2L9NA

Structure of the human shwachman-bodian-diamond syndrome (sbds) protein
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
250
structure length
250
Chain Sequence
MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Uncoupling of GTP hydrolysis from eIF6 release on the ribosome causes Shwachman-Diamond syndrome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Ribosome maturation protein SBDS
total genus 44
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2011-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01172 SBDS Shwachman-Bodian-Diamond syndrome (SBDS) protein
A PF09377 SBDS_C SBDS protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.900 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l9nA02
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2l9nA03
3.30.1250.10 Alpha Beta 2-Layer Sandwich Hypothetical 12.0 Kda Protein In Nam8-gar1 Intergenic Region; Chain: A; Ribosome maturation protein SBDS, N-terminal domain 2l9nA01
1ZM3A 2BM0A 3ZZTA 2IVYA 4ZCIA 2XEXA 2ZITA 1ELOA 3B8HA 3B82A 4TNOA 1N0UA 4MYTA 1ZM2A 3EXCX 3ZZUA 1ZM9A 2I8EA 1P9QC 1FNMA 1ZPWX 2BM1A 1U2RA 4MAKA 3ZZ0A 4ES3A 3UI3A 4ES1A 4ZCKA 4M1KA 5G4DA 1ZM4A 1KTVA 2I0XA 4ES2A 1VI7A 3B78A 2L9NA 1N0VC 3E3XA 2EFGA 3OQ2A 4FN5A 4QR0A 4ZCMA 1NYNA 1T95A 4QR2A 2J7KA 4MYUA 2BV3A 3LH2S 1DARA 4QR1A 2CVEA 4ZCLA 2WBMA 2KDOA 2E1RA 2NPFA
chains in the Genus database with same CATH superfamily
1TL7A 2XHCA 3ZMDA 5F0UA 3C7JA 4CO3A 2XB5A 3FBBA 2R7VA 1Q8LA 4RB3C 2ASDA 1P2FA 2WVEA 1RUSA 1PAUB 3DC2A 1UVJA 4IFVB 3M8PB 2GC8A 1FTZA 4FX4A 1F5BA 3DRRB 3O8WA 1W5TA 4UW2A 1JLFA 2NREA 3G6YA 4J9UE 4ZVTB 3VF0B 2R0QC 1BUXA 3AJ2A 2JA8J 1G1XA 4E2FB 4X62J 4XLCA 3FSYA 4IDKB 2GZOA 4ETSA 3QZ8A 2OLWA 4ZVEA 1IJEB 1BOBA 5ICGA 4I1TA 3CUQC 2O3DA 4B02A 2JEFA 4PG6A 3OYCA 1ZELA 3KOAA 1W2BR 1TL1B 2FLNA 2E7WA 2MKHA 5KCMA 1CSJA 1HQEA 3HTUA 2TRTA 2ZC2A 4V19J 4LFBJ 5FRMA 4Y52J 5ETLA 2PD1A 2ZZTA 1O3SA 2VV5A 3I5UA 4DV7J 1W25A 3UI3A 4AE5A 4EATA 2DGTA 2WVFA 5KOWA 3I5CA 3LAMA 2LXUA 2AT1B 3F0NA 3PIOQ 4O0NA 1VBKA 1UVIA 2Y1RI 2VIXA 2HHVA 5DDOC 1LWXA 3QSYB 4NQWA 3WTSC 2X6WA 3GFIA 1IQTA 3ZQQA 1ZG5A 1U8BA 1KU9A 4A3LJ 3PV8A 3FUYA 4Y65A 2Z1DA 1HW2A 5KFBA 1FTCA 4KYZA 4J9QA 4DPXA 3SMZA 3R0JA 4DX5A 2V94A 3LQQA 2B9EA 1T03A 1D09B 1WJEA 1VQNI 1JKHB 3JSOA 3QT6A 5D0EA 1FX7A 2V9WA 3CJ8A 3QSIA 5D4PA 5AJ3F 1TNTA 1V6HA 5CCLA 4KNYA 3E97A 2NOGA 2HHSA 3M4XA 1H8AC 5K20B 2AX0A 3ILJA 2QTWA 4OL8A 2MQQA 2UUCJ 2IGOA 3U02A 5B0DA 2VPRA 4EM1A 2VL1A 1E0EA 2YH1A 1DU6A 1UEUA 4Y3OA 1AW0A 3MCZA 1CS4B 1V5GA 3DLGB 1RQ0A 2V2ZA 3HHLC 2CDQA 1G3SA 3D67A 4OZ5A 4PYDA 1J09A 3U1KA 3DV8A 3DYAA 4DL6A 1RUOA 2GV1A 3ENWA 1HXDA 1NK0A 4ZDNA 3O6BB 3TL4X 2BJ3A 3UR3C 5CQEA 1HL6A 1H7XA 2NYXA 5FLXU 5KAFC 4A47A 4YIFA 2I8DA 2KKHA 4YOEA 2GA7A 1LK7A 2BM1A 3OYLA 3B4MA 2WHOA 2F65A 5KFVA 2XHKA 3J81j 1GX5A 2IAJA 3FXJA 1MZBA 3F21A 3DDKA 5LHIA 2DW4A 1PJRA 3M9AA 3GJTB 1XN7A 3FXRA 4A3MJ 5JMNA 1CJTB 1YKWA 1KKHA 4C9YA 2HSEB 3GTQJ 4L6V3 1XGMA 2XC9A 1SAUA 2C6YA 3RDIA 4DL0C 1VQ6S 3B4DA 3MOZA 1RBAA 1H0MA 1CJTA 2GQ2A 1A5JA 2YKMA 3ESWB 1D1UA 4CCJA 3RRHA 4CCNA 2K7JA 2K7KA 2DT9A 2J0WA 4A46A 4ZVFA 1AWCA 4A3CJ 3BYRA 4MK8A 5IYDJ 4J9MA 2Z2MA 4J90A 1T03B 3CE8A 4OYIA 3KFWX 3EYZA 3ILLA 2Z2YB 2MGZA 3KP5A 5DQHA 4U7BA 2YNFB 2WAQD 2ZUGA 3WTXC 3VGUA 1TWHJ 2AHQA 2C2EA 1XC9A 1U6GA 2PI0A 2BDPA 2AJ0A 3QP6A 1GQEA 1I5ZA 4KT6A 1R0AA 3LPYA 2PJRB 2EFQA 3KK2A 4OLPA 4RGSA 3A8KA 3US5A 2IEKA 3P4UB 1YBAA 2ZZMA 3PIOF 3EPIA 3V81A 5GP9A 2PQ8A 3BCAA 1SVDA 5EHHA 1G3YA 3PNVA 3VYSB 4RBUA 3R61A 1QAIA 2QGUA 2HVSA 1OIAA 4J9LA 4LT6A 3OWTA 1S79A 1W7WA 2HQDA 5E0OA 3PRBA 1D5YA 3RBZA 3QYEA 3E51A 2HBZB 4E7HA 2DR5A 3N01A 3PR4A 2COBA 3I9V2 4HBLA 2P9CA 3N05A 1O3TA 3PM1A 1S3JA 4BEHB 3NGTA 5DJBA 4K2JA 3ISNC 2B7EA 2JRMA 1Q78A 3CCVI 3FQLA 3GYHX 2P7VB 3PKMA 2HEOA 1NKEA 2OPQA 2IVYA 2RH3A 3QGPA 3G9CA 1T3OA 2FBHA 2WY7Q 4KR0B 4PABA 5KFXA 3RR7A 1V3ZA 3BPVA 3PFYA 3DGVA 1IDYA 3H2UB 2VH7A 4CO4A 1U5TA 3K89A 2OTJI 5E3QA 2OEMA 4DEZA 4LF5F 5IPAA 2IA1A 4PJMA 1ZKGA 1FJGJ 4PZJA 3ZQHA 4BE2A 