2L9NA

Structure of the human shwachman-bodian-diamond syndrome (sbds) protein
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
250
structure length
250
Chain Sequence
MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Uncoupling of GTP hydrolysis from eIF6 release on the ribosome causes Shwachman-Diamond syndrome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Ribosome maturation protein SBDS
total genus 44
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2011-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01172 SBDS Shwachman-Bodian-Diamond syndrome (SBDS) protein
A PF09377 SBDS_C SBDS protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.900 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l9nA02
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2l9nA03
3.30.1250.10 Alpha Beta 2-Layer Sandwich Hypothetical 12.0 Kda Protein In Nam8-gar1 Intergenic Region; Chain: A; Ribosome maturation protein SBDS, N-terminal domain 2l9nA01
1ZM4A 2BM1A 2I8EA 1ZM9A 5G4DA 1NYNA 2I0XA 4FN5A 2NPFA 2J7KA 1FNMA 2BV3A 1P9QC 3B78A 2CVEA 1KTVA 3EXCX 4ES3A 4MYTA 1ELOA 2XEXA 4TNOA 4MAKA 4ZCMA 1U2RA 2ZITA 3ZZ0A 3ZZUA 3UI3A 2KDOA 3B82A 4MYUA 2IVYA 4ZCLA 4ES1A 2WBMA 3OQ2A 1T95A 1VI7A 4QR2A 3LH2S 1N0VC 1DARA 2EFGA 4ES2A 4ZCIA 3E3XA 4QR1A 1ZM2A 4M1KA 4ZCKA 2L9NA 1ZPWX 3B8HA 4QR0A 2BM0A 3ZZTA 1N0UA 1ZM3A 2E1RA
chains in the Genus database with same CATH superfamily
4UOCA 2G7HA 1VYAA 4ZVTB 5HROA 2M2BA 4JI4F 3J81Y 1C0WA 2V9KA 3QLHA 1BI0A 4V1Ak 4S0HB 2QMXA 3FBEA 4MEXF 4ZCIA 4KJIA 2WVDA 1T8IA 5AT1B 3W62A 1RZMA 4DV2F 3I0RA 2VT3A 3TYTA 2EBEA 4QYZK 2PD1A 4YEAA 3T3FA 5IWAF 1Q16B 1YJ7A 4YMEA 3D5SC 4DX8H 3E5QA 2RV8A 3RKQA 4I2QA 4ZP9A 4RGRA 3NGKA 5IOYA 1XPXA 3D1OA 4H4OB 3CQZJ 3MMBA 4NRUA 8AT1B 3BZ6A 1HSJA 3K5OA 3U27A 4GVLA 2CNLB 2VKDA 1Z91A 1T0FC 5LJ3Y 3AHPA 2K1RA 4RO0A 1YKWA 3C7JA 3HD1A 4B3XA 2ICWG 2B7BB 3M8JA 1RIOH 3UDEA 1KQGB 3CIZA 3IAS2 2V34A 4FTHA 4OYMA 4PSXA 1R4NB 2VZ9A 2FUG2 2H65B 5HMWA 3PFYA 1KNZA 3NWRA 5D8HB 4BHBA 4ZYEA 5GP9A 3LGHA 4Y34A 3OHBA 2DRBA 1VC5A 1XSDA 4KFBA 2JK3A 4C8ZA 2HG4A 1X7VA 2D5VA 2B9WA 1UAWA 4NI2A 2CUYA 3WGGA 1GVDA 1G3SA 1U8SA 4HTJA 4WCEQ 1WHXA 1IXKA 2ADCA 4BLGA 5EN1A 3UN2A 2ASLA 1J59A 4V2FA 1ON2A 4KHPJ 1S9GA 2CPIA 1OR7A 3VVTA 5HVQC 3FEYB 4RNNA 1FHTA 1B70B 1MWYA 1I3QJ 2GMLA 5B3SH 2FZGB 4G6TB 3JXOA 3E51A 3MMBB 1LPQA 1A9NB 1AXQA 3C16A 3OYKA 5GADI 2UZAA 4NLTA 2CV0A 1RTIA 5FLXU 4DX6A 4ANJA 2LY1A 4C30A 3F9KA 4A3DJ 1U1LA 1HNWF 4O3MA 2LFVA 2H09A 4HBLA 5D4RA 2FHOB 3ULHA 2Y8YA 3H0DA 3NMRA 5GAGI 2XKPA 1UJ6A 3RAQA 2AEFA 1FRHA 3GYNA 2QM3A 4A0XA 4ZIWA 3PO5A 2IS6A 2HFSA 4DOZA 4ZH4F 1PBAA 3ZZUA 4F3MA 4NB5A 1U6BA 2FBIA 1WG4A 2EWHA 4PXEA 2NQPA 2UUBF 4KHRA 5M2RA 4LMZA 3FRZA 4KO0A 1O57A 1U1NA 2RQMA 2W25A 2K85A 4PWUA 3Q8RB 3WQPA 3LQVA 4K7QA 1FDNA 9ATCB 2HVQA 1PJ6A 4C48A 4PKDB 3PUFA 2DCUB 3CCES 3H98A 2VI6A 2VICA 4G12A 2V1XA 4H54A 3ZGKA 1RAOA 4LK1F 1W7PA 2EW9A 1WNEA 2CJXB 3V4IB 1Z05A 2KH9A 3AAWB 5EWEA 1UZHA 4BDYA 2GWRA 1S6PB 3VAIA 1SD6A 5F64A 1Y0HA 1W5SA 3I64A 3JRDA 3I54A 4O3RA 4JYKA 4J90A 3NKYA 2IA2A 5J1EB 1S6UA 1IN5A 4TY8B 5AJ3F 4WK1A 3THTA 2WBRA 3RBXA 1OCRH 4I0BA 3PDNA 2ZBQA 4PZVA 3BT9A 1GMWD 4X62F 2NSBA 4LF4J 3MM9B 1Q8LA 4D1QA 3T1HJ 4DV4J 1RZ4A 3FZ2A 3GFHA 5B0FA 1DAXA 3UCUP 3BCAA 2XMUA 1J0RA 4ECXA 3HUGA 2VQLA 3QT8A 5L46A 2DR8A 5KFAA 4FYXB 1FF2A 4P7VA 4B17A 2XGEA 5JR3A 3DYAA 2LYCA 1XMOF 1NKCA 4BS2A 3BJOA 4RAYA 1VQKI 1Q95G 2C22A 2BW2A 1HNXJ 3CLQA 4BKXA 1M5KC 2FJWA 2CQCA 1LQ9A 2WB1N 1RHUB 1WJEA 3Q0UA 3QRQA 2W1BA 2KIMA 3ZFVA 2R5ZB 2CYYA 2QLXA 4HSRA 2J5AA 1PYOB 2GMJA 3HHLB 1X4DA 2VE9A 3Q2SC 4ZVRB 4NCGB 1QSLA 5ETRA 5IC6B 2HNYA 2MQ8A 4KFCA 2CA9A 3LA3A 3V2UC 4O44A 1BC7C 2XM3A 2OV7A 2WOMB 2N7YA 3CMAS 1P27B 4RNHA 1HWIA 1P9YA 4NLUA 3KHGA 4AE5A 1ETVA 1NK0A 2CPJA 3NCQA 5FROA 4XAKA 3HRUA 4DLEA 3ZC4A 3JSMA 3J7A1 3HHNB 2O0YA 5CD4H 5I3UA 5GMDA 1XR5A 1FXDA 2OBPA 1QAJA 3DC2A 4HA8A 4QR0A 2JWTA 5IXUA 3BV8A 1JKRC 3A2KA 2DNPA 3DKXA 4RMNA 3K5LA 1X9SA 2RE1A 2HPIA 2MSTA 3JR9A 5FD5A 4DPUA 1WOOA 3CCVI 2VKZG 1VF9A 2C2ZB 4PYDA 2CDRB 1Z3XA 2G7UA 4DBQA 1HBXG 1BHNA 4DFKA 4LF1A 1XERA 4DJBA 2G0CA 4M5MA 3ZZPA 2ELJA 1FX7A 4C98A 3DBRB 3CP8A 1YX2A 3OTEA 1X2MA 3U1DA 4EK2A 2DOEA 1PJ5A 3RQ4A 3HGGA 3WU1B 3OL6A 2MQMA 2CG8A 1BR2A 1ACMB 2OAUA 2O6GE 4Z7CA 2E1MB 3GZ6A 2XS2A 3MTJA 2XF7A 3HSZA 1Z2LA 2Z33A 1CBKA 2DXEA 1SFUA 4LRCA 1Q79A 2B8PA 3KYLA 2ERRA 1MMGA 4Y28C 4O44B 3HSEA 4CLPA 4LREA 1C1BB 1S49A 4KICA 2RAQA 4Q2LA 2VJ4A 2DAOA 3BZQA 4YIFA 1MNDA 4YS2A 3UR0A 4AYBN 3V4MA 3K1MA 2KJVA 4JI3J 3LALA 2HS4A 1ZBTA 5DGAA 4DR2J 1GK8A 3MZ8A 3QMQA 4ZPCA 1HKQA 4EFAC 2JJ4D 2HXOA 1SFXA 4IKFA 1ZGJA 3OYHA 5FLVA 2AHOB 3RYLA 1QA6A 4DR7J 1T9UA 3F8FA 4NQWA 1Y8QB 5EEAA 2NXNA 4HNTA 1RB0A 4DPOA 3FBCA 4QIWD 6PAXA 1JI8A 5J3LA 4ENNA 3HUGB 4U67Q 1JMTA 1RUOA 3DFEA 2PI5A 1JXEA 2QL9B 1VDHA 2ELKA 2GBYA 3LGMA 3AXMA 2DO7A 3BSOA 1JE8A 2MLGA 2ETHA 1EA3A 2IGKA 1MN9A 2BRLA 2L08A 2DODA 1T0TV 1N33J 2QL7B 4GCVA 1KU2A 1WKKA 2KXFA 4ELUA 2Z2MA 1RTHA 3GIIA 5KG7A 5CYQB 3FQLA 1HDPA 3DN9A 2RU9A 2L7ZA 4K4UA 2KIQA 4C8YA 2W8KA 3WTYC 1G2HA 3ZTOA 5LJ5Y 2HYGD 1YZ7A 4E7ZA 2FOKA 4WPAA 