2L9NA

Structure of the human shwachman-bodian-diamond syndrome (sbds) protein
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
250
structure length
250
Chain Sequence
b'MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome maturation protein SBDS
publication title Uncoupling of GTP hydrolysis from eIF6 release on the ribosome causes Shwachman-Diamond syndrome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 44
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2011-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01172 SBDS Shwachman-Bodian-Diamond syndrome (SBDS) protein
A PF09377 SBDS_C SBDS protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.900 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l9nA02
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2l9nA03
3.30.1250.10 Alpha Beta 2-Layer Sandwich Hypothetical 12.0 Kda Protein In Nam8-gar1 Intergenic Region; Chain: A; Ribosome maturation protein SBDS, N-terminal domain 2l9nA01
3B82A 4FN5A 4ZCLA 2NPFA 3LH2S 2ZITA 4MYTA 4ZCMA 4ZCIA 3ZZUA 4ES3A 4TNOA 2CVEA 1T95A 4M1KA 2XEXA 2EFGA 3E3XA 4ES1A 4QR2A 2L9NA 1ZM9A 2WBMA 2BM1A 3B8HA 4ES2A 2BV3A 1DARA 1NYNA 1N0VC 4ZCKA 2KDOA 3ZZTA 1ZM3A 3OQ2A 1KTVA 1FNMA 2IVYA 4MAKA 5G4DA 1ELOA 2BM0A 1VI7A 4MYUA 3UI3A 3EXCX 2I8EA 2E1RA 4QR0A 2I0XA 1P9QC 3ZZ0A 1ZM4A 3B78A 1U2RA 4QR1A 1N0UA 1ZM2A 2J7KA 1ZPWX
chains in the Genus database with same CATH superfamily
3G71I 3KLFB 4LIUA 4RNMA 3EUHA 1NSKL 1HI0P 3L2CA 2H65B 3BSCA 4EYHB 8RUCA 1IM4A 1NJWA 1FX7A 4OAZA 5E1XA 1ZAXA 1VBYA 3DLEB 3FKIJ 5L8RC 3L95X 1RHRB 1C0UB 3SYTA 5C44J 4BKXA 4L74A 3ZZOA 3JRCA 1O3QA 1REGX 2X7IA 1MMDA 3ONQA 1TAQA 1F6TA 1LQ1A 3ZXSA 4F93B 1SL1A 2HBYB 3LP2A 4NB5A 2BRKA 1JXSA 3I6PA 3I0RB 3K59A 2UVVA 3RW6A 3CPWR 2VZ9A 4I67A 3VAMA 4DL4A 2JFKA 4DFPA 1S1XA 1HI1A 4LRFA 4XMYA 1NMEB 4KGMA 3MAJA 1S6PA 1BC7C 4QWQA 1FRIA 4WIQA 3LA3A 3FMSA 5FKMA 2HWHA 1BI3A 1Q7YT 2JNJA 4J7CA 3U02A 1K47A 3WHCA 4JI0F 3MPVA 5CVIA 4C3MA 4BL0B 1FOWA 2G2ZA 1PYSB 5IT0A 2WB1N 4TQRA 2QIFA 2BEFA 1J5EF 4NEZA 2W4SA 4O3QA 2D1CA 3SQOP 4MQ9F 4UUSB 1Q16B 2E7XA 1MDMA 2CU7A 2E44A 4UNOA 1MJAA 1VOMA 4ENKA 1U6GA 1ETYA 2L9NA 2XF6A 3DLLF 1U48A 5A2QY 3FEXB 4DZJA 4I69A 1U9OA 2BYVE 3J7YU 1P4AA 3I5AA 2DR6A 1O7LA 5K20B 1PP7U 2DGSA 3CIZA 3GJQB 1S99A 2C2ZB 2KYZA 1K9MT 2M52A 4ZCIA 4IFYA 2W85A 2JX2A 4JI4F 2R0QC 4DF4A 3WE2A 4ECSA 1N32J 1NH3A 5GADI 3HOUJ 1OCPA 3REOA 1ZRFA 1EHWA 3MM5A 2DPJA 3DDIA 4B3OB 1N36J 4V2FA 1P1LA 3IS9B 3N6LA 4USTA 4IOCQ 4ECQA 4ZP6A 1QUPA 4I76A 1X4BA 3H4DA 4M5NA 2NYIA 1RT7A 1QPMA 3MKYB 2JEIA 1I3OB 1SKWA 2ZOFA 3BP8A 3QNWB 4E7IA 4C48A 2EVZA 2CUEA 3B82A 2WW4A 4ZYAA 5CQGA 5DDOC 3CJQA 4KT0C 2ICWG 1HWIA 4PG7A 4GGGA 4EEYA 1A36A 4ZJLA 5M5WJ 2YVSA 3ICLA 2R8GA 2LG4A 1RBOB 4F25A 1G4CA 5IT9K 3ISND 1O5JA 5DDGA 4DV3J 3AG3H 4GO1A 1IC8A 4II2A 1X4DA 3QU3A 4JI8F 1G4DA 4G6DA 2XB0X 4RW4B 3RAMA 4FYWB 4TU9A 4AUKA 4B3AA 1M0SA 3J80Y 2D1VA 2R7SA 4DUTA 1OLTA 1HQCA 2FHMA 3SMZA 5HVHA 2HOTA 5IT9U 3OTOJ 3POTB 4NX9A 5I3UA 4WP9A 4RGUA 4B17A 5K8OA 2KT5A 3HGYA 3PIOF 5CYQA 2A0FB 5J40A 2FLOA 2L9VA 4X4VA 4ZHRA 1XDSA 3O3LA 3DBLB 1JLGB 4RKUC 4CLSA 2LSOA 4Q48A 2VQEJ 2FY8A 3SCIE 4YIRX 1HWUA 2C3OA 4CA0A 3KFWX 4NLDA 2ZH4A 2MTLA 4IR9A 1WG5A 1VGYA 2W84A 3OL3A 4WP3A 3OR1A 1XD7A 3CC2S 1XR5A 3WTZA 1H9TA 4USJC 3T5XA 2N4CA 3M2RB 2KZVA 5E33A 3P49B 2J5AA 1Y1WJ 4BE1A 3CC7I 1PUFB 4M8LA 4FHTA 5KHDA 4IOBA 3IV5A 4I6AA 3VGVA 2L9WA 4P9UA 1NK5A 2XUBA 2CZ4A 3DRSB 4BH9A 3OS1A 2DXFA 1NB7A 4NRUA 1BW5A 1XCBA 2GV1A 4QR0A 5EZHA 3PNYA 1B72A 1NU4A 1MKMA 1JLAA 1ETQA 2DO7A 2FJBB 1EX8A 3H5RA 1GMUA 1KC8T 4S05A 2PJRB 1LDKB 1LUJB 3M2VA 5GAHJ 2C42A 2V9VA 2FU4A 5D6EA 3QJLA 4R79A 3ET6A 2BOLA 1N36F 5D3GB 1U7LA 3MMBA 3HFVA 4ELVA 4J9PA 5B0AA 4OHYA 5CQEA 1FNXH 3FDYA 5L39A 2RNGA 1OCTC 3QIDA 3GTJJ 2FUG9 3AL0B 2LXFA 1S1WA 3KK2B 2G4BA 4XNFA 2KFZA 3EYYA 1YBUA 1YX5A 1LWEB 1D8YA 3MR5A 2ABYA 4B4CA 2EBGA 3S3MA 1JJ6C 2FPHX 4QPQA 4M95A 2Z30B 4DU8A 1RACB 3L4BC 2AZ3A 5L1KA 2V4JC 4UY8I 4C0OC 2CQ0A 3IRXA 2LEBA 3WG7H 2F9JA 3UNGC 1J09A 2EQRA 1LW2B 2YWWA 1V3FA 5IPAA 3NAIA 2VQFJ 2ILZA 4CDGA 3FXUA 2B8PA 4DV3F 2POKA 1KLNA 2EA4A 4KN4X 2Y75A 1GDTA 4DU7A 2QV6A 3MHYA 1BN5A 2JFDA 1VISA 2NVTJ 1V3RA 2Q79A 2ZKTA 3OTOF 3BGOP 5EX3A 3MMJA 4I7FA 3HSEA 3D6HB 4JI2F 1IAWA 2CAJA 2JLGA 2DMTA 2DDBA 2J5OA 3M07A 3KZZA 3ZFVA 2ASDA 2R8HA 4Z7YA 4YY3F 2XGQA 5KAKA 3CD6I 5KG0A 3NCRA 4CIOA 4W90B 2G7HA 4L3KA 3OVAA 1RBLA 2Z8QA 2VQEF 4PPDA 4MIAA 1TFYA 1I1SA 2BW3A 2NSCA 1IKYB 5FDLB 3TOQA 1UVNA 3L7OA 2JDJA 5K5OA 1J9IA 4IJAA 2JLFA 3MM7A 2C28A 3M8EA 5AE1A 2LKZA 1VRUA 2JEGA 2NSBA 4QWCA 1HSJA 2QLWA 4BJ6C 1U0HB 2PI5A 3KUGA 1NAQA 1NPKA 4FNHA 3PSIA 2IM1A 2R9LA 5EX0A 1PGZA 2HQRA 3NGKA 2XMKA 3G82B 1S1VA 4JOMA 2P9CA 1KOHA 4S0HB 5J2QB 2HQNA 2CG8A 4Y17A 2CKWA 4N56A 4IO9Q 3MMCB 2FIUA 3N5BA 2GQ2A 4DYCA 5IOYA 1JLBB 2ASJA 3MZHA 5F8HA 1CBKA 1UFMA 4DL2A 4UV8A 1TZ0A 4R1HA 3QLHB 3BS9A 4ECZA 2ZZTA 1SCJB 2QMXA 3FEYB 1C0WA 3BKTA 2GA2A 3MUTP 4ZYHA 1O3RA 2OTLI 4NLXA 4L9VA 3CJ5A 4NLGA 4LBHA 5HP1B 1IV6A 2B9EA 2DT6A 1HBUB 5E3PA 1YJ7A 2B43A 1UEUA 4A6EA 2OEMA 4KE5A 4PG8A 3T5HA 1YJ9I 5DEQA 2MGZA 3QRPA 3EGVA 