3FXLA 3M9OB 4PFOA 5LGTA 4Y2KA 4ECUA 2AU0A 3KDOA 4R8UA 3R5CA 1RDRA 3ML6A 1OYEA 4V2GA 2MY7A 3SSRA 4JI8J 1EP4B 2GXBA 2A69F 3OR2C 4OJ1A 3VWBA 3C18A 5B7WA 2ZJQQ 5HK4A 1PJ6A 2V7FA 1Y56A 3IRWP 4U95A 4D5CA 4ED3A 2HHTA 2FMLA 1UFKA 1RWMB 1VK3A 1X9SA 4QYZJ 2W2QP 3BSAA 5IT9Z 4C0BA 1LEAA 4MKYA 3D28A 3TUZC 1U5TB 3H3VK 3AA8A 2R7FA 3G1LA 3UCZP 3Q22A 2DIUA 3THTA 4B48A 3AHPA 4A3DJ 4FISA 1ZREA 4O3RA 2JH3A 1HNIA 3M2RA 5DUIA 1OY8A 3HHDA 2K85A 1TVRB 3BDPA 1J0RA 2BYVE 3KX2A 3EXCX 3UD3P 5F3TA 4R1HA 4G7HF 4NB5A 5A76A 3JYTA 1XNQF 5BXIA 2DXIA 2ZM6J 4P72A 4DV3F 2C1EB 4UTGA 3M2UA 3G96A 4OYAA 4TU8A 3H0PA 2CUEA 1TAQA 3C6UB 1EAYC 2LF8A 3E01B 2UV8G 5E8IA 2HPUA 3TA1A 4NI2A 3PNTA 5C4JJ 4C4WA 2WBRA 4LSZB 4F4AA 2OUMA 3CCMS 2X1BA 3NS6A 5IT9U 2O3FA 3JYTB 5I3UA 1FWKA 2VU5A 3TAPA 1NH8A 1X4AA 2VG5A 3EUKL 2LP4A 2XCAA 4M5GA 1UEVA 2H09A 4CA0A 4OYZA 1UP1A 3VAHA 2R8GA 2E5ZA 1D3YA 3GR0A 4ZDLA 1DGRM 4TQRA 4B09A 4XIUA 3NCPA 5FB2A 4BY7J 2FSWA 1IM4A 2DD8S 4TLQA 3IBWA 2QMWA 1FEXA 3CTRA 5E33A 2CS3A 3TVYA 5E3RA 2UXDF 5J1UA 4HKQA 3TOAA 1PP8F 4ZMMA 2HHXA 2XLIA 1T8IA 2CQGA 4BACA 2BABA 1S1TB 4A8WA 1O4XA 1NXIA 2BY1A 2E36A 1E6YB 1L3VA 2DO0A 3WIVA 3TJ9A 1RXOB 2HQCA 1QPIA 4F92B 3QPLA 2QA4G 2B5JB 1JLGA 3F8BA 4HV5A 3HTSB 4RL1A 5E18F 2G9OA 1V3SA 4B3OA 3HOSA 2QJ3A 2FJEB 2MLKA 2QCOA 3FBNB 3FZBA 3KLGB 3DBHB 3MTJA 4LFUA 1ETWA 1WEZA 4J9NA 2FA5A 5LMUJ 2HVZA 2XMWA 4XDDA 4X4NA 1WDTA 5DO2A 4RLQA 1UHMA 5D6EA 3V7CA 4NWBA 4XM3A 2YX1A 2AZ1A 4Y13A 3HVAA 4LF6J 3A3PB 4C2MA 1HBNB 2Q1LA 1VC5A 2A3JA 3BZKA 3K4JA 2VFRA 2SXLA 4ESJA 2KQRA 1SD5A 3JRFA 3JS9A 1MBJA 1C2PA 1WJFA 3DLLF 3GV5B 2DEIA 3DKWA 4IRIA 5HQLA 4K4YA 5DLFA 1X4FA 1EV7A 1VQSA 1KQ0A 3OYHA 2HEKA 4P55A 3H0DA 2G7HA 4OHZA 1TKZA 2R7SA 3BR8A 1FE4A 2EG1A 2JT1A 3IKTA 2H27A 4PPZA 3ZNJ1 3OVSA 1LXJA 2F5CA 1U0SA 1TFYA 3HHEA 2B4UA 1ZG3A 1WEYA 4Q5SF 1V54H 3VYTB 4C11A 1IXSB 2NS8A 4EJWA 4CM2A 2UUZA 3OHBA 4NLVA 4YR2A 2CWEA 3RPUA 1O7LA 1GTEA 1TKZB 3Q0VA 2HOEA 3HZJA 3VHQA 4IF4A 3BBCA 1H72C 4DS4A 5E41A 3I9V9 1PDNC 4XRMA 1Z9CA 4NLDA 2A2DA 5J3LA 2O01C 4B9NA 3S2HJ 3QT8A 3OVBA 2MYSA 3BTCA 4MMOA 1ZGAA 5EWFA 2YY3A 4Q8FA 3H5NA 1OY6A 1WF0A 1XJWB 2WAQN 1I5OB 9ANTA 4XLAA 1U2WA 5FROA 2XZWA 3THVA 2JSXA 2VF3A 3H7HB 1LWEA 2HFNA 3FBCA 3S14J 4QWQA 1FJCA 3BQ0A 2B51A 2MZ1A 5ILUA 1TP7A 3BQ2A 1IJWC 3D2WA 4DL2A 2ZBCA 3KLFA 3GFZA 4CH0S 4WWSA 2ME0A 2DTRA 2B9SA 4D7NA 2HS0A 3UN2A 3GX4X 4MT1A 4WCGA 3GV7B 4HI1A 3A3OB 3PG9A 2DYRH 3N4MA 4ED4A 2E71A 3GCWP 3IBFB 2DCUB 4LREA 2RVCA 2QX0A 3UR0A 1VDHA 1RAOA 2PMWA 3VDXA 2R42A 3TUIC 2WBMA 2DH9A 4V19K 1LWEB 2IMWP 4DV1J 1WHUA 4B9UA 4DJBA 4HEA2 3MZ8A 4LFAF 4BY1J 3H40A 2HNDA 4JI6J 3TW7A 2F4IA 5KFHA 5KFIA 1MMNA 4NE9C 2LMDA 4P52A 3PW0A 3CDLA 4ZLLA 3HZEA 3EVOA 2ZB9A 4BH9A 1S76D 3PYDA 2KT3A 3DOKB 2XGQA 2OF7A 2QT7A 2KIUA 3S8PA 1B8IA 3D5SC 4EQQA 2DGSA 1BR2A 1KQFB 1XNRJ 4GRSA 1I6HJ 5D77A 4RAGA 3Q8YA 2HNHA 2MKSA 1U1RA 1REGX 3GTLJ 5J1NA 3V4IA 4F0MA 5IV3A 4RNOA 3E6DA 1LFPA 3QZ7A 3IA0A 4GO7X 2W9AA 2Z57B 2BHYA 2L3MA 2F9DA 2H6CA 2CQDA 2ZBQA 4KITB 4RLEA 1N5TA 1JKRC 1RHJB 2ZDPA 2MZTA 3QYYA 2W4PA 4YB1P 4UT4A 1I51B 2W7PA 4G94A 2ZH4A 4I6AA 2FNAA 4TN2A 1YI2S 3OYIA 2NVXJ 4DSIA 2IJLA 1PUFB 2OD5A 2YS9A 1X19A 4QYZK 1DLOB 2WZ1A 2PSZA 1CQNA 1WOPA 3FDYA 4ZP9A 5LMUF 4HAMA 3ERED 4GO5X 3JAMK 2ASYA 3CCYA 4HL9A 1ZGWA 2N4CA 5BPDA 4K5SA 4C9DA 4K2EA 2MPUA 1ZGJA 5ITHA 4Q43A 3CCZA 2YNIB 1J7KA 2CZ4A 1Y8QB 2CNKB 1IN4A 2HZVA 1FRHA 4O23A 4M5HA 2GHWA 3KETA 4JYKA 3MAAA 3W66A 2IAJB 5K5MA 1RE1B 4Q47A 1Q8KA 1RTHA 4QWBA 2DOFA 1PILA 5F9NA 2A05A 2C3YA 1F1ZA 4NX9A 2Z58B 3I64A 1X4EA 5D6GA 3AD8C 3QBCA 3F23A 3OUYB 3HSFA 1S1TA 4JI3F 2FY8A 1ZA1B 4H4KC 1ZPWX 4C30A 4WE1A 4UQTA 4ZCKA 4OYOA 2J0SD 3Q9SA 4E8UA 3SYZA 4WXHA 1LE8A 2DHSA 3I4HX 1QRYA 5E3PA 1RP5A 5HATA 2TCTA 1YZ6A 1KFSA 4ZZLA 1HMVB 4L3KA 4DV5F 4U7DA 4DUYF 2DN0A 5IP9J 2ZNYA 1U26A 1OPZA 5GAGJ 3G2XA 2PGCA 1Q79A 1Z2ZA 4OJGA 4M5DB 2ZKTA 4ES1A 3CC7S 2CZVC 1P92A 3HOWJ 3RYRA 4UUVA 3KK3A 3OV7A 4UV8A 2GMJA 4CYUB 5HP1A 5FLXK 4NYZA 1DDNA 3LQRA 2KJWA 5H9EJ 1R1UA 3DKXA 5GMDA 3VPRA 2IC3B 2AKWB 3LOUA 3KLEA 2WAQA 3IR6B 1WI9A 2GW8A 