1SCJB 4A46A 3GFYA 5LD2C 2HZTA 1S6PA 1OFCX 2AWZA 1JKOC 1C0UB 4J9LA 3H8YA 1O7FA 2P9EA 3HO1A 4U0YA 1TKTB 3VSKA 4YELA 3EXCX 3C6UA 2XKOA 4JI4J 4XICA 2MZSA 3OL7A 3L1PA 5KT5A 1IXRC 3LSJA 1ZQ3P 1BI3A 3H9JA 1CJKA 5D77A 1K9MT 2EK6A 4F26A 2HW3A 5D4NA 3KZZA 3R5AA 4IRCA 3F8MA 1WOSA 3C66A 3MCZA 2VBZA 3KK3B 2QSWA 5J2PA 1BQMB 1VQMI 2DMNA 3G87A 1RETA 3MPVA 3V7RA 4L9JA 1YBUA 3EETA 2B4OA 3KYCB 4YB5A 1LOUA 1X1DA 1AHDP 1L3KA 2NSCA 4AIDA 1C0TA 4JI5F 4II2A 3CCQI 2IRFG 1KQ0A 4BCAA 3R5CA 1G3OA 2IGOA 1R36A 3W6JB 3FMSA 3JTNA 5L8RC 2AJQA 3W2WA 1VJQA 3FCWA 2F8HA 2QF7A 3DQVC 1VTNC 2ZKZA 2DY1A 5T41A 1FRLA 3TOBA 2YNHB 2L9NA 5IZHA 3D0SA 2RQQA 4RA2A 1QD1A 3T1YF 1Q78A 1KEKA 3JRGA 1R7IA 1J7KA 2COLA 1P9QC 1RTHB 1QQIA 2WSFC 2WRMA 4OINF 4X6AJ 2CNOB 1HBOA 2ZJQF 2FE3A 3B4DA 2X1BA 1ETKA 4D5FA 1IKWA 2IM1A 3VDXA 1UFMA 1WFXA 1EH6A 2E1RA 4CLLA 3A12A 1O7LA 1NKBA 1UFWA 2QZ8A 2BKOA 5HL7Q 2XPVA 2HWHA 5EGOA 1MBEA 4GC6A 3H20A 5CVVA 1W4MA 1WSRA 4ELTA 2HDDA 3IG1A 2H4WB 3NMAA 5B0AA 3IRRA 1LJ9A 4WXHA 2RRBA 3FQKA 3ENWA 2R7SA 3OTDA 3GX4X 4O3PA 1FE0A 1VFJA 4X4OA 3MMAA 2LF7A 4RB3C 3KZYA 2W7AA 3DNCA 4HH0A 4U87A 2GMHA 1WCMJ 3GQCA 2ZZNA 3TW0A 4FF2A 3S8PA 3R5GA 1ZPWX 1C1BA 3BG5A 3H25A 1KC8T 3N05A 2D3ZA 3MMJA 4HH1A 5ILUA 2CQ3A 4I7HA 1FSHA 2QENA 2MGZA 4A47A 2EG2A 1AFIA 2BXZA 2VQHA 4QPOA 2DYAA 2YWFA 4RW7A 2ZMEC 3KWMA 3TL4X 1JJ6C 4ED1A 3CCSS 2FD5A 3PX6A 4K4ZA 5L1JA 6FDRA 4KDPA 1MROA 1WC3A 2NVTJ 1RABB 2XROA 4X4UA 4IJAA 4QWAA 4L76A 3C15A 3H9QA 1BC8C 1FFSB 4LJZF 4JV1A 4OZNA 3V6JA 2R8KA 4Y00A 2ZH3A 2ZH2A 4HI2A 4TYAA 4CLWA 2EH3A 2CAJA 2HWTA 2CJAA 2X3GA 1LK7A 3BGFA 1I51B 2UU9F 3OY9A 5CVUA 3E8OA 2IJNA 1RBOB 1TQPA 1DARA 1D09B 2BW3A 5HK4A 4BXFA 1A6QA 2BKPA 2DK8A 2QJ3A 4NLDA 1DUXC 3E2EA 4ZIVA 2WAQD 3O5TB 2FF4A 4A3CJ 4LRAA 2E9RX 3BP8A 2NS0A 3M9NB 4W98A 1E3OC 2BKNA 1H0HB 1ZAXA 2F4OB 3GJQB 4P7TA 2JN6A 1JK9B 1FD2A 3PJRA 2STTA 2ZXHA 1HL6A 2ROPA 2A68F 1GDTA 3CUOA 1UEKA 3FRYA 1BJZA 5DD8A 1FJGJ 2M8GX 3W8PA 5F0FA 4A8OA 5BYRA 2WV1A 2W2MP 3PIOF 2O01C 2LKXA 2B56A 4USIA 4RLQA 4I09A 3KP2A 2YNGA 1U5TA 1HPZB 1TQIA 1S9HA 3GJRB 3LAMA 2RQPA 2K9QA 3J80Z 1X19A 2HNDA 2LEBA 3JRIA 4IR1A 4B1RA 2XMJA 4LT6A 2RT3A 1B1BA 3QAEA 2H54B 5EX0A 1UKUA 4DSJA 3OXFA 3LFUA 3OIQA 2QBYA 4RM2A 5A0YB 4M3FA 3RQIA 5A6WA 2XMWA 1D0EA 1EJ9A 4KA4A 3SQOP 2GAGC 2HBZB 2FNPA 1RT5A 2IM0A 4L9VA 3CD0A 2UV1A 2B0GA 4QIWN 1FX2A 3IN5A 4HX4A 1TBXA 2XLJA 2DNLA 4CI0B 3LMMA 5EG0B 2XHCA 2WAQA 3NWGA 1WC5A 2AS5F 3OV7A 3PNYA 1ZS6A 2B9YA 1HW8A 1RU1A 4AFFA 5M5WJ 1SD7A 4N7TA 3TWZA 1OY9A 4EYIB 2J0QD 2P81A 4TQRA 4IOBA 4J9QA 2H8WA 3ZN0A 3QIPA 3NOCA 3I59B 1QZZA 2ZXJA 4J9KA 3MFKA 2E5LJ 2APOA 2IHR1 1F9EB 4GDFA 5F3TA 3SCLE 1R8PA 3PX4A 2DITA 2DD8S 1YW8A 2KZGA 4V2GA 3W9IA 2EB7A 3HL2A 2R7ZJ 4L3KA 4CDGA 3HSJA 3RDIA 4F93B 2YWKA 3M32B 2W7OA 2OP5A 3OYCA 2ACJA 3LP1B 3K5NA 4AQYJ 4I64A 1W5TA 1YLXA 2XWXA 3PW7A 1W36C 2N4CA 2DISA 3WTWC 3J7AO 2WSCC 2CS3A 1S6QA 4IRDA 5KG4A 3MEDA 1TWCJ 1MIJA 2K3IA 2BEOA 4U0WA 4L3NA 5FDLA 3GIKA 2VXDA 3U02A 3I96A 2HPUA 2A07F 2K7LA 1FDDA 4MT1A 5DDQC 1JXLA 3DLKB 4C9YA 4WP8A 2BE5F 2O8XA 4ER8A 3EYIA 4DFMA 2QFJA 2X1GA 2GOMA 5J2MA 1NJWA 3BGOP 1USSA 3QWLA 2DJNA 4E4HA 5DM6Q 4ITSA 2XSFA 3NCPA 3L95X 1Q4RA 5DG8A 1IM4A 1YJNI 2ZDPA 4FZVA 2QC3A 2W85A 3AG1H 1JJCB 3MMAB 2BY1A 2MB0B 1UMQA 5AXKA 2ZH1A 2CQKA 5D5UB 3HULA 2VBYA 2COMA 2MEWA 2P2CB 4MJKA 3M8QA 3R0AA 3LA2A 4NLPA 1WHVA 2KPMA 4IUFA 1FRIA 5LOQA 3FDSA 1EETA 4X66F 1XMOJ 5GVQA 1T9YA 1DU6A 1NB7A 2BVMA 3W2WB 5ETVA 2VQGA 2KFZA 2FZKB 1EX8A 2LU1A 3CCJI 4TY9A 2FMYA 4TXSA 2ZVIA 4ZVQB 1T7PA 4PFPA 4MK8A 3TVZA 3B54A 3K70C 1HQCA 4KMUX 4PQAA 4FXDA 3IAM2 3EDPA 4ES3A 5EJCA 1TL5A 5GADU 3M2UB 2A3JA 2ZC3A 2Z8QA 1N0VC 3PHEA 4DCPB 2B8QA 2QLZA 2DH8A 4DQPA 2LC2A 3DRSA 4X4RA 4GYGA 1TK5A 1KTQA 1O3SA 2R8GA 3HSFA 3UN3A 3NGTA 2J7KA 2H8RA 3VYRB 3IL2A 2IVFB 5LEKA 2DBBA 2VFSA 2JQ7A 2OQRA 1SFOJ 1ZARA 3ZRGA 3WG7H 3AQPA 1UA1A 1C0UA 1UJ5A 3HOSA 1TL8A 3ULQB 3N6NA 3J7YU 3CO6C 5KOXA 1IBKJ 3TDZC 4UZCA 2FJXA 4DV2J 2Q2EA 3R6LB 4DR1F 2CJQA 3SXYA 3MEGB 3HGYA 3OXGA 4WU3A 1FK9A 3O6QA 1R6VA 3SYTA 3DHWC 1S7IA 3JQKA 3M8RA 4B3AA 3CT9A 1X4PA 3WX4A 2A6TA 1TNTA 1MLAA 3JSBA 4AUKA 4FX4A 5TGTA 2ZJPF 1PUFB 1H72C 5CLSA 4ZYHA 2LCWA 1XCBA 4OV1A 1WC6A 4MNUA 2MSSA 4ED7A 2Y0MA 2QSFX 2UXDF 2LMDA 4OWRB 2PI4A 4QPTA 3FKIJ 5K20B 1SIWB 5D8LB 1W7PD 2J0XA 3GVAA 4ZVGA 5GAHI 4F52A 1VK3A 3TZXA 1VQOS 5IP6A 3QQCD 5HBMB 1ZTRA 2V9WA 3HB9A 2WK4A 2GZOA 3ELHA 1BE4A 4NZ0A 2WHOA 3QRRA 1U8WA 1BWVA 1VLOA 3KE2A 4M5JA 4Q5VA 1X5PA 3IKVA 3HSRA 3ITHB 3AOBA 1RQ0A 2WB1A 1DGWY 1CJVB 2R4GA 3GF2A 4ENOA 3ZQQA 5FJ8J 4ZDLA 4I69A 5IWAJ 4DYQA 1PYSB 3DCAA 1AB8A 3KLHB 4BEHB 3QZ7A 4QIEA 2HHTA 1SPBP 1JHFA 3CCRS 2E44A 2IDLA 3WHBA 5SUHA 4F55A 3MZIA 3S7RA 3BR3A 1PO6A 2FQQB 4IHYA 1B9MA 3KLEB 3DOMA 1ZA1B 1UW9A 4ZPWR 4CCNA 1UA0A 5KFVA 4MO7A 4EATA 2PJRA 1ZZNA 2H48B 2ASJA 3FMRA 4XKVA 5HS7A 5HQMA 3HOXJ 1IN8A 4KHMA 2X51A 5F8IA 4YFUA 1KLMA 2YSRA 4JI6F 2VPLA 2RDPA 5KTQA 2E1MC 1S1XB 4UQGA 5D3GA 1D8KA 4M5IA 4KV8B 3EUAA 1FTZA 4BHQA 3TDUC 2G9WA 2VBWA 1VI0A 4FT8A 4XDDA 3UO0A 3VAKA 1ZH5A 2OPSA 1S72I 3Q22A 2IPOB 2H9ZA 2CFXA 3AAFA 5AJ3J 2QKMB 3KP3A 2UV8G 4ITVA 4HT7A 2VE8A 3RRHA 4O3NA 3C2PA 3CCZA 