4EU0A 1JT6A 5HS7A 2DK8A 2M0MA 1J5OA 3J81Z 4OX7A 2J8AA 4PWWA 3K8VA 3HOSA 1R8AA 3MEDB 2FVCA 4UHTA 5CABA 3GX4X 2HPMA 2H4WB 1ZOTA 2BE2B 2L02A 1LK5A 2IIHA 2QZ8A 2RU9A 2VPWB 5CYJA 1VI0A 2HOEA 4HX8A 2DGQA 1HNWJ 3IH3A 5M3FJ 4Y6IA 4IHWA 2BRLA 3AOBA 5IM0A 3T6BA 4ZITA 3DKYA 2DMPA 2VQFF 4LD5A 3KEOA 4E98A 1LB2A 4DPYA 3DDKA 3IG1B 2P5LC 2COMA 2D45A 2OP5A 3CF5F 5HANA 2HVDA 1YJVA 1RWWB 1UAAA 4X84A 4AUXA 4D7NA 1ZYQA 4MQVA 2VPYB 2KIUA 1TWCJ 5EYRA 4B47A 2DKOB 3BY6A 1G6BA 3ENVA 3DKWA 1YG0A 3UDCA 4LOCA 3BO3A 4EGYA 5HQLA 1LK7A 3CJ0A 2XPVA 3U1LA 2LNBA 4RLEA 3WHIA 5E1WA 3CMAI 1PUEE 3CO6C 2JSXA 4Z2YA 5D6FA 4WIIA 3EDPA 3PXGa 3PKYA 1TVRB 4M5DB 5GVQA 1MNEA 2FGOA 3MXHP 1IN4A 2XAJA 3KIOA 1A31A 2QVOA 5G0RA 3KMQA 4LQ3A 4BAYA 4Q44A 4JI5J 2LBFB 5CCMA 4P5OA 2W2QP 3KHRA 1FCAA 3PRVA 1JXLA 2OTJI 2W2OP 4I0BA 4XICA 5F8MA 3IWNC 3GCXP 4OIPF 2K9NA 2NVYJ 2YUSA 2FSWA 3S6EA 2AQEA 4M9ZA 2KXHA 2RN7A 2BZ2A 2V4QA 2QA4S 1ZLJA 2PQ8A 3KLGA 1W0UA 4OOIA 3MM6B 2R4FA 2HNZA 5D5XB 3AQOA 4YN3B 1W1WE 1B8IA 1FF2A 3GFJA 1IJFB 2C2OB 2FBHA 2HR3A 2VV5A 1N5YB 3DM2A 3ISPA 4XKWA 4LF6J 4F4KA 2DEJA 2FA5A 4C8ZA 2HMIA 1VR6A 1OCOH 3NWSA 2V8HA 4USKA 1RTHA 2B7BB 3IUOA 3V8JA 4CLKA 1YJRA 2QUFA 3M6UA 4EO8A 4ZVTB 3BKUA 3BROA 1R1UA 2QQBA 2IP2A 1H72C 1A35A 2LQ5A 2R2SA 1S6LA 1W26A 3GFZA 3CLQA 3CDBA 3F44A 3W61A 2VC0A 1U1PA 4K5SA 4XIUA 4KMFA 3LFKA 4Y2KA 4OZLA 3OUYA 3R61A 3KUEA 1ZM2A 4LIVA 1NJXA 2EXUA 4O3SA 4V19X 5KCMA 3JSMB 1N5VA 5E17F 1IKVA 3LWMA 2XKOA 1UW9A 1TQLA 5HMXA 2RNEA 3MCOA 3L00A 4HOBA 2QBYB 1X4OA 3RPQA 2JA8J 2HRUA 5L46A 4CGZA 2Y2ZA 2Y1LB 4L73A 1TKXB 1U2CA 4WXDA 1WJDA 2CV0A 3HDDA 1S97A 4C8OA 1FVQA 2QWWA 2DXEA 1HNWF 1T94A 2J7UA 2HVSA 4M3EA 1S72I 5IP7J 1SIZA 1JLFA 2V6AA 2QLZA 5DG8A 2WB1A 4ZVFA 3NNAA 1Q7LB 4ANDA 4DQPA 3OS0A 3BR8A 4OYWA 3GFIA 5DQIA 3KHGA 1ZR4A 2V67A 4HYKA 3EPZA 2OPTA 2HK2A 4M6YA 1QAJA 1H6KX 3KP2A 2Q66A 3CJKA 3U27A 4IO1A 2FC9A 4B9SA 2GW8A 4NLTA 1NBEB 2DQRA 3ABUA 3BG6A 4DV4J 4M5IA 3DEWA 1Z3XA 4AXJA 3W9HA 3TQNA 4C11B 4DV6F 3MI7X 5J6XA 1GH8A 2AHQA 1K78B 1ZK8A 3ZGKA 1Y39A 1L3TA 3L7WA 1ZGAA 4DV7F 3PZPA 1KA8A 2ACJA 3NS5A 1IXSB 4OYAA 2JA5J 3D9BA 1IBCB 3CE8A 1JLCB 1ZTWA 1T0FA 5LMUJ 1EP4B 3R2CJ 2MH9A 3DLKB 4FBUA 2HFUA 4CH0S 8AT1B 4XRMA 3AHPA 1S49A 3C18A 2UXNA 1RP5A 2L08A 5CD4A 2MLYA 5C25A 4Y3OA 4ED4A 2DCEA 3BZQA 3C6UA 1ZG1A 5AONA 3HTUA 4ZDOA 3DRPB 1YLXA 2HTSA 4ZMMA 3CJ4A 3D6FB 4WCEQ 3MM9B 4FBTA 2FJVA 3IR5B 3DOKA 1EETB 2MC3A 5KK1A 3LH2S 4LF6F 3AL0C 4ZVEA 2HSEB 4D1QA 2NLWA 4DLGA 2M4KA 5FFXA 3N97A 2K4BA 3LAMA 4NLPA 3NGSA 1QZEA 4ZVGA 4Y2AA 1FKPB 4A4JA 1X1PA 4OLOA 3DOMA 2P7VB 1TK0A 5BQTA 4PXDA 5B0EA 1WSUA 4V19J 2JVHA 1D09B 2AEMA 2X1DA 4OZNA 2E1OA 3R5GA 2X48A 3QP5A 3CCLS 2CMPA 4ZOSA 2DHSA 4DEZA 3JYTA 2W9CB 2GGPB 2KYXA 2KLOA 4IKFA 4BLGA 1Y56A 2HHWA 3OBIA 2ZXIA 1WQ2A 3E6BA 1D0XA 3CIMA 3BF4A 4N7TA 4J00A 1H0MA 4UUTA 1HQUA 5AE3A 1JLEA 3TR5A 1U02A 2XAFA 2MXYA 1WOPA 4CT8A 2RSQA 1XPXA 4CYDA 3QAHA 2HS3A 3ENWA 3HGGA 3RRHA 2DISA 3HOZJ 4A0ZA 2LR8A 2L7KA 4B09A 1U49A 3TZZA 4PXCA 3PX0A 1K0VA 3OYEA 3PQKA 3PIPQ 3GZ7A 4K4VA 1MSFC 1MMAA 1MWQA 2AX1A 2CPJA 4KQZA 3W2VA 2H1LA 1RKIA 4XLEA 2V6EA 3S16J 1X8DA 3D1NI 2UXCJ 1QLNA 4CCOA 3VR1A 2Y0MA 4UVCA 2K4JA 3K70C 3I0SA 1SFKA 4BYYA 3AG2H 1HBNA 2NR0A 1IRGA 2IBKA 1T33A 2HGCA 3S3OA 2OPSB 3RYPA 2HVQA 3C2BA 2E1CA 1BOBA 4DV4F 1FNOA 2MZ1A 4MIBA 2B56A 2QJ3A 1R1TA 2UXDJ 4P2FA 2B4PA 1IXCA 5AIPA 3GTOJ 4E7HA 3MEEA 4YIFA 1UHMA 4DSLA 2BKPA 3QFWA 1VQYA 4LFAJ 5KT5A 4R25A 5LMUF 5AXNA 2G0CA 3TYTA 3ZQIA 3IXQA 2Y9YA 1JXEA 5E18F 4IXAA 4JI6J 2HQAA 5J1UA 2W7OA 1YBTA 3UQSA 2KTQA 1PIEA 2VKRA 2Z2LA 2ZOGA 5F3TA 2JL9A 3K2YA 3W3SA 4MKVA 1S7IA 4K59A 4WFBQ 3LP2B 1KYWA 1YE9A 4LFCJ 4EMSA 3CP8A 3A4CA 3VPRA 2WA0A 3BJAA 3HFKA 4LRCA 3M7VA 2I0XA 5DGAA 1S1XB 3ZNJ1 1NB2A 2L41A 3IR6B 3T0YA 4OIRF 1S6PB 5FJ8J 3QMQA 3B02A 1XGOA 2GAUA 4E70A 4IOAQ 3J7YI 1IV8A 1R6VA 2CV2A 5A0YB 1WEZA 4IHYA 3ASNH 1RAFB 3HUGA 2X1CA 1Q53A 1R49A 3P5BP 1Y00A 3EICA 4F0KA 1GK8A 2VE8A 4IDKA 2NXNA 3HLUA 1BW6A 1ZYRF 3Q3SA 1TKTB 1SANA 4BDYA 4BACA 5C24A 2GX8A 1U8RA 1QNTA 1T8IA 4X4NA 4ZC3A 1LFBA 1XN9A 2QLFB 3BC8A 2ESNA 4HF2A 2WB1D 3OYCA 2LRDA 3GTGJ 4DHVA 1Z7LA 1F9EB 1X3WB 3MVPA 1Q79A 1ZHFA 4IFYB 4NWBA 3A8JA 1SH2A 2C3YA 1S6UA 2Z9OA 1J75A 5K8PA 5KOXA 2GVZB 2MQNA 2YU9J 1KDNA 1M1KT 5HQMA 1TKDA 2GXBA 3S15J 3N4WA 2X1GA 1FIPA 4NC6A 3RKWA 5I3QA 4NUBA 2W82A 2DGVA 2ZFWA 1HHSA 3NBPA 2VFTA 1S7HA 2MQLA 2OPQA 1NSAA 2AYMA 2LY9A 1SXLA 4ES1A 1CPZA 5I4MA 2UXCF 1RT7B 1RUNA 1FJCA 4NC8A 1FT9A 3ZRGA 3FBNB 4BBRJ 3CCYA 4HX7A 2FJAB 2J7KA 4H4MA 2VKZG 2NXEA 1XR6A 5GAGU 2KHMA 1FFWB 1BY9A 3CJQB 4P10A 5C2CA 1M5PC 5BYSA 3A3OB 1V5EA 5AXLA 2ELJA 4EK2A 5FGMA 3CULA 1QZYA 5B09A 2H48B 1TKZA 4Z37A 3S8PA 1W5TA 1SMTA 3SFZA 2HFOA 3A1YG 4TYBA 3F8NA 2NRAC 4LFAF 3OYAA 1RDRA 3M8SA 3CJNA 4PSXA 1H7WA 4HRIA 3I5BA 1VCTA 2L4MA 3PJWA 2E1PA 2DNRA 1B1BA 5KFFA 5I3UB 2BQUA 4ECRA 1YLFA 2IT0A 2FUG2 1LW0A 2E66A 5HLHA 2PEXA 4RMNA 1KTQA 3RBEA 2VB6A 1SBRA 2FZGB 4P72A 5CYQB 4PG4A 1CC7A 4LVNP 4ZHRB 2OBPA 4HNTA 1RKJA 1VBXA 2IGKA 3CJ2A 3CC4S 1HI8A 2CUZA 4WU2A 3G86A 4CO4A 1XMQJ 4IG0A 3BREA 2WVCA 3X1LB 3WODF 4NYZA 5HLIA 3OR1B 2MZRA 3KLVA 2O5DA 1U09A 2HDDA 3PACA 2X4HA 1R6RA 