4PJ0C 1RWWB 4RW8A 3ULQB 4XNFA 3L7UA 3A3NB 3R97A 5EN1A 2ZM6F 2XO7A 4A6EA 4LOCA 1T9VA 4ZYAA 2APOA 5D3GA 1J5EJ 4DI6A 4DZJA 3PTWA 3UD5A 4NZ6A 4V19X 1X1DA 1UB9A 2VXDA 2VPXB 4U88A 1KVIA 5KFAA 3OOUA 3GWCA 4MLOA 4P9SA 4CQ1A 2ADBA 3CDIA 4KIAA 2OSQA 2CPJA 3HCXA 2ZOFA 1VIOA 2VHGA 2A5WA 2HWIA 3FM5A 4BJ6C 2RQKA 1HLWA 5EDWA 5LL6d 2ZXHA 4Q44A 4JOMA 4FXWA 3D5MA 4RW8B 4OIRF 1K44A 3T5HA 1IN6A 3N6NA 4NLGA 2PX9A 1NPRA 2RVJA 3FDSA 4DPUA 3DGPB 3B6CA 2CQIA 3WC0A 4OFZA 3FSIA 3TW0A 2BXYA 2FQQB 3AFHA 1BI0A 3S1RJ 2HXOA 1VS3A 3SFGA 4RAYA 4U96A 2C2OB 3FZ2A 2XSDC 1AUSL 1Q16B 2UZKA 4QIVA 2IJFA 1BA5A 1OSDA 4MK9A 2HHQA 3I0RB 2FEZA 3ZQ7A 4CYCB 3ZQCA 3FCVA 4PG8A 1E6YA 4NC8A 4IHTA 4P75A 3HIFA 1E6VA 3HUGB 2IMOA 4IQJA 2IJRA 2XS7A 5E3MA 4KJIA 3H36A 1T9UA 4I6WA 2JWNA 2MG4A 5DGBA 2CUFA 3RUBL 2ZEJA 2DA7A 2HTJA 4M8LA 2RQ4A 1IC8A 1YW8A 4HLYA 1N36F 4IZZA 3S6EA 2EIKH 4NLTA 1JX4A 1NZ8A 2BRLA 4WBFA 4YG2F 4AVZA 2RILA 3D6MB 4JI7J 2UU9J 1HW5A 4HI2A 2UUWA 3QAHA 1H6KX 2MZRA 4MK7A 4GVLA 2P6SA 2ECCA 1HC8A 3E1SA 5KTQA 2OZUA 1WC6A 1APSA 2XMUA 2HDWA 1U1OA 4RMNA 2OMOA 4DR4J 2N3LA 2OSRA 4MKVA 1K47A 4CNZA 2K86A 5K7FA 3MURP 1B4AA 1S6LA 3OS0A 3EX7B 4S04A 1JLCB 2P9GA 1X3ZB 2D3ZA 1WJ9A 3BSCA 3M2UB 2UXNA 1Y8RB 2F2EA 3GTPJ 1Q7YT 2DR8A 1GMWD 2YWEA 2FU4A 4R0JA 1QVGR 3K4MA 3FXQA 2M8DB 1JMTA 2U1AA 1M1GA 4OMYA 2AW0A 2ZSIB 1NDKA 2IVFB 2LQ9A 2Y75A 1LEOA 2ESNA 4XQFA 4F0HA 1NNDA 3Q24A 3GJQB 4FN5A 1TL3A 2DJIA 3ZQGA 3LL7A 4HSTA 1J2VA 3GYGA 1JLAA 4WXDA 4OZ3A 4C11B 3H0GJ 4IXAA 5DD4A 4ZCIA 1T9TA 4Y2CA 1KC8T 2HQAA 2I0XA 4Y7NJ 2R7UA 2VBZA 1ETVA 4BBRJ 1IRGA 2DT5A 1G8XA 5HN0A 1KQ9A 2V2KA 1QJHA 2WW8A 3A01A 3RZAA 3CQZJ 3K59A 1T02A 3M8JA 2CW7A 1Z1DA 4ZP6A 3CTAA 2NQPA 2D9OA 3I31A 3ABMH 4WKRA 1JHHA 3K4NA 2R2RA 1GK8A 1WTFA 4C97A 1WHWA 4MEXF 1FNOA 3LSMA 2FVRA 1BWEA 2VLAA 5F1JA 1DTTB 1IKXA 4YP3A 2ZFHA 1PJ5A 1WC1A 4WIIA 4USUA 5CYQA 1WG4A 3WZ0A 3OQ2A 5L9XA 3E8OA 3TR5A 3FF5A 2QMXA 1CJUA 2KT2A 4F3QA 2KL8A 2WB1A 2KG1A 3SZGA 2HOTA 1AXQA 3KZIC 1FYKA 2L9WA 2LRDA 4H54A 3QJLA 2N7CA 2GAUA 4DFJA 3LNQA 4J9KA 3DHXA 1O3RA 3HD2A 2MD5A 2WTEA 2FC8A 1ITPA 2E2IJ 2BBYA 3S1NJ 4L75A 4DUTA 2VL8A 1ZTTA 4DG1B 1RR8C 3K7RA 2A6HF 5JVHQ 4ZCLA 4GMKA 3A03A 4MQVA 4CGZA 3W62A 2RAQA 2N82B 3J7YI 3KJVA 3N6MA 2XPVA 2VQGA 3ZR8X 4AUXA 2M1BA 3J81Y 4RA2A 2FZCB 3ULHA 4Y4RA 3Q8VA 5FLXY 1FVQA 1GVDA 3HHLA 5HS7A 3DPUA 3GSIA 2PT0A 3NAUA 4OIPF 2BANB 4HDUA 1MROA 2QQBA 2DB1A 3H5XA 3IAM9 4IRHA 1SUQA 1MROB 3A02A 4DBQA 1NLKL 2YNFA 3TEDA 1JIHA 1TV6A 3HHHA 2JDJA 2CVIA 1Y6IA 1KTQA 2RHSB 2R8HA 1R8CA 1OCRH 2ASJA 1SMTA 4PXCA 4AT1B 4DN9A 1NMEB 4F2RA 2Q6CA 2BKOA 3VZIA 3CCRS 4QYRA 4QIEA 2IYGA 2X6XA 3VWSA 2LDUA 1KN6A 1SV5B 1L3SA 3Q3SA 3R6SA 4ZJQA 3TUPA 3OTDA 3FJ2A 3H4DA 1Z6TA 3HSEA 5M5XJ 5LXYA 2YVSA 3HLUA 2L7ZA 3SJMA 3Q89A 2VOPA 2DEJA 3W64A 4LRFA 4CLYA 3HDDA 3NGSA 2JK3A 4F67A 4DR6J 3CC4I 4I2QB 2COLA 2FX0A 2B8QA 3K57A 2UU9F 1VQOI 2XWYA 1FFSB 4NXMJ 3ZQIA 1O7FA 4XLEA 1NK7A 3UWTA 3H59A 2V8PA 3TW6A 3VGSA 1S5LC 2GXAA 5L39A 5D8KB 2J9DE 1R1TA 4J91A 3LSJA 4R5PB 3DLEB 4WYWA 4ZPAA 4FF2A 3QJPA 1VI0A 1NK6A 5M2PA 4WFAQ 2F4VJ 2HAIA 1SIZA 2OFHX 2OI2A 1D1BA 4UVCA 1NO8A 3CWJA 2CNLB 2J5AA 1FKOA 4Y2MA 2AYBA 2DR6A 3G3ZA 3KG0A 3OT9A 1TMJA 1IZ1A 1U1QA 1T11A 3OXGA 2G2OA 2ERRA 1KU7A 4LITA 4URSA 3R3TA 5IT0A 1N5VA 1SPBP 2MLGA 2OPSB 3NWTA 3ITHA 3HRMA 3UDCA 1ZOTA 2D5VA 3HM9A 3NRVA 1U7LA 5T7LA 1YSJA 3O8GA 2IIHA 2X6YA 2OPQB 3NG8A 2EFWA 4ZS6A 1TQIA 2XGPA 2M70A 2VQLA 2MABA 2G4BA 1FP2A 2KM8C 4FXVA 4IRGA 2HURA 5BYSA 3DFEA 4LVNP 1HYSB 4ABZA 1EJ9A 2HQIA 1BW6A 2ROPA 1XB4A 2NSCA 2K4JA 4H4KA 1C1CB 3NMAA 5KFCA 1SC4B 4XO0A 4CZCA 2PN6A 3CCRI 3EPZA 1SV5A 3MF5A 3V6DA 3PSFA 1V9OA 4ZVQB 1X5TA 3KHRA 4QQBA 2HOSA 3MM5B 2F4FA 3DPTA 1MJBA 3HRTA 1VC0A 1S9EB 5HLFB 3DXSX 5KFGA 2L4AA 5HDGA 2BY3A 1NSPA 1FJ7A 5C44J 3K5NA 4MKBA 2DISA 2EWNA 3B02A 3D1NI 4B08A 1OISA 3MM7B 4A8FA 2QEXI 4GVBB 1JKOC 1PKUA 2HVHA 2H1YA 4A3IJ 1RTZA 2R8IA 2OD4A 3DCAA 3OJSA 1FMWA 1MGTA 3Q8RB 5F8LA 1CJKA 1YBTA 2RD5C 2QUFA 3MECB 1HNIB 3CCJS 4BHCA 3S15J 5KT5A 1VRUB 4A0YA 1P27B 2Y1IA 1M1HA 1YS6A 5JHFA 3UDVA 1E3PA 1XCBA 2EFVA 