2ZM6J 2YX7A 1VQ7S 2VFUA 2L01A 4J91A 1WEYA 1VQ9S 4L9NA 1K78A 2X0LA 1J9IA 4TV7A 1YBTA 3V81A 5L1LA 2Y9HA 2RGVA 2STWA 3GZ7A 2ALYB 4NLRA 4A5MA 4J9PA 3LWFA 3MKYB 1J5OB 1Y5NB 1JNZB 3CF5Q 3BSAA 4YR3A 2NOGA 5DLFA 2O61A 1G7CB 1WI6A 1RT4B 5BOXA 2C28A 2HZDA 2L3MA 5KT2A 2FY1A 2OC6A 1VISA 4M5LA 4XO0A 1BOAA 2DDAA 1PG5B 2CKWA 1PAUB 3OYIA 2H1KA 4NYOA 2HFOA 1WH5A 3K4CA 1K0VA 3I71A 2DA6A 4BDZA 2K40A 4E0DA 5L1IA 4A8MP 1NU4A 3ICLA 2BJDA 4OAYA 3VV2B 5DCMA 5KAIC 1HNIB 2I8EA 2Q3PA 5KG0A 3EICA 3IP0A 1RAAB 1KHWA 2E5JA 1OJLA 1S77D 3WU2C 1GFWB 3QPIA 4I56A 5LLQA 5IY5H 1YJWI 3BG3A 4Z6YA 2M87A 3OFEA 1G4CA 3S1TA 4NLWA 4MTPA 4Y65A 1IJWC 2YH0A 4C9DA 1YJVA 3T9ZA 4LITA 1QAIA 5HLTA 1AROP 4O4RA 1WF1A 2DMTA 3K6GA 2J8SA 2BW3B 4H0EA 3BREA 3BR1A 3NL0A 1G3YA 1XSXA 2AZ3A 1Q7LB 3BGRB 3OR1A 2KIUA 3QJPA 4C8KA 3T5LA 3KP5A 3SEOA 4OIRF 3J81j 4LIRA 3A8KA 4P2XA 3GP9A 3V6DB 4NLOA 2CQGA 3HKZN 3MMCA 5KFKA 1N48A 4KISA 2F4MB 4P71A 3BZCA 4N0BA 5D3GB 2UVVA 3THPA 4R79A 1XSVA 1XMXA 4BY1J 3TQNA 5ICGA 3CLOA 2YNFB 3MWMA 3FXRA 1CLFA 2LY9A 3LP0B 4U6PA 2B51A 4RW6B 3VYTB 3QU3A 1IR0A 4OZ1A 1TELA 3EM1A 4A8YA 3QIDA 1KFDA 4XQFA 2VOOA 4Q47A 1G8XA 5DS9A 3IHUA 2BACA 2IFXA 1JLGB 4GKKF 2D7SA 4F0HA 1W2IA 2I8DA 2ZNYA 3CD6S 5FJ4A 1TL1A 1A6IA 4ZZLA 2GA1A 1AKHB 1N4LA 4U95A 2E7WA 3H35A 2KZVA 3H1CA 2AGQA 4KIGA 3RKYA 1BQNB 5B09A 2B4VA 2H4YB 3NS5A 4HTIA 2OMOA 1U9NA 4PCQA 4CZCA 2B7EA 4QIFA 3CCYA 2NS1B 3SFIA 4QPQA 3RKWA 2CGPA 3JRBA 3V6KA 3E0JB 3EE3A 3GUDA 4XKWA 2CQ7A 5HNFA 4UUWA 2MXYA 2LBFA 1O5JA 2UWMA 5DDOC 4IL6C 1GMVA 2PMWA 4PG7A 1TT0A 3IWLA 2D1VA 4ERDA 5HMYA 4IHXA 5I42B 3F23A 4R1HA 4UUSB 1UPPA 1EKRA 1V5EA 4B02A 2V79A 1ZAOA 3MM8A 1YRXA 2YU9J 4XSXF 1PBUA 3GCMA 2MHNA 2MZ1A 1G6NA 3HVAA 3QPLA 4IH6A 5J2QA 1U8RA 2PDAA 1RAEB 3EUHC 4ZCLA 1BIAA 3FWEA 3R3TA 3FSIA 4G1QB 3CJQA 1WJ9A 1HBMA 4L6V3 1NG7A 4CO3A 2C1EB 4BGDA 2FEZA 1KRPA 2UUWA 2JTVA 2W4SA 4FBTA 1WDDA 1U48A 4RAZA 1JLEB 5BYQA 1LEOA 1F9HA 2VHGA 3QT5A 1HQ2A 2QMWA 1NH8A 1KTVA 2L4AA 2AJFE 2KVQE 5U47A 2NYIA 3OL3A 4CLZA 5EDWA 2HGCA 5C5JA 4RAFA 2P8IA 3L2CA 2HS5A 5KFQA 1F5BA 3DOLA 1MBFA 2Y3YA 4IYQA 4KPYA 4BQNA 2BQRA 4WBFA 2EFWA 2YKMB 1DTTB 4HX8A 4GKJF 3DLEA 3M7GA 2BM1A 3U21A 5A6PA 2MW8A 4EJWA 1UHMA 2DJWA 2ZJQQ 1HKSA 4NA2A 3CCEI 3D1HA 1MWQA 2VQFF 4GO5X 1HSTA 3JCUC 3M1VB 1U1OA 3NGDA 5KT3A 4PG5A 4IPAA 6FD1A 1KVIA 1FE4A 4LQ9A 3NRVA 2CNKB 1W0UA 4ZLPA 4MKVA 3AODA 2VKEA 2ASDA 3DRXA 1FESA 3SQNA 2FD2A 4K4SA 3HVTB 1ETQA 3CZ6A 2K7KA 2GIZA 3K89A 1Z6TA 1YRUA 4IQJA 1FVSA 3CEDA 3PIOQ 3ROUA 3CJRB 3BDEA 3KK2A 2BE7D 1LWXA 5JFRA 1LDDA 2FVPA 1ZAWA 3GMEA 2JEJA 3BR0A 1BGXT 3CCJS 3AA9A 1NZAA 1WVRA 3Q86A 3OVAA 2G2YA 2XEXA 2W82A 1FZPB 4XN0A 1MMAA 3DXBA 4OI0A 2LP0A 4N4NB 1BM9A 1IDZA 1MW7A 2A3SA 1S1TA 1RWXB 3GFMA 4KRWA 3V42A 3BTCA 1EHWA 2VOPA 3HHGA 1D0YA 4M94A 1UVMA 2RH3A 2BQUA 4R8UB 5H9EK 5L3DA 2NXNB 2KDOA 4P73A 1IG7A 2H6CA 1HHSA 5JVGF 3A4CA 2WAQN 2ZH9A 3DLEB 2I9SA 4NXMJ 2B6AB 2DA1A 1NCLA 2ZH6A 1V5GA 3PW4A 4HNVA 3R5BA 4BWMA 5K1YA 1YJNS 1CJTA 4LF5F 2UUZA 3GIJA 1SH0A 2F4FA 3GXOA 2CJ9A 1S0VA 1BUXA 2ZJ2A 2X4HA 4MH8A 1W25A 1SKUB 5E3AA 4YB1P 4IO1A 1NO8A 1ETWA 3VGUA 2NR0A 1Y1WJ 3MAAB 1XD7A 5IYBJ 3E7LA 3QATA 2LA6A 1ELOA 4X64F 1L3VA 2Q0OA 3Q9SA 4Y6IA 3FXKA 4Q0BA 1ETXA 4Y0FA 1GV2A 3NG8A 4B9UA 2L2OA 3ECHA 2HHVA 5I3QA 1UJ8A 2HOSA 2RJZA 4CT9A 3LP0A 5ICEA 2P6SA 1G4DA 4F3OA 1YIOA 3W6VA 1ON1A 2EILH 3LW5C 2VG7A 5F27A 4IOAQ 4U7DA 2XGPA 3KHLA 3UPFA 2F5VA 2ZFUA 3GLJA 4L0ZB 4DPTA 2W9CB 1SD5A 2HKXA 4FVMA 1U6GA 1FEXA 2P0WA 4MFDA 2I0XA 2NZCA 2EK1A 1RCOB 7AT1B 4ZOSA 3S2WA 4S05A 4L5EA 1YO5C 3I5CA 2IP2A 1FTCA 5HAOA 1U47A 3QT6A 4HF2A 1T3OA 3E01A 1TU0B 1WF2A 1OYYA 2W2PP 3FHNA 2RF2B 1JB0C 4LVOP 1WQ2A 3PNIA 1I6XA 1BR4A 4ZS6A 2W9BA 4PUOA 2IA0A 4W4MA 1BOBA 3J7ZT 2E2HJ 4YQWA 2DR7A 1R8CA 3PUBA 3BSCA 5FKLA 1RT5B 1S6LA 5KFSA 1WHYA 5KFHA 1GT0C 4OYXA 3CPWR 3BN7A 2YPYA 1TFYA 2RAEA 5IV4A 3I5UA 1NNDA 2Y30A 4RLEA 3RTVA 1S48A 4N41A 2HVSA 4HV6A 2XLKA 3OR1B 2XY7A 2KN4A 1Z2ZA 2HS3A 1VQYA 2R5ZA 1XMBA 4EJUA 2KU7A 3NEKA 5D15A 5CA5A 2EKYA 2YQ1A 2UXXA 4ZKAA 1MD0A 1ITYA 1B59A 3CMYA 4JP8A 1JT0A 2R8IA 3P96A 5M3FJ 3GZ5A 5TISC 1RJJA 2HMIA 2ZUGA 3KLOA 3K2YA 3RBZA 1YQAA 1NK9A 4J9NA 1S59A 3W66A 4G8XA 4HG2A 2KM8C 4MIWA 4DF8A 1VBKA 4LR7A 4ZLJA 1AA7A 2WVEA 3KKFA 3UNGC 2VKRA 4XL9A 5A2QZ 4U7UK 3RI4A 4RW8B 4RUAA 2GJIA 3C6TA 2W7NA 1Z7UA 2DTRA 1IRXA 1HNIA 1B72A 2R2SA 2QRRA 4OI1A 1IBLJ 5BNGA 2LRDA 1FOWA 3DTKA 2YKQA 2DW4A 2XV4S 2R3VA 3EDRB 1ZPVA 3CDLA 4PUSA 1TL7A 2JDJA 5JVGQ 5H6QA 1WJDA 2YVSA 2Z2LA 2DPDA 3WC2A 2O8KA 3LH2S 1RT4A 1KS2A 1NH3A 2AJ0A 1ZM2A 4KC5A 2EEYA 5LRRA 1X9WA 4HSTA 4WP3A 3MM9A 1T03B 2KRFA 1YE9A 1G1XA 2DNQA 3FM3A 3SQGA 1IO2A 1AYEA 2QEXS 1VRUB 3V81B 3OYDA 3ERED 1R00A 1AW0A 3NXZA 1DP7P 1APSA 2RKIA 5K5MA 3L7UA 5HODA 4XRMA 3HDSA 3CDBA 4FDFA 3MF5A 3P5TL 4UXNA 4LRFA 3D9BA 4LOCA 1Q1VA 4PJLA 2ZJPQ 1R27B 3OD2A 4LQ3A 1HWJA 1NJYA 1EJ7L 2HVIA 1GTEA 3L00A 3SCKE 2OTJI 3RBEA 1RWVB 4P6QA 4I1TA 3FEZA 4RW7B 1ZGAA 1S72S 1JTXA 3PR5B 4J7CA 5F04A 1LUJB 3BR6A 5D6FA 4HPQA 2LD5A 2EA4A 5EF6A 4DV4F 5HJXA 2QSGX 5E33A 5DCFA 5FLMJ 5CPRB 2V6AA 4FS2A 3SYZA 3VYSB 3TP3A 2KHCA 2O66A 1NJIT 4KO0B 2XO7A 5J1RA 2DGTA 3FXUA 3EZOA 3ZMTA 5HI7A 