4JYAJ 3OIOA 1XJWB 1RSCA 4G65A 2VL8A 3ULHA 4DPUA 1SKUB 1D0EA 1OJLA 2NNYA 2I8DA 2WY8Q 1S59A 3S01A 3BN7A 3QGIA 1DDNA 3KLIA 2CGPA 6FD1A 3BJOA 4ITVA 3DBRB 1TC3C 5E3OA 2HPUA 1B72B 4NXMJ 4L0ZB 5I42A 4H4KA 2V69A 2GJIA 4GO5X 2QYGA 1U47A 1TMJA 1JLAB 4IO9F 2LECA 1O57A 1SJQA 4GC6A 4OMZA 1PBUA 3GXOA 1XERA 1WH7A 5B5EC 3ILLA 4P2MA 1FK9A 5KG2A 1X1AA 4OZ3A 3GFLA 1O0PA 5FKKA 3M2VB 4YR2A 1UMJA 1CJTA 5D0RA 3ZNUA 4L9TA 1VQLI 2MBFA 4FTHA 3S1TA 3ET6B 1WEXA 4ETSA 1P9QC 1R0AA 1GXTA 1FI4A 4KIGA 1WUUA 3MMBB 1TL7A 2OCEA 4YEAA 2RMLA 4LLLA 4YEJA 3KE2A 2F2EA 4ZYGA 2ZUAA 4DR3J 3FKJA 3KJQB 4MTDA 1CULA 1MMSA 4K0KF 2XAQA 2WV0A 3CVKA 4LBPA 5KFNA 5E5NA 3I56I 1Y0HA 3BR1A 4JQFA 2MW8A 1S1WB 3OYHA 3K8WA 4ZLPA 3BGLA 1F5TA 4Y2MA 3MDFA 3CDAA 3C3LA 1BQXA 2HAIA 5KFVA 4F4YA 4F36A 1L3KA 2UUZA 2IPOB 3KG0A 3L1PA 1WF1A 4N41A 1ZBTA 2VN2A 5LEJA 4O44A 4QZVB 5A2QZ 2BW7A 3N28A 5KFEA 4CQ1A 1HCRA 3IRXB 1LEOA 3ISNC 4B02A 1S9FA 2XI2A 2H54B 2XRLA 1F3FA 3AAWB 5KFOA 4PJNA 1SFOJ 2F9DA 3AQPA 4TY9A 3WBZA 1FRKA 3FKBA 3H5AA 3K0LA 3H9QA 3TBIA 1E3HA 2E5GA 4XM3A 3OIPA 1GHCA 4USIA 4C8KA 3ZPLA 3TP0A 2IMOA 4CM2A 2C2EA 1IUJA 1G3TA 5ETKA 3FSXA 1U8BA 4I7FB 2NQPA 2E35A 2ZJRF 3CCMI 2NUHA 1UVKA 3BQYA 4DLEA 2X1EA 3FRYA 3CCVS 1Z4UA 3BSAA 3SSQA 2O3FA 4DFMA 1H7XA 3CJ3A 1MBJA 2IGMA 4YS2A 1O7FA 3CMQA 1U1MA 3FNNA 1OQYA 4BDPA 2DJWA 5KFMA 2DCUB 4HHHA 4MAKA 2JUGA 4TU8A 2OD4A 2AT1B 2BW3B 1JMTA 1BQNA 1HW5A 2P8TA 1C1BA 2E5IA 3WTUC 1FX4A 3EMTA 2V2VA 3TQ1A 3MM7B 1GVDA 1VRUB 2LKSA 1XNQJ 2EC2A 2DY1A 4IFVA 4CNZA 3HSZA 2W48A 2V9KA 3SIPB 2OELA 1HOMA 1KU7A 1L0OC 6AT1B 5CHCB 1ICEB 2Y0SN 3OXFA 1YZ6A 3IM9A 1S1VB 1PAEX 1VNDA 2MDAA 1FDDA 3CDHA 3J80Z 2RIJA 5CAAA 1R43A 4PR6A 1N52B 5C4XJ 2HGNA 3PL8A 4ZP9A 4C8YA 2R7DA 4UTGA 3GR1A 1N88A 3VSKA 1T05A 2EG2A 3TJ8A 4NXMF 4CLWA 5M2UA 2B9WA 1BQMA 3PYDA 4NLWA 2I2YA 3QOEA 1NK3P 3OOUA 1FDNA 5K5MA 2QSHX 4WYWA 3M8RA 1NZAA 3IMQJ 2GHVC 4OI0A 3BGFA 5M5XJ 3FHZA 3PR4A 1ITYA 1QSSA 3H3VK 3H5SA 4BC9A 1RTIA 2C2MB 2PN6A 4DR1F 5F64A 2LTPA 3GJRB 1R0BG 3EUHC 4NYPA 3SFGA 4A6DA 4DR3F 2FOKA 2CQ1A 1LNQA 1RQ0A 4I2QA 1YITS 4KIBA 2CFXA 2ZH2A 2ZFHA 5F0UA 2XZDB 5E3RA 4WF9Q 2O3DA 4ES2A 2MGZB 1FP1D 2MSYA 3RI4A 2HKOA 3GZ5A 4ICLA 2LLZA 1FKAF 1J5OB 1AFJA 3Q23A 4U88A 1SH0A 2J5PA 2CQ3A 1VQPI 1T11A 3F56A 1HARA 4BS2A 5ICGA 4DPXA 5IC6B 2VICA 2V6CA 3ZZUA 4JYKA 3HXMA 3ZMDA 2A2DA 4XPCA 1VQNI 2BOAA 5IM0B 2QMUB 4ECYA 2UZKA 1X1BA 3LPEA 2GWRA 3M8JA 3JRIA 2FLPA 2DN0A 3CCJI 3WU1B 3OOPA 4G7HF 3JQKA 3GFXA 1IR1A 4ZVPB 4CTAA 1EA3A 2JSCA 1YHQS 4KR0B 1MNMC 4RLFA 3F8BA 3G8TA 3PVXA 2XF5A 2P7CB 4Q7AA 3DPTA 2BVZA 3ZN0A 3OFFA 4JUZA 1VC6A 1PKUA 4JV2A 2H4YB 3H8YA 3M1VA 2BY0A 1E6VB 2N3OA 1SC6A 4R8UA 4LLNA 2HQGA 2KIMA 3AODA 1OPCA 4XDDA 4DSFA 2Z99A 1JIHA 2FGCA 2MKIA 4CO5A 1Y5LB 5G0RB 2BW2A 2H94A 4LK1F 3RRKA 4GXOA 3P8BB 2UUBJ 1B4AA 1MW7A 2QL5B 5EF6A 5ETQA 2X9DA 1MBFA 2QT7A 3L7PA 4KDPA 2G2YA 2E1AA 3JSRA 1Z67A 2AXLA 1XNQF 5KFPA 1EJ9A 3PX6A 3RU0A 2HWTA 3V81A 4IQXA 2OJ3A 3SSSA 3R7BB 1RHJB 2H09A 3KLGB 3JRAA 2HNZB 4LR7A 5I3PA 2DR5A 4PJLA 2R92J 1Q5VA 1AU7A 1VLOA 4B8XA 4PKDB 1B8IB 1P27B 3OR2A 2VA3A 4RU9A 4NA1A 5KFIA 5E20A 1Y8RB 2IBOA 1NPRA 4OL8A 4ZK7M 3DM2B 1TBXA 1YOVB 1X5OA 1T9UA 1J2XA 1FBUA 2K9LA 4ETZA 1U4BA 3T8TA 2GXGA 4DZPA 2LDYA 2MQQA 4A48A 2IM2A 1TAUA 1ETKA 4XTTA 2EFNA 1HMVA 3HPGA 1RTHB 3HRMA 2DPDA 4BJ5C 2DGWA 3PO5A 3DBHB 5KFWA 2PFFB 3C6TA 4DCJB 5ADZA 2CPFA 2KKHA 3L2RA 3K1NA 3R5BA 2XM3A 5K7FA 1F9FA 3PEHA 4Q2MA 1FRHA 3R1LA 3O3KA 2QENA 4DW6A 2W2PP 2M5WA 2KXFA 3LALA 1S0OA 3AAFA 5A76A 4XDCA 3EGWB 4A8WA 3BDDA 3OUYB 1Z05A 3ZZPA 2JRTA 1IKVB 4WXOA 2NPIA 5BXIA 1SFUA 2BXZA 2OHDA 3K6GA 2LLKA 3T9ZA 3ERMA 2LA6A 1M5KC 4KFBA 3K0JA 2CUYA 1VI7A 1I1GA 3P96A 3OFHA 2BBEA 2HHTA 3NCPA 2OC6A 3O6BB 4GYIA 3GPAA 3PEJA 5D77A 4ED0A 3HRSA 3G3ZA 3KDNA 4GO7X 4D9JA 1RPWA 4G7ZF 5D4LA 2KDZA 1WC1A 1JLFB 1ON1A 4N8OA 1HA1A 1U25A 2FMLA 4N4OB 4J9OA 3JW4A 4FP9A 2ZXWH 2CJ9A 2MZQA 1IRZA 2DT7B 2QEXS 4M9SA 2HGLA 1XMKA 3ZQLA 4NMXA 3MR3A 3OR1C 5E2QA 2CPHA 3OSFA 4JBAA 3LO3A 1AZSA 1SJ1A 3CJKB 4NNJA 4XKVA 2XGXA 5CA5A 2LF8A 3SJMA 4BUPA 2OD5A 3PYGA 4UQGA 2B4VA 4B3SJ 4LFBF 5LXYA 4MH8A 2Q0OA 2RAQA 3P4UB 5F8GA 1FSEA 1GXLA 4PFPA 2EIKH 3QSIA 2RT3A 4HL9A 1J0RA 1SV5A 4A3DJ 4PG6A 5E0OA 2J0SD 2UUBF 1XMXA 5IQQA 1FESA 1VQSA 4PGGA 1BE4A 2UUAJ 5C25B 3QT5A 1R5GA 2B9SA 4H4OA 1IJWC 2LQ8A 3C6UB 3K1MA 1RR8C 2ZJ2A 1FNNA 4MEXF 1B0PA 3LA7A 4LF2A 2BVLA 3ZO7A 3OQ2A 3T8RA 3ZTSA 1VQMS 3RTRA 2FRHA 3DOKB 3HC7A 4ZDNA 4U95A 1QTMA 4EJOA 4OHWA 2ZNZA 3FZBA 4HNUA 2VJVA 1NHUA 3I5CA 2AYBA 3RG6A 4XLNF 4P7TA 4CO8A 3NAUA 4WXHA 4PUSA 1JTXA 1IZ1A 3DPLC 1RWXB 2V2ZA 4I09A 4ZJOA 2HOSA 3GVAA 3DOMB 3GJTB 2C22A 2IPQX 4YRVA 3D0IE 2MA3A 3KLEA 2HFZA 4ZPCA 4RS8A 3CJ8A 3KJFB 4LSNA 4UY8T 2D3O1 3D54A 3BR2A 4C3HJ 1K6OA 2W8LA 5J3LA 2CS3A 2JA7J 1SJ4P 2M3DA 5CYMA 4EO6A 3JYTB 3ABTA 4J9NA 1JLQB 5J2MA 3D0HE 3VOEA 4GKJJ 4Q45A 2YNGA 1HKQA 1OCRH 2AD9A 2QLBB 2AP6A 1ON2A 3D4JA 1HQUB 1JLEB 2YBVA 4M74A 1FKOB 2HK3A 2FNPA 4A8QA 4L9NA 1JHFA 3ITHA 5LJ5Y 4USUA 2G1DA 4B9LA 3CCES 3Q89A 3HOYJ 1QAXA 1HC8A 3WGGA 1WHWA 3HVTB 2F8MA 1X5TA 2AJQA 2V79A 2R93J 4C3LA 3W2VB 1U8WA 1R8CA 2A68F 1BUXA 3H42A 1NYNA 2QRRA 3GTLJ 3R6LB 2XB2D 4GDFA 