4IOCQ 5JJBA 4JI1J 2BY2A 1USSA 3HKZD 4CO2A 4IG0B 3JRIA 2KXHA 3BG5A 3B82A 3OBIA 3SXLA 1NRKA 2HZCA 1QAJA 4RB1A 4K5RA 1CBKA 2JPBA 3S1MJ 4YB6A 4F50A 3V7SA 1S6OA 4L3NA 4UOHA 1R5ID 3LWFA 4PUOA 4QWEA 2ME6A 1KYWA 3SFIA 2WSCC 3IP4B 2MQLA 2EA2A 1J27A 1B99A 2JMWA 1DPUA 4Z37A 1S0VA 1E6VB 4A12A 3GTKJ 1JXSA 1R8PA 3D1HA 2DT7B 3PSIA 1S0OA 2Y9HA 1NEEA 5CD4A 2B5JA 3RQIA 4MIWA 2E1OA 3NWGA 2OV7A 4K4UA 2CQBA 3UPFA 3V6KA 4TKTA 5FKNA 1NJYA 2DH7A 1HMVA 3OYNA 1ICEB 1N5SA 2NPFA 4ANEA 4M94A 1S1UB 3QO9A 3LANA 2ZITA 1UVLA 1M5PC 1HNXF 5CCMA 4EO6A 5A8RA 4U0VA 1XWLA 4WE1B 5GPAA 5EEGA 3CCVS 1DQAA 1UWBA 2J6SA 2M34A 4E7ZA 1TL7B 4V2FA 4HOBA 3VTIA 3NGKA 3KMSA 4IRDA 2WK4A 2OELA 4G65A 2XUBA 4J9PA 3BWGA 4AD9A 4RLFA 1UETA 2VPWB 1MU2B 3BH7B 1VGYA 5IOYA 2VFSA 2FOKA 4ZVPB 3SZ2A 1WF2A 2R7OA 4DCOB 2AYGA 4KJZA 3MCMA 3KLEB 3M8WA 4Y15A 2KRCA 5CZVA 2Y30A 1TT0A 1Y0NA 3D5RC 3PFIA 3MPUB 2GM4A 1TV6B 1WC5A 1O5JA 3TO6A 4JP8A 2DFFA 4KYWA 4TVAB 3GG1A 4DV4J 1DZ5A 5C3EJ 2VBYA 4LBPA 1BI1A 1MH4A 1HQEB 2V67A 1X5OA 3F8NA 4PZVA 4ZPVR 4K8RA 3MXHP 2LVWA 1UWBB 2VICA 2GZWA 1RACB 2LXIA 4K4WA 2E9RX 3HO1A 3CCUS 2XI2A 2FJ1A 3IC7A 1XGSA 3VYRB 4HQEA 2PLYA 2Y0SA 1TL1A 4DR5J 1QE1B 1Z3YA 1BC8C 1ZRDA 5H1SV 1QZYA 2UUAJ 1R5HA 2HTSA 2LA4A 3HPHA 3RBEA 4UUWA 2WAFA 1PYSB 4G1PA 1U48A 2IFXA 1Y5NB 2X1FA 2AGQA 4XIDA 1Q0NA 1X4GA 1OCTC 4DR7J 2KVIA 4O0IA 3KYCB 3GF2A 4FT8A 4OYBA 3GZ5A 1BE4A 2CDRB 1JUPA 4DX7A 4ENOA 4FKXA 3OYBA 5GADI 4MFBA 3D4JA 4IOAQ 1FXLA 3FC9A 4USHA 2LLZA 3MWMA 3OSFA 4PWDB 3BGUA 2Y9ZA 3L4BC 1K1QA 1YLFA 1PBUA 1WUUA 4DZPA 2VASA 1Y4ZB 1JTYA 4BHQA 4EEFG 1F43A 5HJYA 2RDJA 2VBXA 4ZDOA 4DGWB 2LEBA 1P8GA 5CYQB 4E6KG 2NZCA 4ZH4F 2NYHA 1UELB 5F0WA 4RUHA 4X4PA 2ECBA 4FZVA 3AFGA 5A6WA 1ETYA 2W4CA 2MZJA 3KUEA 3KKFA 4XLNF 1DP3A 2ZHOA 3F22A 1FX2A 3DLGA 3VR1A 2V26A 1YOVB 3BEGB 1ZM4A 4CSWA 5IT3A 4M5MA 3DLBA 3F8CA 3ABUA 1F36A 2F4OB 4I09A 4IQ4A 4BJ5C 3QIDA 2JHEA 3S16J 1JT6A 2EKYA 3AB4B 2LF7A 3IWLA 1UL3A 1CJVB 1YLXA 3HFKA 3VVUA 4AIHA 3NOCA 4FDFA 3PIPF 4LGWA 2IGMA 4TV7A 4U9RA 4QWCA 1B72A 2L9NA 2OPRB 5KT4A 2DA5A 4AIKA 1IBKF 1WPKA 4PSWA 1WHVA 2K3KA 5JHUA 2B8PA 1QHHD 5J4VA 2M8HA 1ZS6A 3J81Z 4A0ZA 3NAIA 4BQAA 3GEZA 4WPAA 3OIOA 4C3LA 1N77A 1F6TA 4EU0A 2DY1A 1JK9B 5HAOA 1R0BG 3GB0A 2J0QD 2PI4A 3OTBA 3KK2B 2IM0A 3ILOA 1ITYA 1I3QJ 3LFUA 4HX4A 4UQGA 1F9EB 3T1YJ 1N54B 2POKA 4O3OA 2FUG2 2V4QA 2GA2A 4BWJA 3MMJA 4A3GJ 1U0HA 3GLLA 1LXNA 3PDNA 2B4VA 4W92B 3S93A 1HD0A 4DZ6A 3M1VA 2AWZA 2XAUA 5K8MA 4MQ9F 2MKCA 3I53A 1X4CA 4TYBA 4RDUA 2OP5A 4OZJA 4CYUA 5HP1B 2MLYA 2ZE2B 5C25B 3SCLE 1NK9A 1UA0A 2YKMB 5E2QA 5C25A 2Z3YA 5D4LA 1Z0XA 1RAFB 3G8TA 1KONA 3BGLA 1HQ2A 3G87A 4GYGA 2M88A 3J7A1 2CG4A 1WSVA 3AD9C 5FKOA 2KIQA 4C7QA 3FRZA 4N9HA 3C2BA 2OO4A 4OZ0A 2K4BA 2L7KA 1ACIA 4K59A 2LP0A 2XDVA 4C98A 3EGNA 2PEBA 4P2MA 3DYAB 4JI7F 1VQ5S 2XY5A 2VPLA 2ROEA 2B3TB 2KT5A 2EBEA 2KRFA 4ASNA 1ETOA 2L7FP 1VQOS 2HW3A 2DFIA 3W3CA 3M1CA 1IV8A 3MR2A 4J01A 1RT4A 4KGVB 4DV6J 4HX7A 3RTRA 4ZPTR 5L8RC 3D3BJ 3QMQA 2E5NA 2BR0A 3SV4A 4A5MA 2HYGD 1L3KA 1GTHA 2HI3A 5H2FC 1GMUA 3LAKA 3BROA 4KIGA 5B66C 2HFVA 2F3JA 1RKTA 4A3FJ 2CJAA 4NA2A 5IC4B 2HS3A 5ICFA 2QA4I 5IYCJ 1ZARA 2QSFX 4QCLA 3K0LA 1MSWD 4AVPA 2H5JB 2XROA 2FJDB 3QPIA 4UUTA 4XDCA 2FYXA 3JRDA 5K8NA 1ZZNA 2WRMA 2DGWA 2PFDA 4I98B 1O8BA 2RF2A 1MJ9A 3TWZA 3DOLA 2MKYA 3DEWA 2RNEA 1MMDA 3MKWB 2HDCA 5GAEI 4KA4A 2WV0A 3RCOA 3A8IA 3LSGA 3R7SB 3RB3A 1EETB 3JTHA 3FK4A 1KHWA 1ZAWA 1VFCA 3NQOA 4ID8A 4XKVA 3DEEA 2VJIA 1G4CA 1FOWA 1Q81T 1YFHA 4ZVSB 3PYGA 2QM3A 1TK0A 2JVGA 4PKDB 5HLGA 3DNCA 4MTPA 4IO9Q 1U47A 1N0VC 2M7BA 4HQMA 2VI6A 1L3LA 4I64A 5G0RA 2FDNA 1UZCA 4R5PA 4X66J 1T0TV 1A04A 2ZH2A 3FKIJ 3LPEA 1M5KC 5HBMB 1IVZA 2DO7A 3DLHA 4RZRA 2KZZA 3WE2A 2UVUA 2O8XA 3K5LA 2JZYA 1QE1A 1HW1A 1RT2B 3K1MA 2MB0B 3HG9A 4MJKA 1MN7A 5DCFA 4ESFA 1U2FA 4DR3J 3MGJA 2L01A 3NMRA 4YQWA 2KJCA 3KCCA 1M0SA 1V3RA 2E5IA 2DDBA 2JSPA 1RHKB 2DHXA 3P9CA 2LEPA 1U1NA 3DLEA 5J40A 1H89C 3NEKA 3MMCB 1AOYA 2GHVC 2VXZA 3QYFA 1MIJA 3QPTA 2M30A 4II3A 5FJ8J 5HS9A 1SJ1A 2PFBA 4DJAA 3DDNA 1T7PA 3KE2A 1QAXA 4U7CA 2HHWA 2BOLA 4FQGA 