1HCRA 4XBFA 3MEEA 2K9NA 4KN7X 2X48A 3DEUA 3PX0A 3QAHA 1RT2A 5H6RA 1GXUA 4I2OA 1HQEB 3DOMB 3CUNA 4PGGA 4DSIA 3ZCOA 1QVGR 2EFGA 2BZTA 4RM3A 3THVA 3JQJA 1R0AA 5FB2A 1TQLA 2DGXA 1HHTP 4A6EA 5H2FC 1FI4A 4EZ9A 2YU3A 2XCAA 2XGXA 4K4WA 2IDEA 2P9CA 1QO0D 2OAZA 2IRUA 2JEFA 4WFNQ 2GHPA 4DUZJ 2MQPA 4IDKB 4I6AA 1S9GB 1L3SA 5E5NA 2R0QC 1T39A 4XKCA 3TO7A 3KCCA 2LH9A 5J47A 1VQ6I 1H0MA 2RUSA 1OYIA 4LB6B 3PKMA 3WHCA 3GB0A 4X4PA 4CH0S 4M6XA 1Y8RB 1MNMC 4USUA 4P72A 1S1WA 3IXQA 2R93J 4HEA9 2UXBF 3OFHA 4KIBA 4YP3A 1HKTA 4EU0A 4X62J 1NHVA 1TKXB 1RHRB 5GAHU 2MZTA 4O4GA 2DHSA 2GGPA 2ZB9A 3OBIA 1HQUA 2WC2A 1IN6A 2KZMA 5CZXA 2H5IB 1ZKGA 4CSWA 3DLAA 3VODA 3GYHX 3LOUA 2IVMA 2PFDA 2EFNA 1MSFC 4A3JJ 4NASA 1BR1A 2WVFA 2K1RB 2VA3A 3HYIA 2O1PA 1WI3A 5ETPA 5KFIA 1I3OB 2WAEA 4I0WA 3I0RB 4TU8A 4FKXA 3R2CJ 4B3TJ 2RKHA 4AVPA 1FK9B 4PSWA 2MG4A 4CHUA 2KT2A 1VI7A 2H5EA 4AYBD 5AONA 3KYDB 3WE2A 1UFLA 3S14J 4DR3J 3A3OB 4AU7A 1K61A 5IT9U 1CPZA 1J2VA 4B08A 1N5YB 5K8OA 1OQ3A 3BQZA 5FO5A 3UD5A 1F43A 3M8EA 1T9TA 1VLYA 2V1DA 2H3EB 3VYUB 1B6AA 5C25A 2ZNZA 3IRXA 5L3EA 3C14A 5D8KB 2UV8A 3EPIA 2LG4A 2VUMJ 4Y7NJ 5T14A 3N6MA 3JSYA 1IBMJ 2EV0A 3KP7A 3OR1C 1IQZA 4QW9A 3PIPQ 3C18A 5HMZA 3SV3A 4PQUB 4DL0C 3CD5A 4NA3A 1RADB 4ZITA 1RT1A 3T5KA 4HL9A 2MBFA 3TJAA 5HANA 3DEWA 2GNKA 2CW0F 3KLFA 3P9KA 1SV5B 3PJ9A 4DS4A 4M6YA 3BKUA 2KTQA 2XB2D 3U2RA 4K2JA 1GMUA 1FOXA 1ERDA 3TX0A 4II3A 4CCHA 3W2VA 3W61A 2X6OA 3EGVA 3HRSA 2AQFA 4O4GB 3MDFA 2XS7A 1AUSL 3Q8YA 1MDMA 4NRTA 5LHHA 3HMJG 3IH2A 2ASYA 1XEZA 2HGLA 1NK7A 2HWVA 1SC3B 2Z5UA 4B8XA 1T05A 1L3LA 2FVCA 4LF7F 4MKBA 2ZH5A 3E3XA 2VPXB 5F9LA 3DGPA 3ZQCA 2HAIA 2JRTA 4DIQA 1NSPA 1TP4A 5E8GA 4EJVA 2H51B 3J7Z5 1FNNA 1DDNA 3CJ4A 3PFEA 1I94F 3G73A 3O3LA 4TYBA 2KL8A 4UOFA 3CJ5A 1XX5A 4UV9A 4B9TA 2KLOA 3CC7I 1LFPA 2AYEA 3UN5A 2DNYA 2IRXA 2JZ5A 1ZK8A 2DK2A 3M32A 2XIGA 3SXLA 2HAFA 3A01A 1OSCA 2R8HA 3HFVA 1U6FA 3IWNC 3CF5F 3TUJC 2VV5A 1OR7C 2LXUA 5LXYA 1IAWA 5HLFA 3ZZOA 3OLBA 2TRTA 5D6GA 2BHYA 4DV3F 1WSUA 3VR1A 1GV5A 1XGOA 3GTLJ 3CJKB 4N8OA 3AJDA 5JLXA 1T56A 3CCUS 3CCVS 2UXDJ 1WUUA 4BAYA 1WKJA 1VHFA 2W2OP 2DMUA 2DQRA 3M8PA 1Q5YA 4X2BA 4DYRA 3OV8A 1ZG5A 4A8XA 2BDPA 4QIGA 1VBXA 3BWGA 5D0GA 3CP2A 1JT6A 3EVOA 5AE1A 2HVHA 1NK4A 3SBMA 2EQRA 2GIVA 2ABYA 1SMTA 2F5GA 1ZG3A 1IKVB 4IVNA 2J0SD 2WA0A 3D28A 5E41A 5MAOA 4WYWA 2KXNB 2IAJA 4UF4A 2DB1A 4DL2A 1VQNS 4LF6J 1IUFA 8RUCA 1OY6A 1DURA 3CMAI 3HXMA 5AIQA 2XGQA 3PL8A 3J7YJ 4XLEA 2U1AA 3QO9B 1U5TB 3EYYA 3EDQB 4MMOA 4X84A 3HK2A 1FFWB 4FHTA 3R8YA 4HX7A 4NC6A 3IAM9 3BGRA 4ZVSB 3POTA 5F8GA 2DA3A 2V67A 3IM9A 5JVTA 3VFZA 5D4OA 3TOAA 3A01B 2LFBA 4Q8EA 2Y1JA 1SD4A 3VAFA 4DR5J 2DCEA 1J5EF 2BUNA 5AE3A 4KKOB 1B0TA 1NXIA 2AYBA 3CCLI 1VQOI 2YXLA 3K5PA 2LF8A 3EVMA 4L0YB 5KT6A 2UP1A 4YG2F 2QYGA 2HNHA 4NCGA 3T6BA 4H4MB 3QNWB 3NGRA 3JRHA 3HT3A 2JHEA 4QU7A 3C6TB 1H2UX 2RUGA 4NXNF 2VA2A 3GV8B 4Q8FA 4YFKF 1U0HA 4UV8A 4FKYA 1WACA 1PVEA 2HK3A 4LFAJ 3KLIA 1QVUA 1WF0A 4DPWA 1PGZA 4Y2KA 2HVRA 1JKQC 1VRTA 5K8MA 3FVYA 2VQEJ 5K9FA 2F5DA 4IXAA 1ZETA 2VG6A 5G0RB 3FEXB 2A6MA 3H3UA 1CSJA 4BH9A 4P2FA 3ML6A 2TCTA 5DS7A 2NVYJ 1LWEA 4WU2A 3BJYA 3CCWA 2QQBA 1FBUA 1RWWB 1N0UA 5A8RB 4AT1B 4DPXA 2W2NP 1KQ9A 5DDRC 1I50J 3UWTA 2A5WA 4BHPA 2GVDB 4HRIA 3LSHA 1UVKA 3MOJB 5HDKA 4ZPVR 3H40A 4WE1B 4X0GA 4XORA 2GFFA 3AOAA 3P4UB 4J9MA 5B7WA 2OD6A 1DU0A 4IO9F 1X4HA 3GMGA 2FJVA 5ILSA 3OVSA 1TVRA 2XG8A 4CO8A 1W2BR 3ABKH 4UNOA 3JAMZ 1KQSR 4EM1A 1B0VA 3FXLA 5C2CA 5HLGA 4M72A 3PW0A 4OYBA 1RLCL 3N01A 4C0BA 4JYAJ 3UVJB 1YJTA 5D5XB 2R7VA 3MHYA 2Y9YA 3FM5A 1LWCB 1MJ9A 2MC4A 1NDLA 5KFWA 3WG9A 5K5RA 2CQQA 1KLMB 5DZ6A 2Y0SN 2CUFA 3TANA 2RC4A 1U24A 2FYXA 3ZQIA 1XR7A 3KPHA 4KJZA 1ZN2A 1HD0A 2UUCF 2PJRB 4ZN3A 5E3NA 2DNMA 1XNRJ 4EBCA 5LGUA 3KOAA 3NEUA 3GFJA 3Q3SA 3PRVA 4NNJA 3HHLC 1ZHFA 4A2UA 3HKWA 1WC0A 3IBFB 2J8AA 3G1OA 1FX4A 4N4OB 4C8OA 1ZYQA 4BEHA 4HQEA 1RWPB 2GXGA 2ZH7A 2ID3A 2LEPA 3DXJF 3IS9A 4ECVA 2VT2A 2MMYA 4LFBF 4MYTA 3GU0A 4RGXA 2LQ5A 4BC9A 4F25A 1SB6A 4XNFA 2MGQA 2GOXB 2XASA 2L0KA 5B1AH 3J80U 4NC7A 3KHRA 1K1QA 1SKWA 1LV5A 4KIFA 2VKHA 2WCXA 3GE9A 1P1TA 4Y4RA 1G3WA 2MTLA 2PG4A 4RKUC 4C8MA 3K1NA 4OZ3A 2QTWA 1B8IB 3TJ8A 1D8JA 4IDKA 4R8UA 2GA7A 4PXCA 3C46A 5J40A 3IS9B 2DJIA 3EZ5A 4Y52J 4NX9A 3NS6A 5ETMA 3VCDA 2G2ZA 1RKWA 3RB4A 1Y10A 3F73A 4B09A 4PQUA 1RACB 2R7FA 3LWLA 5KFTA 2DPUA 3NRBA 2IT0A 4PRFA 3M3YJ 4QZVB 4CA0A 3IRXB 1KD1T 4EGYA 3MZHA 2FLPA 3T1BA 2MKKA 1HNZF 2Z56B 1FSEA 1HQEA 3H0PA 1VBZA 1WI9A 4EWTA 2VLAA 1QE1A 3SIPB 2FU4A 2BA9A 1RT3A 1FRXA 3EGNA 5DQGA 4PWWA 3GZNB 5LHIA 1RTDA 1OQYA 2YH1A 3K59A 4RUCA 3K4NA 1JWWA 5F8LA 4F91B 1R31A 4ZPAA 4DS5A 2KYZA 2O7OA 3VEPA 4KGZB 4OYAA 4N76A 2VJ5A 2X3DA 5EDNA 3P6YC 2RQCA 4OX8A 3J80K 3MOZA 4IG0A 1XTAA 2GVDA 3F0CA 5KAFC 2FJ1A 2EPIA 1WG1A 4PJNA 4OMYA 5D0EA 5IT4A 2AYGA 4LSZB 4DV1J 2M0CA 3GR0A 5IT3A 4ECRA 1DTTA 2KDZA 1S1VB 5CYMB 2GIFA 2ZH8A 2DFEA 4ZVUB 5E3LA 2PC6A 2YKAA 2VFRA 2VIXA 3MCNA 4ILRA 3L2UA 1RT6A 4YFNF 5I4MA 1IXSB 2QKLB 1VR6A 2HURA 3BBBA 3ISNC 2HS0A 2AF6A 2VXZA 1NMEB 4ZDNA 1BJAA 3SQGB 4MFEA 5KFFA 4QWEA 2HVZA 3UQSA 1RKJA 2ZEJA 4LF8F 3BR5A 3KDOA 4IEJA 3PR4A 2V9VA 3WU0A 2KT0A 3TW6A 3ZMVA 2RQ4A 