3F6VA 1F3VA 4OZ5A 1VJQA 1QD1A 1FRXA 2KJWA 4M5GA 5D4RA 3I0SB 5FKNA 2HHHJ 4EATA 4DIQA 2MHNA 1XMBA 2V5HG 2UVRA 1VHFA 4YFXF 1HBNB 1H73A 2W1OA 4YB6A 1RIOH 1EH6A 2KT3A 4PQUA 5LSOA 2ID3A 5B0CA 3H40A 4B3SF 3BZKA 2AJ0A 1DP7P 2K27A 4HF1A 1X9WA 4BQQA 4FPRA 3K7AJ 3MEEB 4C9DA 2DA6A 4QJVA 3UDLA 5A8WA 3FCVA 2PBIA 4G7OF 3A0BC 2HAFA 2OQGA 4CYCA 3GMGA 3GTYX 1TWAJ 2TCTA 4GRIA 4B9NA 3P9IA 4AC0A 4ASNA 1Q0NA 2CPEA 3MQ0A 2UUAF 1W7PA 3PFYA 1POGA 3MZIA 2FHJD 1IUYA 4F3OA 3KPHA 3SZTA 4G1QA 1BI1A 2DOAA 1U1QA 1S76D 2JWTA 1NK8A 1PYTA 2R8KA 2ZJPQ 1ZREA 3W8PA 3WQPA 2P6SA 2AMCB 5J1YA 3W5ZA 3NWRA 2WVDA 4Y0FA 3JTNA 3MUVP 3PW0A 1SB6A 1GFWB 4X64J 2OTLS 1NK0A 4LT6A 2C2KB 1F2GA 2ZWPA 1YJWI 2XY6A 4GFBA 4J9MA 2NS0A 3H36A 1APSA 4QIFA 2Y48A 3MAAA 4YMEA 1O8BA 2XPUA 3W8GA 2DFEA 3PUBA 2BV6A 3A8EA 1F36A 1NG6A 3H3ZA 4IDKB 4UOGA 1T98A 2NXNB 2K86A 3I0TA 1HA8A 2ZITA 3GTMJ 3TW0A 5ED4A 3DKXA 4OYOA 3FMQA 1ZR2A 1S7EA 2RU3A 1NDCA 3TUIC 1U1RA 2Q1ZB 5C24B 1XDUA 4XOPA 1GMVA 3NQOA 2ZE2A 2R7TA 5DTDA 1FE0A 1TELA 2CRGA 1ETVA 4GKJF 5D0HA 1Q78A 3PYFA 1NM2A 2HIQA 4OYZA 3GFYA 4K4UA 2BJ7A 3OSPA 1WGXA 4LG0A 4X4TA 1RWVB 2ADCA 3IL2A 5EGOA 4OIOF 3ZTRA 5LMNJ 4HQEA 4G1PA 5C42A 3GO5A 1YQAA 2V26A 2JC1A 1KQSR 3TO6A 1UWAA 4B3XA 5GAGI 4JP8A 2LP4A 3A0HC 3HHLA 3NGRA 2OCCH 3NBPB 3V6KA 1X60A 2OPQB 3R5CA 3NGTA 2L4AA 5GAHU 5GPCA 3ECOA 4J9QA 4IL6C 1AHDP 4BU2A 2NS7A 4IPAA 3PJRA 2PD1A 1TV6A 4ZPWR 5FFZA 4DV2J 4ZN1A 1D1CA 2DJIA 2CNKB 2Y0SA 1UHWA 2RKHA 1MH3A 4E7KA 1FD2A 3CMAS 2PG4A 3Q0VA 2F4MB 4P9SA 4H4MB 4MO7A 3PUFA 1HIYA 2HHHF 3F21A 4KGVB 3MCMA 2YSRA 2RQ4A 3EUNA 1BR4A 2CNNB 4XBFA 1T38A 1F0XA 3AXMA 4NMLA 2O01C 4RBTA 3CF2A 4JI1J 5CH7B 4J9RA 4A12A 1YTYA 2XYHB 2NAZA 1OCCH 5DDQC 1TKZB 2NZCA 3R3TA 2WV1A 3KTQA 1A6LA 3MMAA 4OIXA 2KM8B 4HLBA 2QSWA 2HW3A 1UJ6A 4IEJA 2M8EA 2DPIA 4RWXA 2PC6A 3R6SA 3HFZB 1K1QA 1DQ9A 2OEKA 1NNDA 1FO1A 2HDWA 2H5JB 2MC4A 1R8BA 4OQJA 2HFNA 2ATLA 2BDPA 2V68A 2BQRA 2KRRA 1LW0B 4KT5C 4RGSA 1R27B 4AWXB 6FDRA 2XSDC 3H90A 3HD2A 4FVMA 3DMJA 3HDSA 1L3SA 3BO4A 2DTRA 1M1HA 3I64A 3EE3A 4M3FA 4I02A 3WTXC 1C1CA 1X3ZB 3OYNA 3BSNA 3JRDA 3BJYA 2MQMA 1K79A 1HW1A 1U1KA 3M30A 2XAUA 1JQGA 3UCGA 4PQAA 5T14A 4LF4J 2F4OB 5BMZA 1Q81T 2P5KA 1EH7A 2STWA 3C16A 1KU9A 5JLWA 1FJGF 1U78A 2IAIA 2BR0A 2A6OA 4P55A 5HROA 5SZTA 3LA0A 2W4DA 3G4SS 2IVFB 5L1IA 3T5LA 1MSWD 1TK8A 2PT0A 1LKZA 2H5EA 5A8KA 4MIMA 2A18A 4MFEA 2KU7A 4OZJA 1G59A 3E97A 4UXNA 5DQGA 4C8LA 1SKSA 5I42B 4UQTA 2FJ1A 1IR0A 2ZSHB 4A5MA 4ATNA 2ZBIA 4LMZA 2IA0A 1FK9B 2GS8A 1RWOB 1S77D 4X62J 1CJTB 4OJ3A 4DX5A 4I01A 3RQ4A 1YDLA 3QAEA 1UVJA 3HZEA 4M5JA 1BHNA 3ZTOA 1R0AB 4B3TJ 1JJ4A 2DHHA 1TL7B 1WZ2A 3DEEA 1G3SA 3H4BA 1UP1A 2FVPA 2RAEA 3MMYB 4MYTA 4NEYA 1IF1A 1CULB 3D68A 4AQYF 4WKYA 5LHHA 4IRGA 1FVSA 4DV2F 3ABMH 3O2IA 1QJHA 1TWHJ 1TL8A 3D67A 4ALZA 4DR5J 2WTFA 3TEHB 3JQJA 2ALZA 3TL4X 1KQ8A 1E3OC 5D15A 2QGUA 1RAEB 2DIVA 5HS8A 2BE9B 2CQBA 3KZIC 2NVXJ 2QO3A 4O44B 1W7PD 4LREA 3HKWA 3ZMUA 4G6TB 2DR9A 5DRKA 1FMVA 2JEJA 1X58A 1CLFA 1IKWA 1V6HA 2JA6J 1S48A 1HXDA 3NS6A 2KRFA 3OYMA 1FNMA 1RISA 3K5NA 1SJ3P 2DD8S 2W9AA 2X6OA 3KZYA 2NVQJ 1BOAA 1Y9OA 1A7GE 4UUXA 3S1NJ 4C98A 2A69F 2XY7A 7AT1B 1G3OA 2DFIA 2XZWA 5F08A 3E3VA 1OSDA 4YHHF 3L3CA 4ZCKA 1IN7A 2FOWA 2WB4A 1FWZA 3OFEA 1T9YA 3K7RA 5ETSA 3TUJC 1U2WA 3D5RC 3P9KA 3TAMA 4YDXA 3TGNA 4EI2A 2MHEA 3F22A 3KJVA 3GFMA 2CQNA 1Y11A 1MIJA 3FUYA 1G2EA 4L9JA 1UVMA 4HT7A 2VPLA 3B54A 1ZA1B 5IT9Y 1BQNB 2M8HA 2APOA 1C1BB 1JKHA 3BQ1A 3TAPA 1R58A 4HX4A 4CZZA 1KLMB 1ZETA 4RW6A 4DR6J 4AIHA 4L76A 3TW6A 2PMUA 4IFVB 1Z7UA 4MK8A 4ELTA 2DRAA 2H5IB 2UV1A 4NI2A 4CO2A 3W6VA 2F8HA 2H27A 1EH8A 2FD5A 3LA2A 3DLGA 4JB8B 4O3RA 4O3MA 2HZDA 1YGYA 2LY2A 2VL1A 5AIQA 1RA7A 1ZN2A 4DFKA 4P96A 2M0GB 3E01A 1SMYF 1IJEB 4I68A 4KUMA 1I94J 1KVJA 2GZWA 3MKWB 3A03A 3AOAA 3PFEA 1X4AA 1T05B 1N4LA 4XN3A 3DDNA 3LF0A 2OQRA 5EG0A 1Y10A 2AJFE 1K61A 2Y0SD 5HDGA 1BQMB 3K5OA 2R7ZJ 1MJ9A 1UJ8A 4F4AA 3MEXA 2EZLA 4X62F 4QIVA 3LSTA 2MLGA 3K4NA 2Y0BB 3BPXA 1RTIB 3RRGA 2VG7A 1N33J 4FS1A 1AUDA 1V3ZA 1U0JA 4O0NA 3GV7B 2R42A 3IC7A 1NLKL 4F91B 1FOXA 2FX0A 1CS4A 5IYDJ 4I2QB 1R1VA 4Y2CA 1WI3A 4EJTA 4DR4F 3V8LA 4ED5A 5KFLA 4DR5F 3CD0A 2YKPA 1FSHA 2IA2A 4ICLB 3KLOA 5ETVA 4L5JA 3M3YJ 3FFIA 2XG8A 4KHMA 3M1EA 5F27A 3NGUA 1WC4A 1B64A 3IKTA 3DU5A 2KPMA 2NZ4A 1RJJA 2PEHA 2VKDA 1TU0B 3IWZA 3RGIA 4MJKA 3H5YA 2A5WA 1FYLA 1NDKA 1LKXA 5DM7F 1RE1B 2XAGA 2L9RA 1C4AA 1ETXA 5JMNA 4RGXA 2LC2A 4LF5J 1TW2A 3TP3A 2LREA 1Z2LA 2F48A 4CTAB 1SD4A 2XQCA 3CZ6A 4QCLA 3ZN1A 2ZM6F 3QYBA 4ITSA 5K8MA 1KZHA 4U9RA 4RUCA 2OPRA 3LSIA 5ETPA 3RCOA 3M32B 2AGPA 2L7ZA 4FCYA 3Q8QB 3MUMP 2E5NA 4Y52J 3M1VB 1FX2A 2RILA 1KR4A 3AFGA 2P81A 2B7EA 4R8UB 4AIKA 3QO9A 4NCBA 2BKNA 2WAEA 2VXDA 4XL9A 4DZDA 1LOUA 1LFUP 5JHUA 4NRTA 2MPUA 4OJHA 3MF5A 3N6MA 2WBMA 2B5JA 3CCRS 3S2WA 3MFHA 2Q2EA 2MFZA 1BLUA 4WJBA 4KHPJ 2VBZA 2AQ4A 4KHRA 1JB0C 2VODA 1PAUB 4B44A 4ZCLA 3AJ2A 4NL5A 5TJJA 4XONA 2HQDA 4XO0A 2CADA 3V81B 2DOEA 2GVDA 1CQTA 4OMYA 2L9DA 1EQ0A 3QIPA 2W25A 2DO4A 2IY5B 2HWVA 2AW0A 1VQ5I 1FXDA 3OR2B 2L7MP 3GB0A 1H88C 1K8AT 2HQCA 5FB2A 1IBKJ 1SFEA 3GZ6A 3CC4I 2QQ9A 1QAYA 1I94F 1T3OA 2V1NA 1T39A 3ILOA 8ATCB 2FD2A 3VAFA 