2ZXIA 3RRKA 4IQXA 3MDFA 5G0RB 1SAXA 4YR0A 2MC3A 4AIDA 5EEHA 5B0EA 3TARA 3OW2R 2XRLA 4DCJB 4DR2J 3L7WA 4A3EJ 4ZVGA 3Q0AA 2QO3A 4UOFA 4PCQA 4XONA 3DI6B 1EH7A 2UVRA 4ITSA 2QFIA 3BPDA 2CZ9A 2KRBA 4WYLA 3HYIA 5KT2A 2RF2B 4PQAA 2BY0A 4OI6A 4UY85 2FY1A 1S99A 5LJ5Y 2NXNB 4RW4A 4KFBA 3UVJA 2YNGB 1TK8A 4EEYA 2V4JC 4L9VA 3FEXB 3FGVA 1FI4A 1WH5A 5DG8A 1OJLA 5CLSA 1N6QA 5ETSA 4K7QA 5D4OA 2E1MC 5L3FA 3H3UA 1TKTA 3BR9A 5KT7A 4I7FA 4OJ3A 2IGNA 5KG1A 1HCRA 2MEWA 3V6DB 4BXFA 2UVVA 3PO3J 1KVKA 2JOQA 1DTTA 5LHHA 4KH0B 4O3PA 2HZTA 3PO5A 3M8EA 1HDDC 1POGA 2CQ4A 2E5LF 1IO2A 1U1LA 4I68A 2ZJPQ 5CYVA 2X3GA 1I39A 3CDAA 3GZ7A 2V2VA 4S05A 3M6WA 2NPIA 2ALZA 1HFEL 5A0YB 1T8EA 3RJMB 1IV6A 2KYXA 4G6DA 1GVJA 3OOPA 3FXMA 3KHHA 3ECHA 3M32B 1JXEA 1UW9A 2JA6J 1X3WB 3A4TA 1HSTA 3W61A 4NC7A 4HTIA 5CVRA 2PMUA 4HH1A 3T6BA 3TQNA 4DPYA 3TBIA 3QRPA 2CYYA 1W36D 3ICLA 3MEDB 2QSWA 3AD7C 4A4JA 3M32A 3HSJA 3LWMA 2NUUG 3RBXA 5E3NA 4K4XA 3E6MA 2HS4A 3SV3A 2QA1A 4GRIA 2RNGA 1DQ9A 4HEA9 1SKWA 1IKXB 1IWGA 1H98A 2CU7A 2B63J 4NEZA 3X3UA 1RT7B 1KD1T 3CMES 1PO6A 4CCKA 3KWMA 2G0CA 4OAYA 1ZG1A 2V6CA 4ZDPA 1U6FA 1QVTA 1LQ1A 3H3ZA 5F8GA 1MJAA 3H25A 2R2SA 3J7Z5 2IVMA 4M6YA 1S49A 4DV7F 4DFPA 4IR1A 3HFZB 3NKYA 3WDOA 3EWGA 4IOCF 5BQTA 4DR5F 4XICA 2KKOA 2LTPA 3IXQA 1FX4A 4FVMA 1Q1KA 4IFYB 4W97A 2DNGA 2DFEA 4M5NA 3VFZA 3CCJI 5EZGA 4M5KA 1ROFA 5FD1A 1PC4A 1HWLA 2BJ1A 2IBKA 4F26A 3N4WA 1QD1A 3BG3A 1FDDA 4M9XA 3AY0A 1T98A 2YKNB 3ELKA 2B6AB 4USKA 3V8JA 2EV5A 3EUHA 1LWFB 4RU9A 4LSNA 1FYLA 1V3FA 3HJEA 1HQUA 3I4PA 2EC2A 2LU1A 3JREA 5FKKA 1RBLA 3PKYA 3F8FA 1KLNA 3CMEI 4GKKJ 2GS8A 5C24B 1YX2A 3WG7H 4A8SA 2R7DA 4F02A 5C24A 4F04B 4ELVA 3GIKA 4LSNB 4HYKA 1CULB 2B7CB 2DNRA 2YPZA 1SUQB 1WQ2A 4WP9A 4KQZA 2FMYA 3RYPA 1G3OA 2GMLA 5FLXZ 1VHIA 1C1CA 2BANA 4ZK7M 1EQMA 1DHMA 3WHIA 4OJHA 2O66A 3CCUI 2M9KA 1SQFA 1NK5A 1IXKA 2AO9A 3M30B 4LF7J 5LSRA 4PPDA 2RDPA 2J9EA 4OYWA 1XMKA 5EWEA 4AQYJ 2CNNB 3ZMUA 1SH0A 3ZN0A 3MQ0A 2AGPA 3POTB 1VBYA 4FE7A 2IS1A 1S1VB 1ZR2A 1KGSA 4WIQA 1BWVA 3O44A 5CYMB 3H9JA 4DQQA 5CD4H 1SJ4P 2MA3A 4P74A 3BP8A 3OIQA 3W3SA 3BGRA 2W24A 4LSLA 5FRNA 4DR2F 1LEBA 1N75A 2Z99A 4F7VA 2M2EA 2LY2A 2HBQB 1U9NA 4ER8A 3DOMB 4BDZA 5JLWA 2LFVA 2GA1A 5KFTA 1ULYA 2KG0A 3C66A 2YWFA 1K8AT 3K58A 1OMSA 3CCEI 1WELA 3IS9B 1BLUA 2ADUA 4M6XA 2IM3A 2CV2A 4EBEA 4PG7A 4DS5A 1S6PB 2R92J 1XSDA 2OHDA 4Y0FA 4DR3F 3LSKA 4ZZDA 2CRLA 3VGVA 4CLPA 2UXDJ 2NXEA 2LYVA 2CQNA 2JUCA 1GXPA 3W5ZA 4EJVA 4CUGA 1NDLA 3WE3A 4ZN3A 4URGA 4CRJA 5F04A 1ZAOA 1NHKL 3M8FA 4JI4F 5EWGA 1S9EA 5HLFA 3SEOA 4NI2B 2K27A 2EFOA 3K2YA 2MH2A 1VLYA 1HQUB 2IW5A 3MCSA 4XOTA 3O8HA 1YDLA 3ZZOA 2CJKA 3BOQA 5DM7F 2IDEA 3QFHA 4DOZA 3QRRA 4M5DA 1FDBA 3LP1B 1TT5B 1G59A 2GOMA 2XAQA 3SEQA 4XLHA 2J9DA 2Q43A 1KRPA 3MUMP 1NG6A 2MBFA 2F63A 4DQ2A 2AD9A 3G71S 3FIWA 1N78A 4BAYA 3VV2B 5THWA 3HKWA 1NG7A 2E9ZA 4Q8EA 1SQGA 3LSIA 2V8GA 4IOAF 2OQGA 1A31A 1IBMJ 2D3UA 1RWNB 4ZCMA 2DA6A 1SFOJ 3ROUA 3PRVA 1WI6A 5A8WA 3T1HJ 3KLHA 4B1RA 1H9GA 4A3BJ 2CQ0A 1WJ5A 5EEAA 4XPCA 3AB2B 1CF7B 2YX7A 1O0PA 4DUZJ 1FXRA 4O6JA 4P2FA 4DLGA 3TZXA 1D1AA 2L7MP 2STWA 2JVOA 4UOCA 5DEQA 2W7AA 4ECWA 3HI9A 1N25A 1KLMA 1S12A 3PX0A 2BJ9A 5DDGA 4ERDA 2OPSA 2C2NA 1IN0A 4NHJA 4BQQA 3DBLB 4TXSA 2I5UA 1S4FA 1SIWB 1R6VA 3KJFB 2ZH9A 2KRHA 5KFEA 3MPVA 4FTHA 2RE1A 4IHWA 4MGRA 1FOXA 1IXCA 4ZC3A 4XL9A 5I42B 5ILVA 4ZPCA 3CCQI 4HF0A 3AG1H 3QQAA 3OTCA 2Y8YA 4N77A 2FVCA 3DP7A 4X65J 1TR0A 1YVFA 4M3DA 2PE8A 5FFZA 4BL0B 1PG5B 1MNMC 4G1IA 1UPMB 1SFEA 3GLXA 2C3PA 4KT0C 4MTDA 3KP2A 2BGCA 1AA1B 1TNSA 3MUVP 1K6YA 4RU2A 5KG4A 4DUZF 1VQPI 1FRMA 2DK5A 2HFSA 7AT1B 2YX4A 2IRUA 5EGOA 2IA2A 4P2XA 1YRNA 2Y69H 5HMWA 3PW4A 3NWRA 4JI4J 5DQIA 5AE1A 1OYIA 5IXUA 2XS2A 4ZPBA 4IG0A 1ZN2A 1HHSA 1KQGB 4M74A 5F9LA 3EDQB 2H9ZA 2RHQB 2UZAA 2YU3A 1XMQJ 1QUPA 1ETXA 1N33J 2E35A 5D15A 1T95A 5F8JA 3A8EA 3KUGA 1X5SA 2IXSA 1RADB 1WH7A 3PQKA 4QTRA 4CLTA 5H9EK 4DV0F 1R23A 3Q0UA 3RW7A 2OZ6A 4ZPDA 3AH6A 4KN7X 5F8HA 2O5DA 1TU0B 4RB0A 4DQIA 3I87A 2W8KA 1SC7A 4RBTA 5EG0A 3JQKA 4XMYA 2V34A 4LVOP 4PAAA 5LM7E 2C3OA 2BW2A 1UCNA 2J7KA 