2DIUA 2DNKA 4ED8A 3GWZA 4CRJA 9ANTA 3LSGA 4YDXA 2HHXA 2OJED 2OELA 1N75A 2BE2A 1FMVA 2M9KA 2F8MA 2QX0A 3GILA 4BXXJ 1QJHA 3H5SA 2E2JJ 3GTQJ 2AXTC 1TL7B 2UVUA 1DFDA 3M9AA 5B1BH 3RZDJ 4C11B 3DCFA 4I2PA 3W63A 1RE1B 4IQ4A 1BQNA 4DUYJ 2C2OB 1F1BB 4JI2F 3OJUA 2OCCH 2UVRA 2JRSA 2AZ1A 4I6YA 3VQTA 4DL5A 1ETOA 2R92J 2VFTA 3LPEA 2QLFB 4GMKA 1B4SA 4CIOA 2X85A 5L39A 1F2GA 5K5OA 3L9ZA 2DCLA 5GAGU 1CGPA 2N4DA 4BE2A 4ZMMA 2OLWA 3H4BA 3K7RA 2A1BA 3GCWP 3ENAA 3G4SI 2B0LA 1MJBA 2O3DA 4DQQA 2QQAA 1T3NA 4KKOA 2BW7A 2QGUA 5DDPC 1NK3P 4E98A 3MZYA 3F8NA 1FT8A 1QSYA 3F8CA 2EJRA 5A76A 1MG7A 2VDHA 3UD4P 2RS8A 4EQQA 1U2CA 1NHKL 4ZDPA 1VQSA 3S2DJ 4Q2MA 3WZ0A 2G0JA 2I5JA 2M0GB 3V6DA 2E7VA 2W01A 4IQXA 1FKOA 5HVFA 2EA2A 1F9FA 2D2WA 4FPIA 5KNLA 4CYCA 2OMLA 2CNNB 2D3O1 1JX4A 1X1CA 3RJPA 5FKMA 3A3NB 5DZ7A 2HQ3A 4RDUA 3PO3J 4UVCA 4A4JA 2ZC4A 3RPUD 3CESA 3RPUA 2RU3A 2A05A 2G4BA 3C2HA 3M30A 3BN4A 3BJ6A 3CJ8A 2C3YA 3PY8A 2VL8A 2BOPA 1Q1HA 4RB2C 1S8NA 5A0YA 3HJFA 1HW1A 5G4DA 5LXRA 2V8DA 2M4MA 3FIWA 1X5TA 1FA0A 5LMNJ 3GFLA 2OPRB 5ETKA 1YRTA 1CC7A 1BXNA 1R71A 1Z1ZA 2F48A 1N8RT 4DV3J 3QWPA 2HHUA 1R0BG 2OJ3A 2KJBA 3KG0A 2YX4A 3L2WA 3ZNJ1 3FK7A 3U1MA 3BG9A 4NMXA 3G8TA 5CXTA 2R7WA 3KNGA 1G2EA 4BU2A 4DCOB 4OI4A 2P5VA 3W9JA 1QU3A 4ECYA 1EP4B 3RB3A 3ZOBA 1NAQA 1E3PA 2VG5B 2EINH 1QHHD 1VBYA 1JGGA 3K8WA 4M5NA 1K44A 3K4MA 3KEYA 3DTEA 1CJUA 1M1GA 2HI3A 3GEZA 3LWMA 1FNOA 3K2ZA 3HHLD 1NK8A 1V3FA 3CCLS 3OFGA 4IO9Q 4G65A 5J1NA 3ZXWA 1FJGF 3GO5A 3BKTA 4ED4A 2F6CA 4L74A 4M3EA 3Q83A 3OL8A 3HCXA 5K7HA 2BHZA 3E6BA 5E20A 4EV0A 4DLGA 1QVTA 1UCRA 1BY9A 1CJTB 4XK8C 2I5UA 5KFUA 4OHXA 4FYDA 4OIPF 2OSQA 2DFFA 2AIRB 4DWIA 3O2IA 4ZHRA 1FFGB 2L9RA 1RAJA 3U1KA 2YPRA 1CEZA 2IAIA 3FISA 1DTQB 1OPIA 3PIPF 1E6VB 1UETA 5GMKa 3LANA 1TUGB 1LEBA 2F3JA 2VONA 2HQIA 3H90A 5M3MJ 2R7UA 5HMXA 2ZFWA 3IRWP 5DEQA 2Z2SB 5E3MA 4IKAA 2WY7Q 5FKNA 3KLFB 1IDYA 5F0UA 4FBUA 1PC5A 4HHHA 8ATCB 4WIIA 1GEHA 3MPDA 1N54B 3TQ1A 3W2VB 2BOAA 1MH4A 2FQ4A 4PJMA 4EGLA 2GZWA 2MFZA 4E7KA 1I6HJ 1SC1B 5KFXA 3SZ2A 4XSZF 4OIXA 4BE0A 1VCTA 4D0PA 1SJRA 4RBTA 3TKYA 1BC6A 4ZPTR 4KNYA 2XHWA 4D3HA 4XLHA 2CWEA 4EMSA 5HDNA 4KV8A 4JV5J 5J1EA 4ANEA 2VD3A 1T8EA 1M5SA 2MGZB 1S6OA 3FSYA 7FDRA 3RZAA 3ZPLA 4NLVA 2FVSA 1X4AA 2V4JB 3T1AA 2IMWP 2JSXA 2A18A 3VAJA 5LMNF 4BNCA 1NZ8A 4AUXA 2LP4A 2VQEF 2OTJS 2WB1D 3W9HA 1ORKA 4X1EA 4C2MJ 4ZPBA 2R7RA 1LNWA 2QYOA 2ZKUA 3PCOB 5J8CA 2NNNA 3HZGA 3MD1A 1WEZA 4H4KA 2KT5A 5IT0A 3NLCA 1KWMA 4KIAA 1L3TA 2OQGA 2Y0SD 3CC7S 3R6SA 4WIQA 1H38A 3GTOJ 5F0HA 2QN6B 1LW0A 3KLNA 3R5JB 4KH0B 5L3CA 1PUEE 1CG2A 1RAGB 2HYJA 1WWXA 2QLJB 3M1EA 4EBEA 2FJDB 5HOOA 2PQ8A 4PJJA 4OAZA 2M52A 4B9NA 4N56A 4F04B 4BS9A 1WTFA 4KY3A 5FD6A 2QCOA 2B6AA 3M6WA 3OUYA 2KP6A 5CJ9A 4G6VB 1RTIB 3OUYB 1ZAVA 3OYEA 1U1QA 3LNQA 3PQKA 4DQRA 3FX3A 4LF9J 2LMIA 4L5IA 1ZG1A 2BJ8A 3BPXA 2G0EA 2PSZA 1FBSA 5RUBA 4HW0A 4L75A 4DSFA 1TK8A 4NDLA 3I5AA 1JLFB 3TBIA 4TKTA 1Q8KA 3DLHA 1YG2A 3Q5FA 3K58A 2B9XA 2GXAA 4UY8I 3NOGA 5K14A 1AT1B 3N97A 4UOGA 3D5LA 4BJ6C 3VWSA 4UOHA 1U49A 1RCXB 1NPPA 1RRJA 2Z58B 2CJBA 1RWNB 1C0TB 2E5ZA 3FGVA 3HSGA 4EBDA 3S01A 1ITPA 2RNEA 4DL3A 2EZHA 2O67A 3UDVA 1Z21A 4RUHA 3G6VA 4DR6F 1SXLA 1SVDA 4MK7A 2ZHBA 1OS5A 4CNYA 3AG3H 4LG3A 4HAMA 3RW6A 5J1UA 3GFXA 1UZDA 4RW9B 3BM7A 3ZQGA 4DX7A 1AKHA 4HQMA 4KHPF 1VZ0A 3MM5A 3DXSX 3BQYA 2HLTA 1IBMF 5E1WA 2DVIA 4AVZA 1YJ9I 5E3RA 4M9SA 1H74A 2RSQA 3IC7A 1VQ8S 3QRFF 1F5TA 2L02A 3DLGA 2ZFHA 2LLKA 1DPRA 1RT7A 1X2NA 3RYRA 4LF8J 3D6FB 1S0MA 3R7BB 2PFFB 5HP1B 5AXMA 4EJOA 3H5UA 1N77A 3VAGA 4ECZA 4LSNB 3AJ2A 3CCRI 1DY3A 2KJCA 3F0NA 2R7DA 1NPRA 3CMMA 1P1LA 1FMWA 4LLLA 2ZWOA 1XMQF 3X3UA 3B82A 1FRJA 2IVYA 4PABA 2E9TA 3FKJA 4M95A 1FKPB 1YYVA 3BR8A 4M9XA 3WGIA 4YHHF 3MKZA 3ILJA 3GPAA 2HQGA 1Y00A 3GTMJ 1S1UA 3DMJB 5T7LB 4YDDB 5KOWA 1BA5A 1N56A 2AP6A 4WYLA 2P9GA 1S5LC 1FTTA 2QA4I 3TRGA 2DT5A 4ILMA 2XZTB 4HLBA 3X1LB 3CMQA 2VU5A 4A93J 1HI1A 2JX2A 2JWNA 5TJJA 4BXUA 4ZCKA 3MD2A 1PCAA 2J6UA 1LWFB 2IGNA 2HZCA 2IXSA 3ZZZA 2E5LF 4BY7J 2P8TA 3IGNA 4I67A 1V4RA 5FLXK 4QQBA 5JVHQ 2DR9A 4XOPA 4IF4A 5C42A 3BPDA 1JNRB 4HDHA 3FCVA 3SDGA 2AEMA 2QA4G 2YWHA 2AO9A 2IBOA 4JI5J 4ES1A 3G8SA 5K7ZA 2M5WA 2JH3A 5BXIA 3ILLA 1JGSA 3RB0A 1VS3A 4HHJA 4AXIA 3R7NB 4XLPF 3OTBA 1HYSA 4S0MA 5BJRA 2Z0GA 1VQPI 4CO2A 2IY5B 2Z2YB 4B3OA 1Y39A 3AA8A 2DGVA 4IFVB 5F1JA 3DRPA 5FDLB 2PFBA 4CYDA 3F56A 5D5WB 2JJ7A 3OL9A 3J81U 2W00A 3PW5A 2R4FA 2DKOB 5ED4A 3GJSB 4C3MA 2VASA 3IKTA 1SQGA 5FFXA 2W1OA 3HM5A 4AIKA 1YOVB 3ELKA 5J1YA 1CULB 2I5JB 2XI3A 4HT5A 3N5BA 4OI3A 3UDCA 2BVLA 4Q43A 1X58A 2LKPA 3OTOJ 3LTOA 2ZO4A 2L41A 3V7CA 4ES2A 2R7OA 2D69A 2UXCJ 3L3CA 1YHQS 4CYCB 5F0WA 3WTVC 3ZZTA 4LB5A 3KLGB 1ZRFA 4AL6A 4Q44A 5CQEA 2ZSHB 2DI3A 2GXBA 4C6AA 2MY7A 2OPPA 1KVKA 4I01A 3LO3A 1DJ0A 1QDUB 3M8PB 1YZ6A 4I7FA 1T0FA 3OXLA 4LFCF 2G1HA 4JX5A 4IX7A 1YW9A 5D4SA 4NYPA 4URQU 1YHQI 2XZDB 2RVCA 4MHGA 5KFZA 4USVA 1VIXA 1IJEB 2GJFA 3M8YA 1HYSB 4RAGA 2A61A 3M6UA 2DGQA 4W97A 3CO7C 3UI3A 1WRJA 2AW0A 1B9NA 4E2FB 3K9TA 4N47A 2VQFJ 5L1KA 1KYZA 2DOFA 4Z2XA 4A8SA 2UXBJ 1FWZA 5J6XA 4LBIA 2R5YA 1TL3B 2QBYB 4ECTA 3ISZA 2V94A 1RP5A 3NGUA 3FF5A 2X1FA 2BV6A 3H5AA 5LSLA 