1BXNA 4RU2A 2ZBCA 4A8KA 2UP1A 2MJUA 5EEHA 5LHGA 1HMVB 3NKYA 2DHAA 1Y3JA 2ZCWA 3IWLA 3C6TB 4DUZJ 3HYIA 1ULYA 4RB0A 5F1RA 2E29A 4FF4A 4A8MP 2PMZN 4V19K 3SDBA 3P3DA 4WFYA 4X65F 1XGNA 2XMAA 2DR7A 4OYMA 2DA7A 1DPRA 5KFDA 5K9FA 3W2AA 4NBQA 4C0HA 4AVZA 3HHHA 2F7VA 2D1HA 2MB0B 3GSDA 2KM8C 1JUPA 4DF8A 4ESFA 2JH3A 1O6XA 4WK3A 4P73A 3JTOA 4DUYJ 2CDRB 3K4MA 3C14A 2WW8A 1BWVA 4QU6A 4U8VA 3J7Z5 4HA8A 4ZN3A 2OAUA 1DGRM 1KU3A 2YQ1A 1T8EA 3KLNA 2EKNA 2VD3A 5HNFA 2R8JA 2LYVA 2L01A 3PKMA 2VC1A 1URRA 3NMRA 3MEGA 4NCAA 2FLNA 2UU9J 3OTBA 5E3AA 2W2NP 3QGGA 2CPYA 5H20A 1JXVA 3U7JA 1KEKA 2LH9A 1HKSA 1VQKS 1CF7A 1USTA 2LCWA 4LF5F 4DX6A 2HKEA 2W4CA 3K58A 3K2AA 4DN9A 2QQAA 4DR2F 1T95A 1D1BA 2JQ7A 3TZYA 2WVBA 3S1QJ 4QQBA 1GV2A 3OTEA 1U9NA 2IW5A 1T9TA 3HSDA 1XNRF 3BG7A 5FKLA 1FOKA 1CG2A 4P71A 5FD1A 1B3TA 4I4BA 2KRHA 3W5YA 1F2HA 2WOMA 2COLA 4ENMA 3O8WA 2E5ZA 5J1EA 1RKTA 2VJJA 1SV5B 4QYZJ 4KHPF 1EF4A 2LY1A 5JVGQ 1Z1DA 3PNVA 4I7HA 3SV3A 5CD4H 3GLLA 2GOMA 1S6OA 4H4KC 1S5LC 1GMWA 3ZCOA 3IFEA 5KFHA 1QHHD 5KVRA 4MK7A 3H0DA 5J2PA 4F3MA 4PRFA 2NPFA 2XPWA 1N75A 5LRSA 1N25A 1OR7A 2W2MP 2QG9B 4H4OB 3Q86A 4XAKA 4P9FA 1Q4RA 2K1RA 5KFJA 2CRLA 3CCVI 5TISC 2N82B 1RB0A 2B4UA 1FYMA 1JT0A 1M1GA 2DHGA 3OXGA 4K8RA 2XROA 5LL6d 1DRZA 4FT8A 5ICFA 4ZLJA 1VQLS 1UW4A 2CVEA 1IBLJ 1WHYA 3WZ0A 2ALYB 3J7AO 3M6XA 4QWEA 3BBBA 3BB5A 3T1AA 2WAFA 2HQ3A 2R7FA 4OV6A 4CLZA 1RC9A 4P75A 1Z2ZA 4U6PA 1PBAA 3EGZA 4DUZF 4ZVQB 1YX3A 3V6HA 3W64A 5E7OB 3KLEB 3JAMZ 3B6AA 4LSNB 4PZJA 4OYPA 1WHXA 1BM9A 2YY3A 2I5JA 2FC8A 7FD1A 3BR5A 4NE9C 5LT5A 3THPA 5CYMB 3Q8UA 1YI2I 1C2PA 2B0GA 3VWSA 4R0JA 5J2MB 5DZ6A 1HLVA 1HFEL 2YNGB 1M5SA 4DUYF 2XVCA 4IRHA 4L6V3 1T08B 3V7SA 5JVHQ 2BHZA 2HZAA 9ATCB 4B1RA 3H2LA 3NCQA 1KYZA 5B0GA 3O8HA 2VONA 4CICA 3ITHB 1ORKA 3VQTA 2VXZA 1A0OB 2WSEC 2CPZA 2RF2A 1HW9A 2HXIA 2YNIA 1GV5A 2UU9F 3FISA 2DBBA 2NS8A 1DU6A 3BQ0A 3KKFA 3QGHA 3ZR8X 5HMYA 4EYIB 4NZ6A 3GE9A 1H74A 4FASD 2VQGA 4CP5A 2PLYA 1N54B 4OJGA 2VKEA 3RB4A 4HDGA 1LEAA 2IC3A 1H3DA 1HNZJ 2QGFB 1KGSA 2F5FA 4HTJA 3R2DJ 5FKOA 3K9TA 1R5HA 3AJ1A 1XMAA 5IV3A 3OHAA 4B48A 2KZMA 2IDLA 4ZKAA 3ECHA 3R9LA 2ISYA 2V1UA 5DETA 2PI0A 4KJZA 1OQ3A 1R4NB 3A4TA 2OEJA 4I98B 1O3TA 3BQ2A 1BC8C 1FPQA 1RAOA 1FRJA 4EJUA 4LF1A 3AXKA 1T9XA 2GHWA 4DDFA 2V7FA 1FTRA 4MKYA 2UXBJ 3L9ZA 1TUVA 2IRUA 3M8YA 3CUQA 4F92B 1FJLA 1YHQI 5A8WB 3AA8A 3DHWC 4CYCB 2DJNA 2O1PA 3QQAA 1H0HB 4O3OA 2X6WA 2YPZA 2P9GA 4WZMA 1W7PB 2B6AA 3CNQP 1J27A 1DJ0A 2CW8A 2ZB9A 2WWYA 1FJ7A 4XRSA 2XTJP 1WJ9A 4Q5SF 4G1QB 3MCSA 4HTIA 1M1EB 2C1EB 1H2VZ 3ZQCA 3R1HA 1D8ZA 3JTPA 5E3LA 2VIHA 2WVEA 4L72B 3KEYA 2XMTA 4CDIA 2EBEA 2R7UA 2BY1A 4DGWB 1Y4ZB 5D0GA 2VJ4A 2K3FA 3LQRA 3G6ES 5D5WB 4UB8C 2CYYA 1IWGA 2D2WA 5JHFA 2L5QA 1TNTA 5EEGA 2RDIA 3U9GA 1IBLF 4LJMA 3NWTA 1ZA2B 3G6VA 1YZ7A 2HQIA 4BCAA 4W98A 4JV5F 2J6UA 3BGUA 3MAAB 4RNNA 4D7MA 4WWCA 3GCMA 3KYDB 1GNKA 2FHKA 4ON0A 4DOZA 2DYRH 1CVJA 4L75A 1LWCA 1IGNA 3RKXA 1IWAA 3BGRA 2HS4A 1I5OB 4WFNQ 4CNYA 2ZE2B 2ZZMA 1J2VA 3JSPA 5LM7E 1VRQC 3EYIA 2M8DB 1VQPS 4URGA 2X1FA 3FJ2A 4OI4A 4EVIA 3J7AY 4RUAA 2UV8G 1T03A 2OU2A 1IBMJ 2XSJA 3OLBA 4DBQA 2GA1A 4PPZA 1VQNS 1QDUB 4CM0A 3UW1A 1KRPA 4LG0B 1EKSA 1W2BR 5EGOB 3A01A 1SVMA 2I6WA 4LJZF 3IR7B 3CCJS 5C42B 1CQMA 3N5FA 4G6QA 1I5ZA 3HPOA 4MYUA 3DFEA 5E3QA 3BTIA 4RPFA 1S7AA 3OYIA 4AYBN 2V34A 2FQ4A 4A8OA 4C4WA 1EARA 2DTJA 1UVLA 1ZG5A 5F41A 5GAEJ 5D5VB 5ETRA 5EDWA 1QBJA 5HLGA 1TV6B 2VFVA 2K02A 1KFDA 2DB1A 3BPSP 1H9GA 4CUGA 1HNZF 4DSKA 1GMWD 3VQSA 2D7SA 2OSRA 4ES3A 1DPUA 1WF2A 1WSVA 1L3VA 3OVBA 2YPYA 2R7VA 3KK1A 2HYFA 1RTJA 2M5YA 5JUMA 2MY8A 3J81j 2L9SA 3OR2C 1R9TJ 3PSFA 4WBFA 5DG9A 3I4NJ 1MBEA 3TEDA 1TWFJ 3FBCA 3EDRB 2OFHX 1JUMA 3GIJA 2COBA 3UVJA 2UXBF 3MR2A 2WSCC 3MMAB 3UCZP 2QEXI 2OMLA 1KHVA 4M9XA 2RUSA 2HHVA 2YWKA 3GILA 5ITHA 4RB1A 5KT4A 3LSRA 2ASYA 3E5QA 1QY7A 5H1SV 2I8EA 2NUUG 3GTQJ 1VQ8I 5FLXK 2VQLA 2JWNA 2ZBQA 2CUJA 1O51A 3DMJB 3HVRA 1GXPA 3U21A 2GIQA 4F2SA 3IH4A 3JTHA 1TW3A 1C1CB 1R6YA 5FLXU 2R7RA 3I82A 2I5UA 2AGOA 1SC3B 3M4OJ 3GBGA 3ML6A 4RUBA 2CQDA 3M30B 2EB7A 3CESA 4O23A 2PE8A 1WOSA 3Q22A 1I27A 3BN4A 3C16B 3SFUA 3H5XA 1X9SA 1XK8A 3HSFA 3TO9A 2X51A 2WBRA 4ZPVR 5FLVA 4WU3A 5HROB 2ECBA 2E34A 3IS9A 4WK8F 4LB5A 2GO8A 4TLQA 1VQMI 2IBDA 1YYVA 2P5VA 1N32F 5A8KB 3KDOA 3S2HJ 2IYIA 4O4GA 1ZTTA 1NUEA 2DNPA 2ESHA 4A3MJ 1IBMF 3CO9A 1PJ5A 3H2UB 1TTHB 4CWBA 3QATA 4A69C 1F9HA 2STTA 5BR8J 2OZ6A 4CRJA 5GADU 2BYCA 3LAPA 2CPDA 1TR0A 2IAJA 5FROA 1RYRA 2R2UA 2M7BA 4ZYEA 4XLAA 2DA1A 2R7WA 3DP7A 2D3OR 4WP8A 1ENHA 3FZ2A 3L2WA 4KFCA 4RL1A 4I99C 1VIOA 3Q83A 2ECCA 5EWEA 2YXLA 4F04B 1YW7A 2F4IA 3SYZA 2HU9A 4KNYA 1QGPA 2YNHA 4DS4A 4HPQA 4YB7A 3OYJA 1MGTA 4RLQA 4OMFG 4KISA 2O03A 3N79A 2A6MA 3S1RJ 4B43A 1OIAA 2PDAA 3LW5C 1RZ4A 1S8NA 2HNYA 2HNDA 4QOTA 3EYZA 3QQCD 1EB0A 4NLSA 5D5UB 3BZ6A 1TL1B 3HVAA 5CZXA 5JLXA 1RHUB 3CCEI 4NYOA 3SCLE 1IN0A 4DQ2A 2MKHA 3V6JA 2MLKA 3ZQ7A 1IKWB 3LWLA 1VRTA 5F1JA 1KFSA 1WKKA 4J01A 4OV1A 4JX4A 3OYLA 3I55I 1F60B 5ERIA 3KETA 2PMZA 1RWNB 2HWIA 2F4VJ 4K4TA 1ZTRA 1NPPA 1OYYA 1FBQA 2GIZA 1XQIA 1IXKA 1NK9A 2M0CA 4ZP8A 3BKFA 2Q43A 3Q2SC 3HTSB 1YRUA 4ZZLA 4HH0A 1Z91A 3W2WA 2W9BA 2CJYB 