3FHZA 2WCXA 2K5CA 5J1EB 3ZTQA 3P7NA 5D4RA 3SCIE 4XR6A 1FDAA 3SQGA 5E5NA 1YRNB 4OHYA 3IUOA 1JJHA 1MBGA 3GZNB 2JA7J 2V69A 2BE7D 5L3EA 2A6OA 1YITI 3M9NB 1B7YB 1SFUA 4J37A 2CJYB 4D7MA 4B3RJ 4LLNA 4A6DA 2BJDA 6AT1B 3OVAA 1QU3A 1ZRFA 1RKJA 1V5FA 2A2CA 2ZJRQ 2KTQA 2AEJA 4HW0A 1SI9A 1SL0A 2IHR1 2VZ9A 5F8MA 2E1AA 2H1LA 1FIPA 4YEAA 1YI2I 3KLNA 2EQRA 3POTA 3L2VA 5C2CA 2K1RB 1AT1B 3EVWA 2ICWG 3QWLA 1S57A 4NC6A 2JLGA 1VQLS 4JV5J 4LRDA 5CVJA 1GAOA 2PMZA 3AJDA 3MMCA 3FMWA 2WVCA 4RW7B 1IQZA 2X6OA 1S6QB 4X1EA 2CPEA 1FHTA 4HF2A 3QPSA 1LNWA 1RT2A 1M1EB 1R00A 1WJDA 2E19A 3DRPB 4ECQA 4MFBB 5ETVA 1A35A 1HKTA 4PWDA 2O6GE 1N5YA 2DPUA 1RK8A 4M73A 3HPGA 4XKCA 1RHQB 3LSPA 1IBLJ 3TJ8A 1AZSB 4FHTA 4FVCA 4WK1A 1YIJI 1R1VA 4OQJA 3T9ZA 3C14B 1RIOH 4KMFA 4ZLJA 1WG1A 1ETKA 5ETMA 1X4BA 1Z2LA 1JJ8C 5A2QY 1Q95G 3BYPA 2JJ7A 4USTA 3GMEA 3UE2A 1VQ9S 3KEQA 1IR0A 1SL1A 1F60B 1TELA 4OIXA 1F2GA 2HKOA 3KZYA 4IO9F 5F27A 4DU8A 3NL0A 4I0BA 3IV5A 5EG0B 3J7ZT 3FMRA 1VJQA 3D1QA 4D3GA 1URNA 4L9NA 5KG0A 3SDBA 2G7UA 5J1YA 2GIRA 2HFHA 3IR7B 5J1EA 2WA0A 4B43A 4ZJLA 2X0LA 2CFXA 2BVLA 5D6FA 2X1EA 2BYCA 4KFBB 1G2EA 2ZHBA 1TZ0A 2M3AA 1VQ4S 5E1WA 2ASLA 2I5JA 1B4SA 4XKWA 3PIPQ 3MMYB 1I27A 1RT5A 3HUGA 2Z2SB 3JAMY 3HT0A 1TP4A 2WC2A 3HOYJ 1FJLA 3T41A 1BQNB 1AB8A 3PQJA 2BKPA 4Q2LA 4IDKA 5CABA 1B0PA 2YTCA 1C4AA 2V1XA 2M0GB 3HC7A 1SKSA 1HIYA 2YNGA 4CTAB 4KO0B 1NKBA 4DV2F 3JSYA 2EEYA 2HVRA 3RAMA 3C2HA 1JXVA 1MBEA 5CVUA 1XSXA 4N47A 2KJVA 3ZTRA 2O67A 2XGEA 3GCXP 2VBWA 3ZZUA 5F0HA 4J19A 4I4BA 1S6QA 2PI5A 2QYOA 2E5LJ 1T0FA 2XYPB 3S8SA 2EZHA 3ZMZA 1T2KA 3LP2B 2BRKA 1U0JA 5J6XA 1Y5LB 2QEXS 3HFVA 2VPYB 2R93J 4QW9A 5ETPA 2R2TA 1S59A 4G7ZF 1NSKL 4IOBA 5HVGA 4CIOA 2O03A 1FTTA 3V4GA 2DY9A 1B0TA 4XN0A 2G0JA 3MM6B 5HVHA 2D74B 2QV6A 2ZH5A 2MJUA 1RA7A 3GUDA 4X4QA 2P9EA 3GIRA 3MOJB 2VKHA 2XO6A 3SCJE 2XNRA 1YBUA 3IM8A 3R7NB 4N4OB 2XMAA 1HPZA 1WSUA 1H2UX 3W2AA 2H65B 3EM1A 4AXIA 1SC6A 5I42A 2EG2A 3M07A 2A0FB 4P6QA 3H8YA 4BKXA 3DXJF 1FC3A 1S10A 1GV2A 4C0OC 5F1RA 3D54A 1S8NA 2WSEC 5AXKA 3OY9A 2NRAC 4A8YA 4ZYDA 2NVTJ 4BDYA 2DNPA 2WB1D 1ZR4A 3Q8PB 4C8KA 5J1RA 1XGNA 8AT1B 4PK4A 4X84A 5J4YA 3H1CA 2EBIA 5IWAF 5I4MA 1XCVA 3GILA 2WWYA 2DITA 1T08B 2DNNA 3C1DA 3MMAB 3M8YA 1P9YA 2DK8A 3CF2A 1VI7A 2KPMA 1IDZA 4CH7A 4QWDA 4RUBA 4F91B 4FYYB 1ZZFA 2EFNA 3DU5A 3N5BA 4ZYEA 3LA3A 2H8RA 5EDNA 4ILMA 1EJ7L 5TJJA 2RS2A 2B4PA 3JSPA 1Z21A 4I02A 4X65F 3WU0A 1QSLA 4UY8T 4JB8B 1FRIA 3ISZA 4JI1F 3CSKA 3BO3A 2VD3A 4DIQA 1HHQA 1Q82T 1NCLA 1RTJB 5LGNA 1XIQA 4FF4A 3VZHA 3W2VA 2WVBA 1HWIA 1MBKA 2IBDA 1W7PD 3KP4A 2AXLA 2NNNA 5KFZA 2OCCH 4XSXF 5DZ7A 1E17A 4CLUA 4KIBA 1XD7A 2QC3A 2MQ8A 1QTNB 2GO9A 4ED7A 1Y39A 4L9TA 4L5EA 3L2RA 1QY7A 4R8UB 4DHVA 3W60A 4JV1A 3F56A 3W5YA 3OR1C 5LJ3Y 2EK6A 1R5GA 2M7AA 1EP4A 3BBFA 2ZMEC 5D0RA 5LXRA 1N4LA 3GQCA 3GZ6A 3WHCA 1FNMA 2HNDB 2JUGA 3WTVC 4PSXA 1P4XA 3L7OA 4JYAF 2VKDA 5CYMA 4F93B 2M7SA 3I3LA 3BG9A 3DLAA 3HL2A 4FP9A 1FO1A 3EXYA 4W4MA 4CYDA 2BJEA 2ZBIA 1D8ZA 3R0AA 2X7IA 4LB6B 1Y1VJ 5C4XJ 4OMFG 1IBMF 2DH8A 1T05B 4QLCU 4C8NA 3LAJA 4XLPF 1JLQB 3N5FA 1EETA 3U21A 2NXJA 4N4NB 4YFNF 3W8GA 3LH2S 2L3DA 2HFOA 3QOPA 5JLXA 2IS6A 3QOEA 3G86A 3KHGA 5K5RA 3B8HA 4IHVA 2VQHA 1T05A 3D0IE 3RB6A 4O4RA 4XSZF 1Z1ZA 3ZMVA 1FKPB 4EBDA 3UW1A 3GJRB 4QIGA 3RKXA 3TP3A 2JVRA 3FXOA 5EUHA 4MNUA 1Z3XA 1D9AA 2EPFA 2M87A 3OFEA 1X1CA 3OR1A 2HQNA 2OFGX 2QYGA 2H94A 4WCEQ 1VRUA 2MD0A 4Q48A 3D68A 3N79A 4A8MP 2KO1A 3LWLA 4AFFA 4ZJOA 3CP8A 2CG8A 4DYRA 2QFJA 1PJ7A 3BC8A 3CB4A 1FVSA 1KYZA 3WIUA 1X31C 2Z2ZA 1CGPA 2JLFA 5KFDA 1IWAA 4OV1A 2HNZA 3R5DA 1FEEA 5IYBJ 4RO0A 4RUCA 2VFUA 3RKQA 1RT6A 4DPWA 3OHAA 3K69A 2B43A 1JJ4A 2RNJA 2VPZB 5AE2A 3DLKB 1VQPS 1IBCB 2HWVA 3MAQA 4KV8A 3PYEA 2DRDA 2Y1JA 3ETOA 1IR2A 4RNFA 2IP2A 4XK8C 1NHAA 4RAZA 4DXLA 1YZ7A 3K1PA 2CA9A 4S0HB 2ELKA 1P1TA 3CCSI 2LNBA 1HBNA 2X48A 1VISA 1BIBA 4P10A 1TWAJ 2OQRA 3GIIA 4CCOA 4PWWA 4LFAJ 4CT9A 1B70B 3FNNA 1TUWA 3ZCOA 5CKTA 4P73A 2HLTA 1HNWF 4DSKA 3G8QA 1AU7A 3OIPA 2D69A 4OZ1A 5IQQA 2W9CB 1ZAVA 3JQJA 5HQMA 4HDGA 3EZ5A 1Q1VA 1OPCA 4LJZF 1YJVA 1T94A 3SDEA 