4YN3B 4B3RJ 2HOTA 3CO0P 1T9VA 4AC0A 4C3HJ 3ISND 1LKZA 4DEZA 1ZRDA 2LDYA 2VG7B 1Y6IA 4QBUA 4EM0B 3DM2A 2XTJP 1NB2A 5FFZA 2OA4A 1UVIA 4B48A 3CTRA 2AT1B 1H7WA 3TUZC 3P8BB 2QSFA 2HXIA 2DMQA 4ZK7M 1WJAA 2OTLS 2VJIA 3NWTA 2ZSIB 3B73A 2ATCB 4Q0BB 1QTMA 1ZREA 2FSWA 1GXTA 3MCSA 4B3OB 2NUHA 2ZWPA 2C6YA 2OU2A 4MYUA 1AZSB 3ENVA 2DPIA 2BEFA 4DZPA 3DLLF 3A02A 4NC8A 4ED5A 2VPYB 3IH4A 2NXCA 3DDNA 5F1RA 2DY9A 3NP5A 3IRQA 2DA4A 3KX2A 2IJRA 1AA1B 3JRCA 1R49A 5AXNA 2XRLA 4N8NA 1S29A 3AOCA 3QFWA 2MLZA 4XOTA 2YKOA 3HXLA 1DLOB 3KMSA 2B9SA 3ONQA 4XRFA 2RB7A 3TO9A 3OYGA 3OOPA 5KFOA 1S1TB 3FMBA 4DI6A 1YK9A 4KTQA 2WVBA 4DR2F 2KT3A 1ZM9A 5AIPA 2NREA 3OMYA 5CCMA 3UFCX 1RT3B 1KQKA 3VZIA 3I0SA 5BPIA 2AV5A 4DV5J 2JSCA 2DN0A 5J2NB 4KN4X 3Q8PB 3W7BA 3GLLA 4MIAA 1PJRA 5AXLA 4L9TA 3A1YA 3MEGA 1QAXA 5JMNA 4RNMA 5HLIA 1MROB 2KYXA 2PE8A 4B9VA 4GO7X 1ZRCA 3H9GA 4FF3A 5IP7J 4BWJA 4X4TA 3BEGB 5KCMA 2DA7A 2CJYB 1E0EA 2BABA 3DGVA 3Q8QB 1E6YB 1HR0J 4DDFA 2E35A 3A8EA 2J76E 5IFMA 2ZH4A 2F9DA 4MQ9F 2AGOA 1XN9A 4ILLA 1F4KA 1LEAA 2UU9J 2E7XA 4GFBA 2HLUA 4OI6A 2ZKTA 1XNRF 3H7HB 4XLFA 4LIVA 4G6DA 1U0SA 5FLXZ 1MMLA 3VSLA 1HMVA 3IWXA 3DOKB 2ECBA 4ID8A 4DUYF 2HEKA 3ERMA 3LAKA 4J9UE 1ZR2A 2K3PA 1W0TA 2HHHJ 4LLGF 2DHXA 2J0WA 2V4RA 1WEXA 2K8GA 3BZKA 1JXVA 4CLKA 5J8FA 5JHFA 3MPYA 4CM2A 3A03A 4CO5A 3RTRA 5K14B 3P7NA 4N77A 1Q0NA 4LFBJ 3CJQB 1X3WB 2EC0A 1WORA 1JLCA 4J9SA 2OFHX 2GM4A 1RI7A 4R8HA 1IKYB 3I31A 3TA1A 5THWA 2XC9A 3CJ0A 1XMQJ 3BR9A 1BI2A 4ETXA 3T8TA 1UELB 2E1PA 2CPFA 1EQMA 1XIQA 4DUZF 4XLCA 3KJFB 5D0RA 3M6XA 2CQDA 3OHAA 2OZUA 2VF3A 1KOOA 4NOHA 3F72A 4ZC3A 4X4QA 4ZLNA 2Z99A 2FC8A 3QZ8A 1RR8C 1OWXA 1X1AA 1JXSA 3Q24A 2O03A 4A0YA 4KPCA 3OTCA 2GA2A 1NUEA 2HRYA 4OYIA 4I98B 2QIFA 4NEZA 4X65F 1N25A 2MZRA 3I4HX 3Q0VA 2FA5A 2XUBA 1UHSA 2VB6A 1ICEB 3QFHA 1S7HA 1P4XA 3E6CC 1SH2A 3AG2H 3NGSA 3CD7A 3RCOA 4ZLLA 3KFWX 2H1YA 3K17A 2HGNA 1RK8A 4BL0B 4ENKA 2YS9A 1IXCA 2JA5J 4FYWB 3PYEA 3MCOA 2ZOMA 1HI8A 2E1OA 3PG9A 3SFGA 5H9FJ 3DOKA 3PW2A 1HBNB 4F67A 3BY6A 1DPUA 1RSCA 3NCRA 4F2SA 4M8LA 2ZMEB 3KP6A 1IV6A 1WC4A 1NDPA 2K2PA 3BH6B 1EV7A 4GO1A 2YWEA 4AIJA 4PXBA 3M8ZA 1HW2A 1H9TA 2LNBA 2P5KA 4NBQA 3TGNA 3PYGA 1QZEA 4KGMA 3MMCB 4CUGA 1YG0A 3H92A 2OEJA 1JTYA 1TKTA 3HRMA 3LP2B 3MWBA 3QIPB 4KYWA 4DV0F 4UW2A 3OFFA 4HI1A 4OYOA 2LTPA 1F3VA 3P5BP 4ID5A 5ETNA 2VH7A 1HNWJ 3WE3A 1A04A 5E79C 1W1WE 1BN5A 3D6TB 4DQIA 2XSDC 5DTDA 1R7JA 3MVPA 1DGRM 4JI7J 4H4MA 1IR1A 2DNRA 3L7OA 3AFHA 3I56I 1VRUA 3O6BB 4B9LA 2L9SA 3IP4B 4HACB 2QFIA 2ZHAA 5ADZA 3HOTA 1LQ1A 2ZBKA 3DTIA 2D45A 1X31C 1AZSA 2PEHA 1EP4A 1QPIA 2KFNA 4LIWA 2NXJA 3PEHA 2DNHA 4S04A 1FOKA 2QQ8A 1OMSA 2G2OA 1B4AA 2M8HA 3W6KB 4NQWB 2H6BA 4MKAA 2FJBB 3JTHA 1FBQA 2SXLA 3KLIB 2QA4S 2GIQA 2HOEA 1VGYA 1D1UA 3LA0A 1KVJA 5DO2A 1DTQA 1I5OB 4J01A 4Y17A 1TMJA 2HFHA 3JB9k 2PGCA 2ACYA 3KJVB 3WDOA 1U25A 2EFVA 3T19A 2XY6A 1IW7F 2WWYA 2HWIA 3ENQA 4QCLA 2H5JB 4TU9A 4LF6F 2LKZA 5CKTA 4F36A 3MECB 4BDPA 4AD9A 4B9SA 4ZVHA 3MFIA 1P6RA 2FIUA 3HTSB 4NUBA 5D6EA 2LEAA 1QHGA 2M4GA 3GW2A 5HS9A 1JLAA 4N9HA 3I4PA 2D3OR 2V5HG 1W5CC 3ET6A 3FBIB 4ZYDA 5F8NA 3TO8A 3CDUA 5ETLA 1J5OA 1ZYRF 2EFOA 2OPRA 1M1EB 1NK5A 1RNLA 4M5GA 4R0EA 3CJKA 3LSKA 1WJBA 4PJ0C 3A1YG 3IWFA 1K73T 3IA0A 1U9OA 5FLXY 2NVXJ 1AWCA 2E5IA 2CZ9A 3M1CA 5FIIA 3RZOJ 1NTCA 1XTZA 4AL7A 3QGGA 3HOYJ 3CJ2A 3NQOA 5DLGA 3DLBA 2HEOA 3ET6B 4OZJA 2VJVA 4AIHA 3H5RA 3M8WA 1IKVA 4DV6F 1GH8A 3VGVA 4QPXA 5E3PA 4OV6A 4OZ5A 4DV5F 2Y0BB 2EWNA 2JA8J 1A5JA 5H9EJ 2HYIB 3NY0A 2CV1A 5B0DA 2BV3A 4WK8F 5K8PA 3SJMA 3VB2A 1VQ4S 4DR7F 2P6TA 3EMTA 3C2GA 1ONVA 1N88A 2QWWA 4CLYA 5EWFA 1LFUP 2MLKA 1X4BA 2MC3A 1TL4A 1IKXA 1NK2P 2K7JA 1UWBB 1VC6A 4RR5A 1T05B 2CW8A 3V6HA 1RC9A 5KG5A 3AQOA 4LUBA 3CDHA 1XK8A 1FKOB 3BYRA 2E5GA 2ZUAA 2HNYB 3L2VA 4DF4A 1MNEA 3RR8A 3FXJA 3M4OJ 1SAXA 4BQAA 3OL4A 4K4VA 4JOMA 4O0IA 4CM0A 2CUEA 1R3NA 1HXDA 2OF7A 2CDQA 3N4WA 1E17A 5DG7A 4C2UA 2HHWA 2PMZA 1SI9A 2HK2A 1SL2A 1OYDA 2RRAA 3QYFA 2FNAA 5FRNA 2LR8A 1T9XA 2K86A 4KQZA 1XWLA 4JX6A 1N32J 2VFVA 4F0KA 2YTCA 2BBEA 2C2KB 1SH3A 1MZBA 1S97A 1K8AT 2QLBB 2YNIB 4DR4F 4IZZA 4KT0C 2DGOA 2DXIA 4TY8A 1S9EA 2W84A 1R89A 1RT1B 5D0HA 4C3IJ 3AL0C 1EAYC 3IR6B 4LLNA 3UD3P 1FXRA 1LWFA 2NUUG 5CABA 3CB4A 5M2UA 5LEJA 1NKEA 2M2EA 1UWAA 4UZBA 3GLXA 3MR2A 1D8YA 4NZ6A 2EVZA 4CO0A 4E7JA 3SCJE 1HD1A 2Q6BA 4NLYA 4CCOA 4ESBA 1OCCH 1SKSA 1RT6B 2WV0A 4UQTA 4O0NA 2HRTA 4Z37A 2UUAJ 1WZ2A 5DUIA 3S3NA 1SJ1A 1WC1A 2ATLA 1V6HA 3D0GE 4YB7A 1XR6A 1YS7A 2IS1A 2AJ1A 4PGHA 4MTEA 4DQ2A 2VC1A 1DRZA 1D8ZA 1LFWA 6AT1B 5KFPA 3QRPA 2WADA 1O3RA 5C25B 2HFNA 4P9FA 1SAUA 4UB8C 1OQ6A 4QJVA 3M2RB 3CUQC 1UB9A 2MH2A 2XBPA 4M5KA 2QA1A 1KQFB 1Q8IA 5E1XA 5KVRA 3S6EA 2RN7A 4TN2A 2OPQB 2J6TA 2R8JA 5IM0B 5B0EA 2RNJA 2XSJC 2K27A 2LXIA 4HOBA 5LMUJ 1M1HA 3Q2TC 4WXCA 1GQEA 2HQCA 3VZHA 3TJ9A 2HQAA 2KM8B 2Z30B 1S57A 5GPAA 5JHUA 4ED0A 3FKBA 5E17F 4XK4A 4ABZA 1FCAA 2F4IA 2AHQA 2CADA 4OQJA 5ILVA 2CPDA 3DU6A 4A3GJ 1M1KT 1MWZA 4DG1B 3B6BA 4RS8A 3MN2A 2VJUA 2MH9A 1UG2A 1FEEA 2WBMA 4U8YA 2VL1A 1FWPA 4XLNF 4HNUA 3WTSC 3MAJA 3HHEA 1PYTA 5EUHA 5IOLA 4PK4A 2HHSA 1VHIA 1YWXA 1VFCA 5M5YJ 1NK6A 1UW4A 4UUSA 4F4YA 1E3HA 1U2WA 