4QYZJ 3W66A 1X3WB 3W62A 2Q3PA 4ECRA 1X3UA 5IQQA 3QJLA 3T9ZA 1T9WA 2FZCB 1QSSA 2CSOA 3K4KA 1O6XA 2CFXA 1KYZA 1KU9A 2O6GE 3H3VK 4FKYA 2IJNA 3CJ8A 1KNZA 3BF4A 1FKOB 2R8GA 1VQNS 4JI0F 4MT1A 3RW7A 3PZPA 1QAJA 3W6VA 4I6WA 4P52A 3CDWA 5KAIC 4XOTA 1SQFA 2X6XA 1I6XA 4DGWB 3A3NB 3MDFA 1B7YB 3KZZA 1RWXB 2IDLA 1U5TB 4X64J 3HCXA 1Q1VA 1SJ1A 3HOTA 5LRSA 4OI6A 1YO5C 3Q86A 2ESNA 4ZP6A 4DFKA 4WIIA 3P9CA 1CEZA 5D8HB 1SB6A 3DPTA 3A01A 4NASA 3IBWA 1AYEA 1U2WA 3QT8A 1UPPA 3LSMA 1FRIA 1XERA 2DODA 1G7CB 1DPRA 3MMCA 2WW4A 3H90A 2RF2B 2FJWA 4UTGA 2HNZB 2FBKA 1YHQI 3G1LA 5I3PA 4YP3A 1SVDA 4ZIVA 2YQ1A 1X4OA 3QO9A 3FK7A 2YKNA 1SUQA 4C7QA 3SV4A 1FFWB 3Q9VA 1EA3A 4O5VA 1X4DA 4MIMA 2ZC4A 4JI2J 1Z05A 2FUG2 3POTB 4F0MA 1K6OA 2WB1D 3MPUB 1OY6A 4O3MA 2Z33A 3JRCA 4F0KA 2Q1ZB 4XICA 3T1YJ 2LC2A 2QTWA 1QU3A 4B3OA 3BJYA 2ZCWA 2MQMA 1VHFA 2LP0A 4RGRA 3DOKB 3GR1A 3FNNA 4LSNB 3N28A 2HKEA 1REVA 2R7RA 1VI0A 1IN0A 2W9BA 3J7Z5 2DNRA 2J9EA 4MMOA 3PRBA 2Q1LA 1Z91A 4YMEA 4OYZA 1RBOB 1JJ4A 3MKWB 4CDGA 4LR7A 4PABA 1NDKA 5CLSA 1JHHA 2L0KA 2XGCA 2FJBB 1U0SA 3ZN1A 3L7PA 1U0JA 4QOTA 4CO2A 1SL2A 2DNNA 3I0SA 4HEA2 4QZVB 1SIZA 2BRKA 3TUPA 4DJAA 1R4NB 4DBRA 1RP5A 3CCYA 1D5VA 1NO8A 1HBOB 5HJXA 2IS4A 4OZ2A 1T9TA 1AA7A 4CRJA 3KEQA 1YIJS 1WKMA 5KG6A 3UCZP 9ATCB 4MAKA 1F9EB 2Y30A 2PMHA 2CG8A 4Q48A 3DBRB 3EDQB 4EUVA 4CLSA 1Q82T 1HDPA 2VOPA 1DGWY 4V19K 3CCQS 2Z1DA 3BR1A 2E1MC 2ZBQA 3JRGA 2VD3A 3IAS9 3LH2S 3D1NI 1SFOJ 1HW2A 1UZHA 5KFVA 2MGQA 1QTNB 5CVJA 1RT2A 4L6V3 4NUBA 3ZMSA 1RT5B 3T6BA 4ECTA 1FC3A 3BWGA 2L5QA 4MLOA 4OLPA 3V7SA 4ZCMA 1RHJB 3HK2A 4A3KJ 3FCHA 3I4MJ 4F2SA 3VQTA 2RQPA 3OBIA 4OMZA 3KP7A 2HQIA 5KFOA 4XBFA 1YGYA 5ETTA 1KQ0A 3QIPA 1L3UA 3FFIB 4BE2A 3CTAA 1FJ7A 2VQFF 1CG2A 2W4PA 3N79A 3ABKH 1V3ZA 1AA1B 1GT0C 3GZNB 4Y2CA 2XEXA 3JRDA 5BR8F 4NA2A 4OI4A 1RISA 4ZPVR 3TRGA 3Q8SB 4L76A 2OU2A 1E6YB 4Y17A 1NJZA 4LFUA 3ZO7A 2CJKA 1ZM2A 4OZLA 4DYCA 4A8XA 1GMWA 4AM3A 1R0CB 