1RHMB 3D6TB 2HAFA 1IKYA 1JJ2R 4LMZA 2NOJB 1WJCA 1E2XA 3MEDA 5IOZA 3G82A 2GAGC 3ZZRA 3CC2I 5E3CA 2AZ3A 2ID6A 3AKZA 1M5OC 4XAKA 3MTKA 3NWSA 3BREA 1WI3A 4DW6A 5KFRA 3IO1A 2CADA 2C42A 3OXLA 4FNHA 4B3AA 1WEXA 4H4OB 3IWXA 4FS1A 3G82B 5A0YA 3RAQA 1UW4A 4OZNA 1R4MB 2P7CB 2A6MA 2XY6A 3BR1A 3QT5A 1RWVB 2LQ5A 4DQRA 2UXCJ 3PVXA 2AQFA 2CPYA 1TW3A 3CDBA 5FLVA 4G9YA 1FWLA 4QW8A 1CJKB 1TUVA 1VRQC 1DTQA 3K5OA 2CQKA 3BPXA 3T1AA 2R5ZA 4LRBA 1YIOA 2MQOA 1UJ6A 4YB5A 2Z2LA 2QQ9A 4QWAA 1T6SA 2VJ4A 4X6AJ 2DMNA 3T1BA 3UNYA 2ZC3A 3DKDA 4DX6A 2RB7A 1XSVA 3TZZA 5FFXA 2UUBJ 4DWIA 2XF5A 3KZZA 4EGYA 1PBAA 1WCMJ 2Y3YA 2F1FA 1WVRA 4N76A 3KP3A 4EYHB 5GAGU 1H2TZ 4E4HA 3D6HB 4P9FA 2XIGA 5DM6Q 4M63A 1Y9OA 2PO4A 3OYAA 2FTRA 3RB0A 1ORKA 4A0XA 4QPTA 4ZIWA 3M8RA 2E5JA 3MM8B 1ZTRA 1ODDA 5JVGQ 2FRHA 1PIEA 5DG7A 1D8KA 5ETOA 2R9LA 3OSPA 1VQ7I 3PNIA 1Z91A 4DQSA 4CO1A 2KISA 4JUZA 3HKZA 1STZA 1GXUA 2FLLA 1HWJA 5FLMJ 1NHVA 4HLXA 2MLXA 2L9SA 2EC0A 1X1AA 4IH5A 3G4SS 4JOUA 1UVNA 1E3HA 4G3IA 4LD5A 2MFZA 4MHGA 2M9HA 1IKVA 1VQ5I 1VR6A 5KAKA 3W7BA 2L48A 3PR5B 4CLFA 4X62F 3RW6A 1VBZA 2F5EA 1H0HB 2XWXA 1CJVA 1GT0C 1P7IA 1I50J 3HP6A 4NLPA 1IBKJ 4B9TA 2ZWOA 2MQPA 5KFYA 3L2UA 1IKVB 3K9TA 3SZTA 2F6CA 4RS8A 4LSLB 4A5NA 3QGIA 1Y1WJ 1TMMA 1T38A 4L0ZB 3I0SB 1S5ZA 5HROB 3V4IB 2ZSHB 1T9XA 3GYXB 2JNJA 5HO4A 1NDPA 3UNGC 4NZ7A 3W6KB 1IN8A 4OIQF 5GPCA 4Z7YA 3AL0C 3G4SI 1VQ8I 5DLGA 1ZYRF 4A48A 3L9FA 2K1RA 1T0FC 4E0DA 1HA1A 2FQ3A 1GXQA 3S3NA 2NR0A 2DPDA 2QLZA 1BJAA 2FXAA 3HVTA 3W9HA 2XPWA 4F0KA 4U87A 3RZDJ 3FXUA 1T33A 3IAM2 1KFDA 4ES2A 5TRDA 1WG5A 4P96A 4G1QA 1J75A 4FKYA 1IAWA 1BOAA 3M1VB 3RBDA 2UXCF 3N0VA 1K83J 1MMLA 2QF7A 1C0UB 4LR7A 1JUMA 3KJNB 1BR1A 1KLMB 3R27A 1ZAXA 2Z9OA 5HLIA 3MFIA 3E6BA 4I67A 1XBWA 1G4DA 2A10A 3A0BC 1I1SA 1B8IB 2BA9A 3BF4A 4ENMA 2ZMEA 4N9IA 1F5AA 5IT9Y 1OWXA 3KDNA 1FNNA 4L0YB 4NCAA 3BDEA 5H9FJ 4DV3J 4F7ZA 2DVIA 2B9XA 3IH3A 1O51A 5F0CA 3HT3A 4KSEB 5I3QA 3KK1A 4M5JA 4KDPA 4LQ9A 3KK1B 2Z5UA 3IWFA 4G1QB 2OAZA 3W2VB 2BEOA 2CUZA 1LW0A 2XMKA 4J7CA 2KHDA 2V6EA 1IJFB 1SBRA 2H6BA 4A8KA 1NH3A 1N36J 1M5VC 1DPRA 4N0BA 4Y6IA 1UHWA 1KOHA 3IC1A 5EF6A 4HR2A 4MIAA 4LF4F 4P7TA 2HLUA 3UQSA 2G1DA 1PP7U 3SYTA 1B1BA 3W9IA 3M6UA 3ENQA 5BR8F 3CJTA 2NS1B 3HSZA 1PYTA 1FY7A 4C8YA 3ZPLA 1RAAB 3VAIA 4PQUB 3HB9A 2HBRB 3V6HA 1QVUA 3T1HF 5K1YA 3LP2A 1SFXA 2EB7A 2QIFA 2EIMH 2F8HA 2Q79A 4F36A 5DUKA 1IRXA 1JUSA 3P8BB 1R0CB 1UZDA 2XZTB 3CDUA 1RUNA 2OJED 4UHTA 5FO5A 3THPA 1AHDP 1VQ8S 2JEGA 4JI3J 1WKJA 3MWBA 1MH3A 3QODA 2OKQA 1IKYB 2KU7A 4PQUA 4WP3A 3HOTA 2RIJA 2HQRA 3OTOJ 5DTDA 4WU3A 2CQ7A 2FBIA 4B4CA 1R43A 2FJVA 3EDPA 3LW5C 4A69C 3NS5A 2DAOA 2CMPA 3R60A 4FCYA 3A1YG 2HQFA 2YUSA 3C8YA 4LJMA 1W36C 1SXLA 3COAC 3GXOA 4URQU 2ZBKA 5L46A 4FPRA 5GADU 4NYOA 1MLAA 4WJBA 4M3EA 4GKJF 2XBPA 4CO0A 3AG3H 5KFWA 1U02A 1S0NA 3C2PA 5D8HB 3C16A 4JBCA 2E1CA 4PWUA 3S7RA 5HODA 3EZOA 1HOMA 1LPQA 1YW7A 3TRGA 2DTJA 1RGVA 2H48B 3FMSA 3BR0A 3U1MA 1D9FA 3U7JA 2CUYA 2MGZB 5L3DA 3KG4A 1U6BA 1SVOA 1RAJA 1OQ3A 5F0FA 1ZA2B 1FMVA 2R5ZB 1Q5YA 3DGPA 1IW7F 3W1YC 4FX0A 4W1UA 3HHKA 2KLOA 4WFNQ 4FE4A 2PJRA 3NXZA 3TAMB 5IP7J 4Y3CA 3AAWB 1PGZA 1SL2A 1U5TC 2D2WA 4JQFA 1Q1HA 5IY5H 3LAPA 1BHNA 4B3SF 2UV1A 3CJRB 2YSRA 3PUBA 1H38A 4DPOA 3MEGB 4IKAA 4DLEA 1FKOB 3MEGA 4ATNA 2AJQA 4CICA 2IRYA 2HKEA 2MQNA 2KJBA 3WTTC 4QPXA 4DV5J 2JC1A 3R1HA 3DF8A 3HPOA 2WONA 3OYDA 3A8JA 3U27A 5IWAJ 3QQCD 1I1GA 2VUMJ 3PW2A 3WC2A 4LIRA 4CLZA 3D3CJ 2F48A 1N34F 2MHEA 1Q8IA 3RQ4A 1HHTP 1HWUA 2LVSA 1A0OB 1WJBA 3QU3A 5D0HA 3AOAA 2PA3A 4HACB 5KG2A 1RWXB 3C6TA 3MAHA 2WONB 3CNQP 1SVLA 1NM2A 4OU0A 1JLFB 2V50A 1NSQA 2DGUA 5H9FK 3C3LA 5LSLA 2ZZNA 3O2PE 3GW2A 2V68A 2LMIA 3N28A 1R31A 3HGGA 1IUYA 3T5KA 2DI3A 4PEOA 3OSGA 1YJWS 4A8OA 2O8KA 2GAHC 1WACA 3CDHA 2E2JJ 5F08A 2W85A 3AJ1A 1TKDA 1F5CA 1EX8A 1NK4A 1P4WA 4QIWD 2D1CA 1EZZB 1R8BA 1TQPA 3AOCA 3CCSS 2CWKA 1JLAB 2JA2A 4DNCA 5ILSA 4KISA 1K6OA 2PG4A 4NLSA 4J5OA 5J8CA 3ABTA 3CCES 1ULRA 3I0SA 5J2NA 4U7UK 2CPZA 5BNGA 2H3EB 4JK1X 1RLCL 2J8AA 4NRTA 4LF9J 2LQBA 3VGTA 1CG2A 2DNLA 4XKBA 2QWWA 3Q5FA 1UJ4A 4I76A 