1CQNA 3BOQA 2DTJA 2VKVA 1IC8A 4A12A 4NWBA 4A5NA 1HOMA 4JI1J 2XMKA 1LK5A 2C2EA 4G6QA 4GGGA 4WFYA 3E6DA 5I3PA 4ESFA 3COAC 1XDSA 3HSDA 4LG0B 1ZGWA 4OHZA 2E5HA 1H98A 4DCJB 3OQ2A 2A6EF 5LRSA 2OTLI 3AY0A 2DHGA 4DG1A 2E5NA 3PVXA 2FTRA 4B4CA 3S3MA 2C3PA 3DLKA 4PZJA 1CVJA 4CH7A 4RWXA 2FZCB 1RESA 2GV1A 3R97A 1XGNA 2N3OA 1Q8BA 2X6WA 2XAFA 4MEYF 2DK5A 3KLVA 3BS9A 1TUWA 1JQGA 3QPTA 4XN3A 1Z1DA 2XI2A 3A4TA 4P9UA 3OR2C 5E7OB 1S6QB 3SMZA 2FLLA 3PO4A 3BGLA 3G6XA 4Y13A 1RGVA 1HW5A 1UWBA 5TRDA 3H59A 3MM7A 1TWGJ 3VWBA 4X64J 2YNFA 3FBBA 4ZJOA 1LWCA 1TL1B 1JHHA 4QWBA 3R9LA 4OHVA 3ZZRA 1YSJA 2RD5C 2LREA 3CC2S 4JI0F 3I0SB 3JSPA 5E3CA 2MQOA 2IJLA 1NRKA 3KEOA 4OU0A 1WJFA 4CTAB 3DBLB 2HZVA 5HROB 2ROEA 2V4JA 2GO9A 2BYCA 1XQIA 3E1SA 4LF7J 3LP1A 1A35A 3CC2I 3ZR8X 4XPEA 4L18B 2YWWA 1XG1A 1U1RA 2V26A 5J2NA 2KKHA 5KFJA 2CUJA 1FPQA 3D6HB 5ITHA 2CO5A 3AG4H 5EZHA 1N5QA 4B3MF 3D1QA 2K9LA 1HF0A 2V1NA 3PACA 1T03A 3O8GA 4JI7F 5GPCA 1R1UA 4OFZA 4XR6A 3S93A 4U9RA 4UY8T 1IF1A 2OD4A 3PKYA 4HZFA 2ADUA 2E9ZA 4MGRA 1OCPA 2NCKL 2LDIA 1N36F 1DLOA 2DR5A 3W2AA 4KGVB 2CPXA 9RUBA 3GV7B 1FOYA 1R5ID 2O3FA 2RKIB 2JEIA 2A2CA 2R42A 3QJJA 2A5YB 3QSIA 1F6TA 3U1NA 2WOMA 2ZM6F 2UVWA 3EPGA 2RILA 5A2QK 2ZE2A 2QVOA 3VVUA 2XB0X 1MGTA 2X1EA 3DPLC 1B72B 1N34F 3BO2A 2WTFA 1OCZH 1B64A 2EXUA 4B47A 4P52A 2VG5A 1YJUA 2BQ3A 2L7FP 1KQ8A 4I4BA 3KEQA 4MFBB 2XF5A 4P10A 3TVKA 2XAJA 3JYTB 4GYIA 5B0BA 2FJEB 3T5XA 2DEIA 2HMIB 1ZELA 4LSLB 2YUSA 4P9SA 1SJQA 4P1WA 3O44A 3K4LA 5HJYA 1SBRA 2DO4A 2IA6A 4WXWA 2W9BB 4PUOB 3GTJJ 2R9LA 4F4KA 1Z6RA 2WONB 3LUYA 4WJBA 4DV6J 4Q5SF 3MFHA 4F7VA 3J7AN 2Y69H 3HTUA 3I4NJ 2ZBCA 2N3LA 2CQNA 4GRIA 2VJJA 3D66A 2GO8A 1AFJA 3MXHP 4WZMA 4GVBA 2CW7A 4OX6A 2P7VB 3M7VA 4W1UA 4HYKA 1Y56A 3Q8VA 4ICLA 1U26A 2GW8A 2RF2A 1JUSA 1MBHA 3BBCA 4WF9Q 2XY5A 3EGZA 1A7GE 2B4UA 5HQ8A 3GIMA 1HWKA 1VQMS 3P49B 1TZLA 5ERIA 4RU9A 1Y0UA 3LP2A 3OJSA 1R6YA 4A8WA 5HLFB 3G71I 2DXFA 2WVCA 3WC0A 2XRNA 1IN0A 2R3SA 2ZDOA 3I9V9 2XAUA 1MSWD 1BW5A 3JQMA 3DF8A 2L7MP 3MM7B 1FYMA 1FIAA 4DSEA 4JI3F 2R7XA 1GUUA 1FXLA 4M73A 2OGUA 3VQSA 2KJWA 3OYLA 1PAEX 3GTKJ 1IWGA 2FY8A 3MECA 3EUKL 1RWKB 3OYMA 3HHLA 3EX7B 1X60A 4PG4A 1BQXA 2EFPA 3B78A 3LAJA 1QM9A 3KG1A 3OWTA 1F0XA 4MIMA 2V1UA 2PMUA 2XMVA 4Y15A 3AJ1A 4X66J 5KG3A 4EYHB 3CWJA 4HV5A 4U0VA 5HLHA 1X4EA 3HDDA 1YJWS 5K8NA 2F4VJ 1RUNA 3QP5A 1FO1A 2XHKA 3LL7A 4IFYA 3BKFA 4LF4F 1LE8A 4RL1A 3IUOA 3L7WA 4Z7YA 4CCMA 2XZWA 4A3BJ 4UVBA 2L9DA 5F8JA 2EIKH 3DGPB 1JLQA 4O3OA 3WGHA 2BM0A 4YY3F 2OIHA 5CYVA 4RUBA 2CFOA 4QU6A 2M7AA 2MD5A 4A6DA 5DUKA 2HR3A 3N0VA 1RDRA 3MD3A 3CJTB 3ZQ7A 2ALZA 2MYFA 4ANDA 3GFIA 3E6MA 5GAGJ 4NZ7A 4YR2A 2E71A 1NPKA 3R7SB 4LFAF 1OCTC 2D74B 3N9UC 3AD9C 2F5EA 2JLEA 1ULYA 1PILA 2GJ2A 1FWKA 4CZZA 1C4AA 4LVNP 3NWSA 1XNQF 1P8GA 3C14B 3S15J 1E2XA 4DFPA 2DRAA 3RRKA 2LVWA 4WTOB 1SQEA 3RUBL 2RREA 4DSLA 3MAQA 3N28A 5F3ZA 1X0FA 4NE9C 1Y1VJ 1F5AA 5KFMA 1YVFA 3H3ZA 1QSSA 5KFYA 3F6OA 2NPFA 3SV4A 1UEVA 2MLYA 4M3BA 1R4MB 1VQ4I 3E3VA 5ETQA 2ZJRQ 5DETA 4RLFA 2GS8A 1IVZA 4QWQA 2CG4A 1N78A 5IM0A 5F6FA 4YHHJ 2KVIA 2WSEC 3UR3C 1X4CA 4R0JA 1IQTA 3ILOA 4KYZA 2W7PA 1R23A 1M5OC 5LMUF 2DMPA 2L5QA 3C6UB 1B3TA 1FC3A 4D3GA 4J9RA 1N5YA 3TZYA 1KKHA 1RKTA 3QLHB 3QGPA 3DFGA 3DWLE 2XAQA 1KU3A 2DNZA 1Z7LA 4PEOA 4RJVA 3WTXC 2M70A 5LHGA 3NAHA 2KISA 5KG2A 2HQ5A 2RQKA 2OPQA 4MKYA 5J2QB 2XGDA 2IM2A 2E34A 1I3AA 4EEFG 3CUQB 1WHWA 4MAKA 1GX6A 2ZBPA 1GXQA 3NAUA 4IRGA 1A36A 3IH3A 3HG9A 4K4YA 1BIBA 3CDWA 2BBYA 4PG8A 1VQLS 4AL5A 4ECWA 4HLXA 3PRBA 4P55A 2MLXA 2YKMA 3UNYA 2M0MA 5LGTA 3HVWA 1OIAA 1CQTA 1C4CA 1JLFA 4NI2B 2LBFB 1FKAF 1FP1D 1O6XA 1U1KA 4ZDOA 4EZ6A 3OYAA 5GAEJ 3D1NI 4A3IJ 1WELA 5JXSA 1GX5A 1XGSA 3S8SA 1OY8A 2NS8A 4FF4A 3SZTA 3G9CA 3HFKA 3T9NA 2Q66A 1RTJA 1TUVA 3W64A 1Y4ZB 4MK9A 3BDPA 4QWCA 4KB7A 3R60A 1S9EB 2KG0A 4WP9A 1L0OC 5L3FA 4FE7A 3CDIA 3I55S 3SEZA 1ODDA 3C2BA 4WF2A 2M88A 3FJ2A 1XDUA 3S2HJ 4ZYGA 4PAAA 4LIUA 4IHSA 2DH7A 4P2MA 5IS2A 2KMUA 4CICA 3BO3A 4M9ZA 1QBJA 4LF5J 3PM9A 2YR2A 1FDBA 4UB6C 1K1SA 4ZZDA 3E5XA 3T5HA 1WHUA 1RBLA 2EV5A 4KSEB 4EO8A 3HI9A 5A8KB 4B3SJ 4NL5A 3L2QA 4N5SA 5HO4A 3LSRA 4RW4B 1X5SA 3T1HF 4X4SA 1R0AB 5F9NA 3KUEA 3IMQJ 3I56S 1EF4A 1J09A 1V5VA 4DL7A 2YY3A 3R61A 3SDBA 4FASD 2KHDA 3MEDB 5IYDJ 2JVOA 2FPHX 2R5YB 2AGPA 1RXOB 3P9CA 4OJ1A 2V8PA 3HHHA 4CYUA 3PO2J 4JI1F 5KG6A 3MR7A 3MCMA 2DEJA 1TR0A 4KT5C 3TUPA 3HOUJ 2G1DA 3MM6A 4DW6A 3J81Z 1M0SA 1X1PA 3KK1B 2R2RA 3K69A 3VGTA 4GXOA 5C24B 3F41A 4WE1A 1S12A 2ZBRA 3MUMP 5CZVA 4G94A 5E0OA 4KAIA 2PMZD 5E2QA 2FRHA 1RBAA 4MIBA 5F08A 2LQJA 3BGUA 3HRTA 5HVHA 3EXYA 1R1VA 2ZJRF 2JZYA 1KZHA 1TKZA 3GCXP 1RHMB 4DSKA 2RHSB 2IW5A 4TNOA 2HVEA 3DRYA 3OS1A 3ZNUA 5JUMA 1UVJA 2RIJA 2N8GA 1H8AC 1ZTTA 1ZOTA 3CDAA 4UVAA 4GVBB 1D3YA 5KFCA 1F3FA 2YQ3A 1SJ4P 4BBSJ 2QGFB 1UEUA 4LBPA 1MBKA 1QLNA 3K4KA 3FBNB 3CW2C 3LAPA 5KFLA 2J9CA 1Y5IB 1U5TC 4JI6J 4JV5F 1NJZA 4ZP7A 2NVQJ 4WFBQ 4HR2A 4P5OA 1LWEB 1R8BA 4DBRA 2KHMA 3EUHA 4QR1A 1S4EA 1GAOA 4DL6A 2EKNA 4FF1A 1FIPA 1MH3A 1X3ZB 3OS0A 2TDXA 4A3FJ 4PXDA 1V3SA 1VRTB 3BSNA 3HIFA 3DI6A 2F63A 1EQ0A 3DYAB 2D9PA 2P5LC 3D7SB 2YKNA 4O3QA 2Z16A 1SL1A 2XPWA 4HDGA 1SUQA 2BY3A 2Q6CA 1A6LA 