1YBAA 3ELKA 1IR2A 1V3SA 1B4SA 3IGNA 4AL5A 2Y1IA 2HI3A 3EZ5A 4JBCA 3OWTA 2EFGA 4LB6B 4DV5J 1RLCL 1RR7A 3KJVB 2AKWB 2YR2A 1NO8A 4J9KA 3M1CA 3H2VE 2QL9B 2ZH9A 2NYHA 3PW5A 3PY8A 3RW7A 1JKHB 1SC4B 4DSIA 1U0SA 2CQPA 3G9CA 2ROEA 2LP0A 1YRTA 4Q43A 4I2PA 4RW6B 2I9SA 4UW2A 4KGZB 3H20A 2BXYA 1V4RA 4GMKA 2V4RA 1P7IA 3RR8A 2LQJA 5KFZA 1UG0A 3LSJA 1RRJA 4XKBA 4D0PA 3DLGB 3CCSI 1D0ZA 1EKEA 1YQHA 2FJDB 3D2WA 4LITA 1BWEA 1BR1A 1UEKA 1ZARA 5L3DA 2QSGX 3E01B 1SVDA 4KH1B 3GW2A 5J1NA 4DJBA 2DVIA 2K3KA 3HIFA 4WE1A 1J5YA 4DX8H 3HT3A 2OJED 2HYGD 4KIFA 2KMUA 1QPIA 1PYVA 3HHKA 2HIYA 2D74B 5J4YA 5EG0B 3NOCA 4KSEB 4K4SA 5BR8F 1A6QA 2DODA 3IAS2 2C2RA 2IEKA 5CVVA 3IM8A 4UOFA 3QJJA 4M94A 1SPBP 3KG1A 2WHOA 2WC2A 3IBWA 1MROA 3RZAA 5EGYA 3TUZC 3LUYA 3F8MA 2VG7B 1JUSA 2RJZA 3L2VA 4S0MA 3UI3A 1CJVA 4N76A 4F4ZA 3L2QA 4XLFA 3TOAA 2VKHA 2CWKA 4QYRA 1D0YA 3UD3P 3MFKA 2P6TA 1CS4B 2CW7A 4RGRA 1FTZA 2IRFG 2P9EA 2R4GA 2HVHA 4NDLA 2Z33A 3EWGA 3W65A 2PIIA 2CZ9A 4B08A 1KBRA 1YVFA 2MMYA 5SUHA 3K57A 3RYRA 2BACA 4ZPDA 3E8OA 5TGTA 3RKYA 3FFIB 3X3UA 5E3NA 3I4HX 5MLCV 1BJAA 4FYYB 1NDPA 2EFVA 3LOUA 4NCGA 1OYIA 3HBLA 2IJNA 1RT3A 2CQQA 1BA5A 1ZAWA 3H5NA 3GZNB 3I71A 3QPTA 2ZHOA 3ASOH 3GFHA 3GV5B 2ZHBA 3QOPA 4IUFA 2BY3A 2ZJQQ 4QIWD 3E51A 1U1OA 2NXCA 5KFGA 2F4VF 2CJKA 2XMMA 1S6QA 3H5UA 1RAJA 2ZBPA 3N05A 2WTEA 2CW0F 2ILYA 1KKHA 4FE7A 2BEOA 4OAYA 2CQCA 2OPRB 3UCUP 1N48A 3TUPA 2QYOA 1XMOJ 2JN6A 1TP4A 4BEHA 3QO9B 1YJWS 2K5CA 3BG9A 2K8GA 1K73T 4JX5A 2HHUA 3FSIA 4KV8A 4DV5F 5HATA 2DK5A 1LVKA 2B5JB 1IKXA 1Z0XA 2AZ1A 3CUNA 1R71A 1FYKA 2Q1LA 9ANTA 2JVGA 4RBOA 2RQPA 4OX9J 4DYQA 3DHXA 1U3EM 1YJTA 4YR3A 2RRNA 3IGVA 5JVGF 4F0HA 3GG1A 4Y2IA 5DYMA 1KVKA 2KJBA 4HHJA 4U8YA 3OL7A 2A07F 4NZ0A 3GV8B 4W92B 2DH9A 2E1RA 2LF7A 1T7PA 1XC5A 2GOXB 1M5HA 3OTCA 5DG7A 3G73A 1ZQ3P 4EUVA 5DM6F 4QWDA 1OWXA 4BHPA 1VK3A 1TUWA 3ERED 2ZUGA 3BTLA 1RWPB 5DCMA 2CQXA 4E4HA 4USVA 2DAOA 3LOCA 1XSDA 2PFBA 1Q1KA 1WF0A 1XSXA 3KMSA 3CWJA 3V6DA 4UF4A 1G7CB 3EETA 3HVWA 4QWAA 2ZC4A 1FFGB 1HW2A 2RREA 5BYQA 1C0TB 3VGSA 3G1MA 4PCQA 3G4SI 4I6WA 4MFBB 2M45A 3E3XA 4TU7A 1ZGWA 5IT9Z 2HFVA 2FDNA 2DMQA 1ROFA 1RT2A 1XG1A 1X3UA 2I10A 2IVYA 2Y69H 2QA2A 5T7LA 4CO3A 1A5JA 1WJFA 4EQQA 2X1BA 4IRDA 1X31C 4U0YA 5HMWA 1OPIA 1MN9A 2A3SA 1T0TV 5ETLA 2PMZD 4J5OA 4C6AA 3C14B 4ECTA 5AE2A 5HJYA 4FXWA 1WC0A 3MECA 1D3YA 3OYDA 2XV4S 5IC4B 2JVOA 4ZVUB 4LF9J 2MQ8A 4II3A 5KFBA 4RAGA 2VOOA 4N9HA 3BR9A 2ZKZA 4QSHA 2PSZA 1GAOA 4I1TA 3MEGB 5F8NA 1R89A 4K4ZA 3FQKA 4UZCA 3LNQA 2E9ZA 5H9EJ 1NTCA 5KT7A 2BABA 3DI6B 4DG1A 1TVRA 4M5DA 1N77A 4W97A 3CTAA 3ILJA 1OY6A 1BI0A 1YIJS 1UZCA 1CF7B 4MK9A 2A05A 5J47A 3PCOB 4DV1J 4B9TA 4F7ZA 1MWZA 3VVTA 2MQPA 4JOUA 4AL7A 2DGTA 2LD5A 3LSGA 3OT9A 4ZVRB 2ZZNA 3BPDA 4JI5F 2J6TA 3F41A 3BPVA 3CJRA 1ZPVA 2O6GE 1VS3A 3IN5A 1NH8A 3SZPA 2B4OA 5L3EA 1NKBA 3LPYA 2IM3A 1F5AA 1RK8A 3R8YA 4P6QA 2FYXA 2WOMB 4AL6A 3HEFA 5J1EB 2LVWA 1R4MB 4QR2A 2CNOB 1PCAA 2DI3A 4M63A 2LYCA 1T2KA 1B59A 1TUGB 3ZQGA 4AYBA 2Z3YA 5J2PB 1FC3A 4AU7A 1HBXG 2D9PA 4OHXA 2FNAA 2X6XA 2LA4A 2XEXA 2FVQA 2K1RB 5KG5A 1E2XA 2RGVA 2LKPA 1P9YA 3TP2A 5AJ3J 2QL7B 1OYWA 3BBFA 3ZMZA 1HHTP 1Q82T 3UDEA 1XGMA 1TMMA 2X6YA 3E6DA 4U96A 2YX1A 2YX7A 2MY7A 5M2PA 1YSJA 2BUNA 4WTYA 2YTCA 2DITA 1XB4A 4P1WA 4WFZA 3D0GE 3JQMA 3NRBA 1FD8A 2ACYA 3DTEA 5LEKA 3JR9A 4ECXA 1N6QB 4DCPB 2RVCA 5CVRA 3KP4A 3RYLA 4ED6A 2V63A 2V9PA 5D4PA 1CC8A 3CF5Q 2I5JB 1IRFA 4BGDA 5H6RA 1P6RA 2R8IA 3UE2A 3NGDA 1Z77A 4HF0A 1EV7A 1UA0A 4LK0F 3QSYB 4KO0A 3RBXA 3GSIA 4TQSA 3GYNA 1URNA 2C3PA 4QU7A 5L3FA 3K4LA 2RVJA 3FDSA 4UB6C 1DY3A 4LF9F 3HB9A 4IOCF 5IP6A 4BE2A 3Q0UA 2D9OA 2YS9A 3K4JA 4JI7J 2RF2B 2OKQA 3F72A 1ZS6A 3PRDA 2YNIB 3GCWP 1JJHA 4HVZA 3HXLA 3RPUA 3EM1A 4DZ6A 2ZXHA 1WEYA 2PEBA 5HQ8A 1WC3A 2VPXB 1Z6TA 3LQQA 2JJ7A 4HW0A 3BEGB 2NS1B 4KYWA 4F50A 4EM0B 2L7FP 5IFMA 4DV1F 2Q8KA 1HSTA 1UHSA 5L3GA 2IC3B 4EBEA 1VYAA 4G9YA 3DFGA 4FN5A 3MD2A 4W1UA 4JI3J 3DLHA 4A46A 3ROUA 3N4MA 5CVUA 2V8GA 2MKYA 1YW9A 1P2FA 3F8CA 4LF8J 2VLAA 2CNLB 2KO1A 1EZZB 3FK6A 4WKRA 2PMHA 2E71A 2XZTB 1TNSA 2R5ZA 4FPIA 2BY2A 4NLUA 1AA7A 3RDIA 4AM3A 3QPHA 4M3BA 2C6YA 1BIBA 2YQ3A 2XMVA 2ACMA 2EV6A 5F6FA 3CUQB 5C2GA 3V4IA 1DARA 2PMWA 4Y4RA 4JI0J 1WC6A 3C2GA 2ELHA 1I6JA 3KP7A 2QA1A 1J5EJ 1YWXA 2B6AB 3DOLA 2YKMA 2XRNA 3CCUI 1JKPC 3S2DJ 1PVEA 1VQ7I 1AUSL 4NQWA 2ZD1A 2O8XA 2OD6A 1RETA 3C1DA 2XSFA 4Y00A 3CJSA 5AJ3F 1OISA 3G1OA 2R7XA 1SC1B 4U7BA 1N8RT 3CCRI 3DLAA 1UFLA 2E60A 4XLCA 1HHQA 4KGKA 1AROP 1X0FA 3VDXA 1MDMB 2DYSH 3F0CA 3FBFA 1FHTA 3CD5A 2UUCJ 3QP6A 2VBXA 4X4UA 4WX9A 3Q8VA 3FXJA 4YFUA 3A8KA 3F9KA 1JGGA 3EGNA 4EGZA 3TO7A 1FBSA 3W3CA 2DYAA 3JB9k 2AIRB 3DGPA 4M6XA 5HDNA 1LWCB 1D9FA 2YNFA 2JLEA 1K0TA 3BGRB 3NWGA 5H2FC 2ETHA 5K7ZA 2CJAA 3I87A 1WRJA 4E7ZA 4ZS6A 2VF3A 2IJLA 2VI6A 3MM5B 3M9OB 1MBHA 1T03B 5HOOA 2XSJB 1G3WA 2NVUB 2AF6A 4KKOA 4Z6YA 3S93A 4WXCA 4PJMA 2IJRA 1TQPA 1BL0A 3CGIA 3A01B 2RQCA 4BHCA 4HH1A 1RI7A 2J0WA 3C15A 3ZTQA 2BOPA 4K4WA 2OPSA 1FEEA 2HYIB 2ROGA 4JI7F 3R5JB 4URQU 1QVFR 3NY0A 3J81K 2EFOA 1ZZFA 2H3EB 1HBMA 1K4TA 5CVJA 4YFKF 4K5RA 1OYEA 3OMYA 4JI8J 3P45B 1LDDA 2IM0A 1S9EA 3KCCA 4Z2XA 4I0AA 2DMUA 2JPCA 3WGHA 2UXDF 