4KIGA 1KVIA 4QWAA 4RB0A 4L9VA 2XC7A 3QRPA 1SMYF 1QZEA 3R4KA 2IYIA 4S0MA 4ZVRB 1LVAA 2CUFA 3OR1B 1GLNA 3ECHA 3T1BA 5IOZA 1DFDA 3BJOA 4XKVA 4NZ7A 2PMZA 5D5UB 3TZWA 4B8XA 4ESJA 3EYIA 3I4NJ 5J2PB 2CV0A 2N7YA 4F67A 1N8RT 1QDUB 3ABMH 1WJ9A 2XMTA 4PWDA 1S97A 3J7AO 3QAUA 2DO0A 2O3DA 1JLAB 1H7WA 4OI1A 1YBUA 1VQNI 5KFJA 2Y0SA 4JI5F 1BOAA 2H4WB 1RAEB 5HMWA 1WHUA 2E5JA 4I76A 3KYCB 1F0XA 1S76D 2E36A 5KFHA 1UVKA 3JRFA 2PEXA 3GX4X 1SH2A 4ZCIA 1VISA 2E1OA 5C24B 1VRTB 4UY85 2X6YA 2DXIA 3G8SA 3GYHX 2Z2ZA 2FGCA 2ZJQF 1FWZA 3DGVA 1U2FA 2LYCA 2A3JA 4O0NA 2KFNA 4PZVA 4XRMA 2X6OA 4RNNA 3QYEA 4XPCA 2A2DA 3RG6A 3OIPA 3KETA 1VRTA 3JRHA 1HNXF 3A8EA 1D9FA 1ZARA 3KEOA 1X4BA 1GDTA 2DA4A 3JSRA 5KG0A 3GXOA 3THPA 3DRRA 1T2KA 5F27A 3DF8A 3OYFA 2JSXA 3TNVA 3FXJA 4BJ6C 4LF5J 4FKXA 1VQOS 2QFJA 1FOWA 2ZFWA 5DCMB 1VQ8S 2Z2SB 2VF3A 1RRJA 1JKHB 2ILZA 4XKWA 3HKZN 4II2A 2FDNA 1JLGA 5D15A 4JV2A 1IZ1A 1TT5B 5THWA 5KAFC 1WDDA 3ILJA 1VLOA 4HZFA 3MAQA 2XKOA 4Q2MA 3HSGA 4RNOA 3Q8PB 2M4GA 4C2TA 5F3TA 1IUJA 4MIWA 5A8KA 4N8OA 3BN7A 5IZHA 1FI4A 2Z30B 5EZHA 4UOFA 5H9FJ 1IKWB 1I51B 1TP4A 4G94A 2BHYA 3O6QA 3PW0A 2V6EA 1RAGB 3E5UA 5J1UA 3S3OA 4DV7F 2XMWA 2R3SA 1TV6A 4NX9A 2M9HA 1KS2A 1VQSA 3JRBA 4I2OA 3BBFA 1S8NA 5K5QA 2DGOA 4XSXF 3HJEA 2J76E 2NVYJ 5D3GA 1I6JA 2OPQB 4RUBA 1PO6A 2KKOA 4OHVA 2X6WA 3FZVA 1NSAA 2ISYA 1X3ZB 3F56A 3J81Z 4YG2F 2A68F 2ZXWH 3EGVA 3IBFB 3MAAB 3JAMK 7FDRA 4A0ZA 4ZYEA 3MF5A 2RAQA 2MKJA 3LGNA 3LOCA 5G4DA 1S49A 2H51B 3CCUS 3S14J 1NSKL 1XC5A 5L3CA 3RRGA 2B0LA 1ULYA 2ZBIA 1S9GA 4ICLA 3DRPB 1D3YA 4I2QA 3DEEA 2AEFA 4XR6A 3CCQI 4OINF 2LH9A 1WI8A 4RGXA 4AC0A 2AX1A 4B3RJ 2YX7A 1SQEA 2R5YA 4KAIA 1T6SA 3WG7H 1B6AA 4KHMA 2AO9A 5J1EA 4M6VA 1TUWA 3K4JA 1YJNI 1NUEA 3DPUA 2O66A 2QA2A 3KJVA 3T6JA 1WQ2A 2H94A 4I0AA 1O7FA 3OJUA 4IRCA 1Z2LA 1ZOTA 2MQQA 4WK8F 2JWNA 2QA4G 3OOPA 1MU2B 1HMVB 3Q24A 2ZO4A 1FTZA 1R8AA 1DJ0A 3VTIA 4A69C 5LOQA 2W1OA 2W2QP 1EP4B 3T1HJ 1VK3A