4CLUA 4K5SA 3VPRA 4WWSA 3Q8SB 2H1LA 2DT9A 2EZKA 4ZVPB 3NARA 2AX1A 3ABMH 2V0NA 4IOCQ 3ABTA 3GONA 3A8IA 2ELHA 5IYCJ 5CVJA 4JK1X 1NSAA 1YS6A 1FD8A 4ZVFA 4EM2A 1J5EJ 1TKZB 4G9YA 3POTB 1P92A 2DNOA 3RGIA 3PHTA 3NS7B 3GFZA 2KRCA 1GXPA 1ACIA 5J1PA 1LW2A 2K06A 1K78B 2VPWB 3QO9A 2BJEA 4F2RA 2MABA 1TV6A 1NDCA 3SDEA 3SSRA 4ENMA 4ESJA 2UUCJ 1H9GA 4IH5A 1IUJA 1S1UB 3DMJA 5T7LA 1XMKA 4K5RA 3MM6B 5IQ6A 2W57A 1Y3JA 4ZCMA 4RW8A 3C1DA 4LMYA 4ECSA 1TP7A 3UCZP 2BJ1A 3W1YC 4HACA 3TO6A 4PDKA 3DLLQ 5DQIA 4M71A 1RTZA 1LDKB 3FZBA 2E1CA 2CQ4A 1WJCA 2W9CA 1D9DA 3J80Y 2JUCA 4LSNA 2G9OA 2Z57B 4YRVA 3C15B 3VHQA 5HP1A 3L4BC 4X65J 3D68A 1S76D 2HIYA 1ZA2B 4GKJJ 1UCNA 2XO6A 1QVFR 4QW8A 2PEXA 1A31A 4XIUA 4V19J 5HDGA 2OCEA 3TEDA 3R2DJ 2ZMEA 3O8HA 3OR2A 5JI6A 5L9XA 5GMEA 4EMDA 1TLHB 1FDAA 4IHWA 3S1RJ 2MYSA 2Y2ZA 1VRQC 5CCLA 1HNXF 4K0KJ 4P96A 2L9WA 1IBCB 2XVCA 3IC1A 5C24A 4USHA 1HDDC 3H0GJ 4RW4A 3KHHA 5IV3A 4I02A 2FC9A 4CWBA 4QWDA 4WKYA 2QE5A 2UUTA 1IBLF 2OEMA 1U2RA 5F41A 3J7YI 4FP9A 3KJNB 1HBNA 5B08A 4V19X 3GYGA 4U88A 3U7JA 2KRHA 2QUFA 1OSDA 3MKLA 1UTAA 3GG1A 1GNKA 4EVIA 2KIFA 3ETOA 3FFIA 3QPSA 3V8KA 2VUGA 3ZMUA 4ZPDA 1Q81T 1TC3C 4JQFA 2KRRA 5HBMA 1Q5VA 3IBWA 4DR4J 3LOCA 1UVLA 5GADJ 1XC9A 2ME6A 1CF7B 1MBJA 1KR4A 2ESNA 2CRLA 3EGWB 3OSFA 1WOPA 3OSNA 3ASNH 1I27A 3G3ZA 2HNZB 3H42A 4HYEA 2Z2ZA 5E3OA 2FMLA 1OCOH 2GHWA 3EZUA 3GBGA 2YNHA 3IO1A 3B6AA 2HQFA 2ZZTA 1YITI 2KI2A 1KYWA 1LNQA 2CWXA 1T6SA 5LFAA 4K2XA 3OIOA 1XBWA 1Q1KA 1KSPA 1V3ZA 2PN6A 3HOWJ 2B43A 1WDTA 3CF2A 4KFBB 5A2QY 2KRBA 2UUBJ 3CUQA 3RBDA 2AX0A 2YX1A 1NDKA 5KK1A 1FJCA 1SC7A 5C3EJ 3CC4S 2HHPA 3IFEA 2I2YA 4A8QA 1S1VA 5CYMA 3R1HA 5DDGA 2XSJA 4DN9A 1MN7A 3BF4A 2KQRA 3ZTSA 2XMTA 3W5YA 2NZ4A 4CP5A 4F4AA 4I76A 3ILIA 1CJKB 4JV0A 2FBKA 2LK2A 1NHUA 4PG6A 3I9ZA 2XCPA 3DDKA 4U7CA 4DNCA 1SV5A 2ACMA 2BGCA 3FK4A 1DZ5A 3CSKA 1H7XA 3J7ZI 3SSQA 1LDJA 3CJRA 1REGX 1E6YA 4DV0J 1BQMA 2WAFA 3JSOA 2I1RA 1URRA 3K2AA 1U7LA 2GCFA 2Q8KA 2HTSA 2W4CA 4K0KF 3HZJA 3DOLB 1GXLA 1KDNA 3OS2A 4HF1A 1PP8F 2B9EA 3MR5A 3PJXA 1QE1B 1YLFA 3DDIA 4CCLA 2DYSH 2K3KA 4DR3F 1RHKB 3S3OA 3E5UA 3T41A 3OPKA 1S99A 1VOMA 2VPZB 1D5VA 3DEEA 1IJFB 2HBYB 4OMFG 1U78A 4W90B 1WKMA 4QYRA 5H1SV 3R1LA 4RB1A 4XIDA 3I32A 2PMHA 5FGMA 1KLNA 1TW3A 1U2FA 4F02A 2JNJA 1EETB 4KITB 4NHJA 1N5VA 3M9OB 2JFDA 1KBRA 2IC3B 1SJ3P 1SJFA 1L5UA 2OHDA 3R4KA 3ZMSA 4LGWA 3IV5A 3ZTQA 5CYQA 2Y1LB 2JEGA 1CF7A 3M4XA 2AJ2A 2XWYA 3CDEA 3HPOA 5J2MB 1WI8A 1QTNB 2WY8Q 4ZP8A 3DPUA 3HZEA 4HEA2 1HQUB 5DV5A 5L3BA 5DD4A 3CULA 4L73A 4O23A 5E1ZB 4KGXB 2CQXA 2FVQA 3DKWA 1YITS 2W9AA 5D4LA 4NLGA 1S0OA 1I1SA 2J5OA 4F8RA 1DQ8A 4C0OC 2DHAA 4FYYB 4UTGA 3M8FA 2HIQA 1FRKA 2L3DA 1KHVA 4PPZA 1IM6A 2DGUA 2JRMA 4FPRA 4RPFA 1D1BA 3OOUA 2A6HF 2MZJA 2ROGA 4C3KA 1HR0F 1IKXB 4FS1A 1MU2A 1RU2A 2J9EA 1PC4A 1JLQB 5J4VA 2CPEA 4F0MA 5DG9A 3TAMB 2M9HA 3K7AJ 3T6JA 3JSRA 4G1IA 1JKHB 1VK8A 3JAMU 2FQ3A 4OYPA 3TR5A 4ALZA 3GTGJ 3FXOA 2BMBA 3Q23A 1YTYA 1TL3A 1OO0B 1JLBA 2EC2A 4I6ZA 2V4JC 4RX6A 2QYCA 5CD4A 2E2IJ 3ZO7A 1RWMB 1NG6A 1Q86T 1H89C 3UKGA 3TA0A 1MMDA 1YW7A 1MBGA 3QBCA 1N5TA 3K4BA 4CCJA 5C4XJ 3FFIB 4UHTA 4QIVA 1FJLA 3MPUB 3SFZA 2DNNA 5A2QU 3D4JA 1TQMA 4IRKA 3VOEA 1T94A 4BQOA 1JLGA 3I0TA 3I59A 2O5DA 3MEEB 5KFDA 4M63A 2K3FA 1SVLA 2F8EX 1I94J 1WJ5A 1HBUA 4F7ZA 1EKSA 2F7VA 3CCMS 3G6ES 1V5FA 1KOHA 2AYMA 3C19A 3B8HA 4ZTFA 2DA5A 2HDWA 1WGXA 5E18F 3QQAA 4B3MJ 2YWGA 4K50A 4I7FB 2PIIA 1ZLKA 2DIVA 2KFDA 5G0RA 5HQLA 4M6VA 3ZTPA 4DHVA 1O0PA 5MLCV 3L2RA 3MURP 3W3SA 3AL0B 3HT0A 4Q7AA 5A8WA 4XRSA 2QSHX 2B63J 2CPHA 4TVAB 2MKSA 3JYTA 3H2UB 2MDAA 3DHXA 1OISA 1WPKA 2J5PA 4DUTA 2PO4A 1O3TA 2ZVSA 3TEGA 3DRPB 4ZHRB 3O2PE 2NLWA 3D2WA 2ZOGA 4KBIA 3BDDA 5B0CA 2ZHOA 3RG6A 4OJHA 3R6GB 4C8LA 3F3XA 2VG6B 4KR0B 4USTA 3W65A 4OYZA 1REVB 1EIYB 3BQ1A 2MD0A 4OLPA 2EPFA 1A0OB 2BZ2A 4JOUA 1YX3A 2VPRA 1ETYA 1FTRA 3S16J 3QYBA 5M5XJ 4LJMA 5E8IA 1Q82T 4Y3OA 3CJSA 2F9JA 1UMJA 1C1CA 3TEHB 3PZPA 2M3DA 2L54A 2UUAF 4WXOA 3TI0A 3ZMZA 2B4PA 2A69F 4WZQA 3MQ0A 2HNDB 2HHQA 2GLOA 2V4QA 3GV5B 3A3PB 3I4MJ 2DYRH 3QAUA 2CRGA 2GIRA 3HLUA 2LECA 1DQ9A 2FBHA 2HKOA 2OI2A 2X7IA 1IRZA 3D54A 3TZZA 2D41A 5FKOA 4YR0A 2HPMA 1P4WA 3ZQHA 4OHYA 1U02A 4JV2A 2RNGA 1D0XA 1FERA 3OYFA 2D3UA 1KU7A 3A0HC 1FKPA 1TNSA 4UY85 2B5JB 4NLSA 1SUQB 3M30B 4DL4A 1XN7A 3AFGA 3P3DA 2J7UA 4ZA1A 1Y5LB 1S79A 3TAQA 4UUXA 2K9SA 3JTPA 1YIJS 1BL0A 3H5XA 1FY7A 1VNDA 4MQVA 2YBVA 2HTJA 2C3UA 5B0GA 1RT7B 4C0HA 4NYZA 2WW8A 3PSFA 2ZXIA 3HPHA 3E01B 1F5CA 2MQLA 1HNVA 5A8WB 2IBDA 4K4XA 2KZZA 1OKRA 3P5JA 2Y48A 4DYCA 4BUPA 1GTHA 2J6SA 5IT9K 1QAYA 3U1LA 1PYVA 5EWGA 1X8DA 4OJ3A 1X1BA 4CDIA 1OPZA 2OH2A 4CCKA 1S1XA 2WTEA 1TWFJ 2XLIA 3QWUA 1WG5A 4QLCU 3WTTC 1HBUB 1RHJB 3LSPA 4F3QA 4CTAA 1YX5A 4WKRA 3VTIA 1GHCA 4DU7A 1V9OA 1R9TJ 2GVZB 2QA2A 3QOPA 4LD5A 1BLUA 3R27A 3VGSA 1YDLA 2V63A 2G0IA 2M8DB 3NBPA 1VQPS 2K9MA 4E7LA 3W5ZA 4DR6J 3FNNA 4M74A 3DRRB 2DU9A 1DP3A 5FRMA 4WCGA 2JVHA 2LDUA 3F44A 3G82B 1FJ7A 1HBOB 1H73A 2J7WA 4J00A 3HJVA 1JLBB 2MY8A 3QGHA 2C3OA 2AEJA 2IEKA 2JSPA 3TMOA 1T9WA 4R5PB 3ECOA 3TAMA 2DA2A 3D5MA 2H94A 2HYFA 5ICCA 2MJNA 1STZA 3JRFA 1TWHJ 2LLZA 3FMQA 4OOIA 4OX9F 4DN0A 2W8LA 4IRIA