3ZZ0A 3FMRA 2K3IA 3J81U 3NP5A 4EMDA 2CZVC 4HV6A 4JI3F 2M4MA 3N6NA 3IHUA 5D8KB 1U1LA 1DFDA 4AYBD 6PAXA 3B6BA 1Y5NB 4KAIA 4NLQA 1WOOA 3PDNA 3HT0A 4ENOA 3KK1B 2VU5A 4LF8F 5CZVA 4ESBA 4QPOA 4JI6F 1RTJB 1Y7PA 2V2KA 5B0FA 2GM4A 3IKVA 4U7UD 2YKQA 5FIIA 3W6KB 3FMBA 4A3EJ 3UVJB 1VQKI 2HG4A 4FYXB 2XY5A 1SVLA 2C3UA 4LFCF 3PHEA 5A0YA 1VQ5S 3HULA 1SJFA 2RHSB 2G7UA 1TP7A 2CA9A 1DP3A 4EM1A 3B4DA 3QU6A 5D4OA 3P7NA 2MH2A 3GTPJ 1B9NA 3HK2A 4N9IA 2RQMA 1TKTA 1RT5A 2YQ0A 3I58A 1HD0A 2AHOB 2BJ1A 2RB7A 1S9HA 3S3NA 3E6CC 3WDOA 2HRYA 2XS2A 3TA2A 3VODA 3FVYA 1RHKB 2NREA 3EVWA 1LDJA 1R00A 1Q5YA 1HL6A 2JA2A 3DLBA 4FE4A 2PGCA 2UUCF 3I3LA 5E3MA 4IF4A 3HOVJ 2FTRA 3AG4H 2D5VA 1YS6A 4DJAA 2EWNA 3IWXA 4B9UA 2GVZA 1OJ4A 3MOZA 1WTFA 5RUBA 2KVQE 2F65A 3RB3A 3E5XA 1UFKA 4I6YA 1WJEA 5IZHA 2R2TA 3CJTA 1KVIA 3RTVA 4BWJA 4ENJA 4EWTA 1N56A 4V1Ak 3E7LA 3RPUD 4N0BA 2JRMA 5L3BA 1IUFA 1X4HA 1RBAA 4O4GB 3FHNA 4ZDPA 4CYUA 1XSVA 3CMES 4M73A 3L9FA 3DNCA 5T41A 1FZPB 2IAJB 1FLIA 2LEPA 2M2BA 3FK4A 2M7SA 3SXYA 3H9JA 1S4EA 4DSJA 5LFAA 3HG9A 4CLUA 1NJZA 4TV7A 2G0IA 3HRTA 1VC5A 1BR2A 1I3AA 1JKQC 4IHTA 3EX7B 1TT0A 2YNHB 3BCBA 3Q0AA 4LF7J 2XF7A 3F6OA 4RW8A 2BKOA 4DPOA 2OMOA 2KI2A 2MLXA 4U67Q 2RE1A 2MEWA 1GXUA 2YWFA 2E7VA 3I5UA 2DXDA 4X66J 4CI0B 3EJMA 2HNYB 5DZ7A 5B66C 2HNDB 1REVA 1U26A 1V5VA 4A47A 4EZ9A 1OR7C 2W7AA 1X2NA 3UD4P 3OTDA 4JI2J 1F1ZA 1W25A 3H35A 3HKZN 2JPBA 1X5SA 3CLOA 4YY3J 4LSLA 1U45A 4Y7NJ 1VRTB 2ZC3A 2O5RA 2QN6B 1KHWA 5KAIC 1JE8A 2Q6BA 1ZAOA 1W5SA 1HQ2A 4DXLA 1KS2A 4J9UE 2E2IJ 4BBYA 2U1AA 2M4GA 3V7RA 3QRFF 2AXTC 4ZYDA 3DXSX 1F4KA 3SXLA 2F5DA 1U5TA 3GU0A 2ZJQF 2Z2SB 3BYPA 2JK3A 5IYBJ 3HSJA 5J8FA 1XMQF 1W36D 4FXDA 4Y34A 3W2WB 2W9BB 2MKSA 5KFUA 2G13A 5D4NA 3FXQA 2FJXA 3MWBA 1TL3A 1VTNC 1XC9A 1ACMB 1AA1B 4J9SA 4JYAF 4CLFA 5AXMA 1ZKGA 1IN6A 3QYEA 2X0LA 1RWMB 2WRMA 3CMYA 5C4JJ 4X6AJ 1NXIA 3KYCB 2ZVIA 1PC5A 3LSHA 1Y5IB 3E5UA 5GTIC 4KY3A 3I9V9 4RAYA 5GADJ 4I2PB 2OAZA 1RTZA 1YI2S 1AWCA 4BC7A 3UN3A 3VAJA 3DGVA 4KN7X 5HJXA 2EFWA 4FQGA 4K7QA 3U2RA 3HP6A 1IO2A 5ETMA 3L2UA 1QAIA 2VJ5A 5C3EJ 2X85A 3G6EI 3I31A 4ZPBA 1F9NA 3GUDA 4EBCA 2AWZA 4RO0A 3CCQS 1L5UA 3RAXA 4BXFA 4E2FB 5FD5A 4WE1B 3ZZTA 2VJIA 4RNFA 5HVQC 2AGQA 2HZTA 4QWBA 1YKWA 2O66A 3NNCA 2KG1A 4A8YA 5HLTA 3JSBA 4NLOA 2Y31A 4YELA 3M8FA 4ZVSB 2GQCA 1MROB 1TK5A 3WU0A 1ZM9A 4ECWA 1USSA 4LQ9A 4ZPAA 4NZ7A 1NKCA 3D1HA 2K7LA 5HL7Q 3MR7A 4K2EA 4PABA 5IOLA 1CJVB 2BX6A 1NZ8A 3CO0P 4HI1A 1R3NA 1B70B 3QODA 3V42A 2KIFA 4LF7F 3CUQC 4JX6A 2QMWA 1LFWA 1YFHA 1MU2A 5DLGA 3PO3J 3OL9A 1RUOA 3DCFA 3KWMA 4OFZA 4GC7A 3DF8A 4X66F 2L0KA 1FEXA 1D1UA 1FTCA 2K7JA 4HR2A 1UMQA 1V55H 5D8LB 1DQUA 4QPXA 3TRGA 3PYEA 2IS6A 4UVAA 3S14J 4QPTA 4GKKJ 2C3MA 2O8KA 4NCGB 4ED1A 2BVMA 4PDKA 1RT3B 2GCFA 3BSOA 4EEFG 3MN2A 2VOPA 3TVKA 2KL4A 1HNXJ 1U2RA 1MJBA 2VUGA 3NNHA 1N5QA 1H89C 1WG4A 2XC7A 1LV5A 5KT3A 1PYOB 3BR3A 3RBZA 1B9MA 3FK7A 1S6QB 4ANEA 2ZDOA 2D69A 4KT6A 4FNIA 2M30A 2EA2A 3QT7A 3JAMY 1SUQA 4J9LA 4B3MJ 4RM2A 3QT8A 4IZZA 3ADAC 5GMKa 5THWA 2JEFA 3TARA 3FC9A 2DNMA 4RUHA 4BEHB 1MWYA 1FWKA 3R97A 3Q2TC 1A9NB 3H0GJ 4QBUA 1HQEA 4KV8B 3BWGA 4LG3A 1Z6RA 5JR3A 4QYZK 4F2RA 1IKXB 1HYSA 4Y28C 2XSJC 3CT9A 3KNGA 1G1XA 1QZZA 3DWLE 4DQSA 2ADUA 2GLOA 2HXOA 2NOGA 1QM9A 2O61A 5FD6A 3BBCA 5LJ3Y 2ZO4A 4TNOA 1JJ2R 1S0VA 3OD2A 1I3QJ 2Y3YA 4AIJA 2KFYA 1XEZA 4FXVA 3OL4A 2HMIB 2M1BA 1RA6A 2MLZA 2WK4A 2CVIA 4HACA 5D8HB 4IR1A 2WCXA 1HWJA 1HPZA 4NLYA 3SSRA 5FLMJ 5HO4A 2G0JA 5DCMB 4KTQA 3Q8YA 2Z58B 3SEOA 3JSYA 2HTJA 2RKIA 3ZZYA 2HLTA 3V6DB 2ISZA 2BE5F 4NA3A 3LSMA 2XULA 1YIOA 1DTQA 4C3KA 3OSNA 4BE0A 1C4CA 5K5RA 2XB5A 3RJPA 2K3PA 4P2XA 4ZTJA 2J6SA 3OL6A 2XHKA 1GTEA 2XGPA 3R4KA 2LXIA 4TYAA 5J2NA 5HDKA 2KDOA 1RT2B 3TKYA 4PFOA 2CQGA 5T7LB 3R5AA 5DUKA 1SVOA 2EZIA 2WAQN 1NHKL 2CFOA 4RAZA 1V9OA 3V2UC 5J1RA 3BG5A 2ZJRQ 1UZHA 5HI7A 3BZCA 3E2EA 3NMAA 3DCAA 2XLJA 5DCFA 4QW8A 2E7WA 3UDVA 4YB1P 3ZQHA 3MECB 4C97A 3SV4A 2KJCA 1JNZB 1XN7A 3PIPF 1E6VA 3OL8A 5F0WA 1ZG3A 4NA2A 1QVTA 1NKEA 2ME6A 1TL4A 4DV6J 4GKKF 4A0YA 2IMWP 1AOYA 2H6CA 5LSLA 3IH2A 4DV7J 4DG1B 3HM5A 3QAUA 5DV5A 4FZVA 1VQ8S 3K1PA 3EXYA 1CJUA 3W63A 4JV0A 1HNXF 3R7NB 1SIWB 1IVZA 1S1UA 4XLPF 2J0XA 2RDDA 3CQZJ 2RRBA 3WIVA 1WJAA 2HOAA 4X4RA 4ERDA 3A1YA 3TVZA 4IG3A 3MCNA 4M3GA 1OFCX 3I53A 1HWKA 2PA8D 2RV8A 4Q0BA 1TQIA 4B3MF 3B73A 3A12A 2I38A 4AD9A 1LE8A 3H92A 5L3CA 3CJRB 4YFNF 5L1LA 5H6QA 4HHUA 3WTYC 3IA0A 2HS5A 3BO2A 2YU3A 4EGLA 5B0DA 4HI2A 3DPUA 4ZA1A 1VQ6S 3O2PE 2KJVA 5B1AH 3TANA 2QF7A 2VG5A 5HAOA 3SZ2A 5L38A 3FCHA 3BTCA 1CJKA 2BZTA 3O8GA 1R8HA 4F4WA 2DA5A 4PXBA 1GLNA 5LBQA 3GTKJ 3PV8A 1HLWA 2XLIA 3D5SC 3G6XA 2EBIA 1YO5C 1X4FA 4M1KA 2VPZB 4O3NA 4BNCA 4LBIA 5LOQA 2WONA 5KFKA 1QE1A 3AG1H 4RX6A 1IRXA 4IOAF 2KHCA 4ECVA 3DQVC 4FF1A 3FXKA 1RT4A 2DY9A 3UR0A 1Y0UA 2CO5A 2ROPA 1IW7F 2PI4A 5JJBA 1SFXA 3MZ8A 5K1YA 4XSZF 3FEZA 1FY7A 3KP3A 1IXRC 3IWFA 2YWEA 4EM2A 3OXLA 2GMLA 2MZTA 3W60A 3IAM9 3PR5B 4ED3A 4F8RA 2G1HA 1S57A 3FX3A 1PDNC 2VFSA 3FXMA 2Z2MA 2EH3A 1LWFA 2YKNA 2JTVA 4DQRA 2XDVA 4UUWA 3BH6B 1RZMA 1U2FA 1IM6A 5EZGA 2EILH 3TJ9A 2VQHA 3MM8A 1PJRA 2HBRB 4PG5A 4X2BA 5DO2A 4KO0B 5A6PA 1W4MA 3ENQA 2IA6A 4IQMA 1L3UA 4M5MA 4JP0A 3QWPA 3I55S 2B0LA 2E9RX 2IA1A 3KP5A 1UJ4A 3C2PA 2BJEA 1V5IB 1YRNA 4CO1A 3O1LA 1U24A 1F5BA 5KFAA 4M5LA 2VE9A 2ZOMA 4ANJA 1VJWA 4FF3A 1HR0J 4E7SA 5KG1A 2XS7A 2SXLA 3PTWA 1VMBA 1OMSA 3B8HA 3UNYA 5A2QK 3LMMA 3HD1A 1WI6A 3KG4A 4FKXA 5L1JA 4OHZA 2UVWA 2HPIA 1TTYA 4Y15A 4USHA 5GAEU 1R31A 3CEDA 5A2QU 2CWEA 2E9TA 4LIRA 4H0EA 1DURA 2DTZA 2HDCA 1RTDA 3HI9A 3IBFB 3ETOA 1K6YA 3W9IA 3PHTA 4ID5A 1S0MA 1LEBA 1X1CA 3M8QA 2R5ZB 3VV2B 4WK1A 5HS9A 4AE5A 4IRKA 4ILMA 2M2EA 3TA1A 3PW7A 4ABZA 4AD6A 3F73A 4OINF 3GP9A 4YQWA 4CXFA 3CCSS 3J7ZI 4AIDA 3V4IB 2LU1A 4G6VB 1KQ9A 2JZ5A 3TOBA 1M5VC 2XS5A 2BHYA 3I32A 1GXQA 1LXJA 2GAGC 1RXOB 5F3ZA 1MBGA 1ZH5A 5F9LA 3DOLB 2YKMB 1EIYB 2GMJA 1F5CA 4NQWB 4C9YA 3VYRB 2ZD1B 3AB4B 2ZDPA 3HUGB 2E1MB 4C8MA 3T9NA 4RA2A 2DH8A 3LAJA 1JKRC 3M6WA 2F5CA 4BBSJ 2QC3A 2ZXJA 2KRCA 3GIMA 1EAYC 5G4DA 1RHQB 2VBWA 1FP2A 2CIMA 1JLQA 2XMUA 3FXRA 1KWMA 2XGCA 3CXCR 5HLFA 3C7JA 2AJ2A 4CSWA 3HKZA 2UUWA 1IN8A 4YIIA 2IS2A 4FISA 2W24A 3C19A 1I6XA 3J80K 3D66A 4USMA 3SFIA 4A93J 4PAAA 1UPMB 1HD1A 1FKOA 4C2UA 5DDPC 1U6ZA 2JVRA 3GIKA 3LGHA 3IP4B 3M9NB 2RC4A 2W7PA 4ZZDA 4BQAA 1UWBA 2XYGB 4EBDA 3SDEA 3PQJA 2KHDA 1YJNI 2EK5A 3HRUA 2HVZA 2ATCB 3DGPB 4U0WA 1XTAA 2AYEA 2YH1A 2MQOA 3HVTA 4CHUA 2YNFB 5KG3A 3J80U 4QLCU 2R7QA 5JFRA 1SQGA 4DSEA 1PO6A 4L3NA 5DS9A 5ILUA 3H1CA 3J7AN 3TDUC 2HQ5A 2Z4PA 5LGNA 2LFVA 1ZGJA 2OO4A 3NEKA 4TY8A 3VHQA 3PRBA 2ZC2A 4KKOB 1STZA 2H1YA 4U87A 2FMYA 3MKLA 4A3JJ 1VK8A 2DNLA 4KITB 1VQ9I 3EUAA 1WELA 3QPLA 3M2UA 2MD5A 1Y1VJ 3F8FA 3C15B 1AFIA 2MSSA 3LP1A 3K5LA 4X4SA 1HNIA 3TNVA 2E5LJ 2VFRA 3QWUA 2W01A 1D8KA 3GR0A 1I6HJ 1HBMB 1HR0F 4O3PA 2PFDA 3AJDA 3DTIA 3K89A 1FWLA 5HBMA 2Y1RI 2N7CA 4LRBA 5HN0A 1X4PA 1S9EB 1T56A 3K5MA 2M88A 2VT2A 1VQ4I 3MD3A 3W1YC 2OLWA 4CO0A 5EHHA 3I54A 3P5JA 3RZDJ 3B78A 1TQMA 3OV8A 2HHPA 2EIJH 4KYZA 3QBCA 4RR5A 2AX0A 5MAOA 4C3IJ 2XAHA 3CDWA 3D3BJ 4WFXA 2BANA 3TWZA 1NK4A 1WNEA 3HX9A 3UPFA 4O6JA 2EG1A 1VZ0A 4XPEA 2QYCA 2KT2A 1N34J 2N3LA 3A3NB 2H8RA 4XK4A 2GO9A 2K40A 1E0EA 1UL3A 1S5ZA 1J7KA 2E5JA 5KFSA 3BT9A 4A3FJ 4X4OA 5IYCJ 1YIJI 1X9MA 4K50A 4HLYA 3H7HB 4PEOA 1D1AA 3HOTA 4NXNJ 4UY85 2QFIA 2WADA 1MH4A 1X4GA 4CLYA 2EFPA 4ETXA 3OJUA 4RBVA 1WD6A 1X4EA 4A8FA 3V4GA 4X64F 2Y8WA 2L3DA 3RB6A 4IG0B 1RT5B 1V5GA 3T1YJ 2FB0A 2DO0A 1T3NA 1K7AA 1NG7A 3EZOA 5H9FJ 2RD5C 4J37A 2IHR1 3FCWA 4D5FA 1NK6A 1JI8A 1GT8A 2CDQA 3C2HA 4K2JA 2IFXA 5KFCA 4G8XA 2HVIA 5CPRB 3UO0A 2NYXA 3BYRA 1B0VA 3QT6A 2DLLA 4HBLA 5KFXA 4JK1X 3KLIB 2ZMEA 2FZCB 3MURP 3UR3C 1N0VC 2JMWA 3FBIB 4RM3A 2KP6A 3Q9VA 3R27A 3VGTA 4NLVA 3CJTB 1NCLA 2MKKA 3CCZA 4WYLA 2MD0A 1JGSA 4I6ZA 2Z16A 2FQ3A 4BY1J 5ILSA 5LMNF 3A8IA 3BV8A 4K0KJ 3LWFA 5EEAA 2CJXB 4BJTA 4DI6A 2NCKL 1DU0A 1RT1A 1WWHA 4LMYA 5BOXA 1O3SA 4KPYA 4CYUB 1ELOA 2DFHA 2TDXA 4QIGA 4DX7A 1TFWA 1HBOA 2GJ2A 4QR1A 3PO2J 3VYTB 1UFWA 3RB0A 4DQIA 2QKMB 3OV7A 3DXBA 2UXXA 4E0DA 2GHPA 1T0FC 3DRXA 4DR7J 5HODA 1OO0B 1VC0A 4BS9A 2QQ8A 2FE3A 1FA0A 2E5LF 2B9YA 3MOJB 2VHGA 1CEZA 4ED7A 3QPSA 3I9V2 5FRNA 2HNHA 2CJBA 1FFSB 2IYGA 2XGDA 3R0JA 3RQIA 1X0PA 4DPWA 1BI2A 4OU0A 1AKHA 3TA0A 4RW8B 4JI1F 1UCRA 2DGUA 5TRDA 3G2XA 5U47A 2K9SA 1A6IA 1MMLA 4FDFA 4HDVA 4ZDLA 2BJ9A 4RW9A 1REVB 2VQCA 1KQKA 1ZLKA 3FIWA 3GMEA 1G6NA 4AFFA 1Q8BA 4B3RJ 4F7VA 2GAHC 4Q2LA 3VB2A 4E7LA 1Y6IA 2DA2A 2DPUA 1N34F 2VA2A 3K17A 3D5MA 1T02A 5IT4A 4LSLB 4ILLA 3GEZA 4XIDA 1LNWA 1SAUA 2E2JJ 1KTVA 3CUOA 3SCKE 4TKTA 4GVLA 3J7YJ 4P74A 4KA4A 4OLPA 3M8PA 4N5SA 3MPDA 2DGXA 3M8WA 5B0BA 4NXNF 5KT2A 1W2IA 4OZ1A 1T6SA 3HKZD 3QGPA 3T5KA 4DN0A 4NHJA 1WORA 2FVSA 3CDEA 3W66A 3HZJA 4R5PA 2JHEA 1U5TB 3H0PA 2DIUA 3DTKA 2WAQA 1DTTA 1RCXB 3A3PB 3PO4A 1PILA 3T1YF 4HSTA 2QCOA 4CLLA 2DCLA 3DYAA 1TL3B 4C2MA 5DGBA 4LF4F 1ONVA 4ZTFA 3KUHA 2H9ZA 2OH2A 3ZXWA 3I4PA 4F3QA 4G3IA 3D3CJ 3HHLD 3E6MA 2MABA 1MD0A 4ENNA 2XC9A 1MNDA 3QYFA 1VQOI 3GIRA 1RWUA 3BM7A 3GWCA 3WX8A 5D4SA 3VWBA 1FRMA 4NLRA 5DD8A 1VFJA 4G12A 3SQGA 4DR1J 3PW2A 4X4PA 4DL3A 3CTRA 4IRCA 3CD7A 2VIXA 3I59A 1VFCA 1WHUA 5FLXY 1Z3YA 5D0EA 4ZCMA 3VAGA 1P4XA 3QZ8A 5DQHA 3Q8PB 1QO0D 4YUDA 1XS9A 4BXUA 1MLAA 4B3TF 2ZH8A 2PJPA 1YX2A 4DWIA 3Q8RB 4BDZA 3NL0A 4UT4A 5K14A 3RZOJ 5F0HA 4ZH4F 2QTWA 4DR7F 3HSRA 1FIAA 3QFHA 2BXJA 2GBYA 4YB5A 2BM1A 1RAGB 3WIUA 3OPKA 2J7WA 2DNZA 3KXDA 1BMQB 1UETA 1Q8LA 2QSFA 3OYGA 3JXOA 1KQ0A 4Y13A 2UVUA 1NEEA 4DFJA 2R3VA 1BC6A 3MEKA 3RR7A 1GQEA 3EPGA 1R5ID 2HBZB 3HHNB 1ZAVA 1WI9A 3KHLA 5C5JA 1MU2B 2L54A 3D0SA 5HSPA 5DLFA 4UUVA 4O0IA 3AB2B 2QLJB 4KB7A 1WC5A 3QZ7A 4UZBA 5L9XA 4H54A 2Y9HA 3H98A 4B3RF 3AD8C 3LGMA 1FERA 3S32A 5IS2A 3DU6A 2E1MC 5H9EK 4ED2A 1QVUA 4KIAA 2F5EA 1FDAA 4RJVA 2VH7A 2LEAA 3VYSB 3TQEA 2MZSA 2OPPA 1E3PA 5B7WA 3D1QA 1FE4A 1NSQA 3CCUS 2J9DA 1VQ7S 1S9GA 3PNTA 4M6VA 1KONA 5ICEA 4WZQA 2CSOA 1S1TA 2CQ4A 4HLXA 2ZEJA 2QX0A 4TN2A 2AS5F 3LSKA 4OWRB 3IAS9 3K4CA 1KLMA 4PYAA 4XR6A 3THVA 5KFRA 3MKZA 2OF7A 2QKLB 3PW4A 2FJEB 3MAQA 1SUQB 1FOYA 5KFYA 1W36C 1KNZA 5L9NA 4ZJQA 1IDYA 3C8YA 4XSXF 1WJCA 2WZ1A 4DR6F 1AT1B 3TX0A 4EJWA 1HQEB 1ETOA 4E7JA 3DC2A 1NK2P 4P7VA 3P5TL 2W4PA 1HYSB 4ZVHA 1UPPA 3PX4A 2F5VA 2NXJA 1K1SA 4N8NA 4GVBA 2VG6A 2HVEA 2IXSA 3FBEA 1RWKB 5KAFC 5HNHA