1UFLA 2HGCA 3L2QA 2VDHA 3NGUA 4LF8J 3IKVA 4ILRA 1LKXA 4WXCA 2HNZB 5GMEA 4Y34A 1U0HB 4YIRX 3IRQA 4GYIA 2MYFA 4ZTFA 1YHQI 4M1KA 1UWAA 2Y31A 2UV8A 1X8DA 2QA2A 4YN3B 3CJ4A 3CD5A 4MIBA 3EQLF 4RR5A 4PGHA 4RW4B 5K14A 1LWFA 1J5YA 3DTKA 4NPOA 3D1OA 1BR4A 1KA8A 3PM9A 3O2IA 4K4VA 1HA8A 5HNHA 1FBSA 3HD1A 2LY9A 1N52B 3VSKA 2RS8A 4PUSA 1F5TA 3S1QJ 2HPIA 5I3PA 1RT7A 3CJ3A 3SQNA 2Q8KA 4WX9A 4NZ0A 3L1PA 2HXIA 2U2FA 2CIMA 3L00A 3CJ0A 4P71A 1BQMA 4KC5A 1X2NA 2A68F 1S9HA 2DFHA 1HPZB 2AJFE 3KLGA 2VONA 1R49A 4DR6F 4EFAC 2I5JB 1Y3JA 1YJ7A 2UUAF 1XMAA 1UFMA 4AYBA 2DCLA 3AT1B 3CDWA 1UMJA 3TO8A 3FQKA 1YK9A 1RT1B 2DYSH 5TGTA 2FHOB 4Z2XA 1JLGB 1CQMA 3E5QA 4RNNA 2ZH6A 2QVOA 1HBUA 2CQ1A 3J80U 4BNCA 3JTOA 1S29A 1C0TB 1QDUB 5FJ4A 3UFCX 3WHBA 3PO2J 2VA3A 5D4NA 1YJWI 2PMZD 2P81A 1ZYQA 4OYPA 1FOKA 3T0YA 1WC4A 4Y2AA 3ZXSA 2JTVA 2C2ZB 3IN5A 2MZSA 3CLOA 1CJUB 5KG6A 1VQYA 4MH8A 1JT0A 2EK1A 1MN9A 4UB6C 3KNAA 5LFAA 9ATCB 3KJQB 5KT3A 5E3OA 1ELOA 2M5WA 2FZKB 1CS4A 3CUOA 3O5TB 3FKBA 2FHMA 5DRKA 1VRTB 4TU7A 3RRGA 3NARA 2MDAA 1TL5A 4ED0A 2L08A 3FXKA 3EDRB 3DOLB 4U8VA 5HROA 2FF4A 1BQNA 1IRZA 1KEKA 5KFSA 4YB7A 1HNXJ 2X3DA 1MSEC 2STTA 4MFEA 1SD7A 2A61A 1WKKA 2GIFA 3PYFA 5RUBA 3JR9A 1Y3KA 1JHFA 2KL4A 5CPRB 2L9DA 2ZOMA 2LR8A 2QN6B 3W2WB 1OQ6A 4KO0A 4NLUA 3UDLA 1QZZA 3JSMA 2CWXA 4HV6A 3A01B 4IHSA 2KB2A 4PDKA 3C15A 2CW8A 1RISA 1OYYA 4IFYA 2OA4A 4L76A 3TMOA 2WB4A 5EX0A 1O6XA 3I6PA 2V9VA 4K0KJ 4IUFA 1XERA 3C16B 4D3HA 1M5HA 1MWQA 4DR1J 3B6BA 2B6AA 3HHLB 4OINF 3DRXA 4B47A 3HVWA 1NK2P 4U0WA 1VQ6I 5KFOA 1A9NB 1N33F 3ISND 2ZMEB 4P7VA 4R0EA 3QAEA 2XMJA 4C2MJ 2D7SA 1DGWY 2XYHB 3CJSA 4W98A 2HHHF 3FEZA 2VJUA 4UOGA 3Q83A 2WTFA 2LG4A 2MC4A 1C1BB 3FK6A 4ENKA 2DNOA 4ZITA 1RWOB 3IRRA 5E1ZB 2P5LC 1A6IA 3TX8A 3ENVA 2E44A 2FVQA 4Y28C 4J9SA 2UUTA 4BHBA 5DG9A 1ON1A 4IL6C 3GFLA 2ABYA 5MLCV 4O4GB 1HKSA 1WHXA 2LOOA 3RSNA 5DV5A 4EM0B 3I0TA 5F3ZA 5T7LB 5BJRA 3IG1B 5GAHU 4ZVUB 3HJFA 5CHCB 4I2QA 3EGZA 1RT4B 4ZTJA 4WF9Q 3GIJA 4RNMA 3OPKA 5D5WB 4ECVA 1K4TA 2KXFA 4BE0A 1VRTA 2KH9A 4OLOA 5DD8A 2IPQX 3M3YJ 3HF5A 1HI8A 3ZRGA 2VKEA 3HVRA 1GLNA 3R2CJ 2QLJB 2HG4A 1OYDA 2JEIA 4JI2J 1WGXA 3VQSA 4A2UA 3JTGA 1V5IB 4UZCA 3ITHB 1HNZF 2A6EF 3TOQA 2GOXB 4EYIB 1DARA 4RBOA 1NJXA 2HR3A 1W7PB 3KIOA 1U8RA 4CLKA 2DHHA 2CV0A 1S6PA 1NKCA 2LFBA 2N4DA 3DLKA 4USIA 1MBHA 1S4EA 2IA0A 1TWCJ 3MN2A 2DGXA 4OAZA 2UXBF 2N3OA 1X3UA 4LG0A 1ZRCA 1TTHB 3ZZYA 1X0PA 2QQ8A 3G1MA 5HSPA 3D0GE 2BJ8A 4LFCJ 2GMHA 4OYXA 3HEFA 2DXDA 3MECA 3GFXA 3PFOA 5J2MA 3VAKA 2ACMA 5AONA 4LF2A 4CO8A 1LFBA 1KBRA 3IL2A 3G6VA 5GAEJ 1MMSA 2WAEA 3Q8QB 2J6UA 5FDLA 4PG4A 5K9FA 3Q86A 1K73T 1B0VA 3HHNB 1QZEA 3C6UA 4EZ9A 2LKXA 3CJNA 4M71A 3I96A 3OR1B 5HL7Q 5FKLA 3ZZPA 1EA3A 3LOCA 3LSHA 5B0FA 3ZC4A 1R7IA 1Y10A 3R6LB 2F5GA 3ZQFA 1KTVA 1DBDA 4DN0A 3LGMA 1FWZA 3IFEA 3OYEA 4EUVA 1LUJB 2KM8B 2J7WA 1KQ8A 4M3FA 3ABKH 1X4OA 4HTJA 1OCZH 3ADAC 2BV6A 2E1MB 1VQ4I 4RJVA 4HZFA 2LREA 4DYCA 5JR3A 5AIPA 1QSSA 3MD3A 3DEUA 2QLBB 4S0MA 1AKHB 4F55A 2IYIA 1G6NA 3H2VE 2NXCA 4FF1A 4MEYF 1UKUA 5DETA 1PYOB 3CJ2A 4C3KA 3PL8A 1YJTA 2ILYA 3R7BB 1OR7C 2MKIA 4PGGA 3JRBA 2Y0BB 2QSFA 1YJUA 2YR2A 5LHGA 4WP8A 4HACA 4KHMA 2Z16A 1RZ4A 4D9JA 5EX3A 2VOOA 2N7YA 1YJ9I 2DBBA 2EI5A 1ZM3A 5J2PB 3VSLA 1NK3P 3RJPA 4JI2F 1BL0A 4X4RA 4DCPB 4DX8H 2AQEA 1OY9A 2UXXA 1LE8B 4YELA 3MFHA 4NLOA 1S0MA 1IKWB 2BHZA 1IGNA 1D0XA 4L73A 3BSOA 3NP5A 1NJZA 1FCAA 3NEUA 2AIRB 3FHNA 1RI7A 1WWXA 4RX6A 2YQ0A 2W1BA 1K7AA 2VG7B 1ENHA 4AUKA 2QYCA 2GJFA 2QKMB 2XB2D 1BW5A 1WI8A 4C8ZA 1NDCA 2MKKA 3SQGB 2V9PA 1LNQA 2C2RA 3CP2A 4LF7F 1X5PA 1T3NA 1G7CB 3OLBA 3SDEB 4USVA 1W2IA 3MMBB 4TNOA 1DQUA 5IM0B 4ZP8A 1ZPVA 3KLOA 1PUEE 3LF0A 2Y48A 2UUCF 4TY8A 2RU9A 5K7ZA 4KHPJ 2ZH8A 4H0EA 2HWHA 3ZTSA 4OX8A 3FISA 1GFWB 4EJUA 3TGNA 3P5BP 4JYAJ 5D5XB 2MTLA 2DQLA 2V1DA 3I56I 4CO5A 1Z7LA 5G4DA 4IRKA 3LP0B 1DQ8A 2XSJB 3FCWA 3DCFA 4X0GA 1M5SA 1WSRA 2DNKA 9RUBA 4C48A 2JRSA 1ON2A 3GTMJ 1SD4A 3HGYA 2W25A 1TQMA 4C8LA 2G13A 1T39A 3GR1A 3ZGKA 2EV6A 4FXDA 3EICA 4J9VA 2BZTA 1FEHA 3SSSA 3CW2C 3EYYA 3U9GA 1WOOA 4UVAA 3CIMA 1FD8A 2Z30B 2HVIA 2ZXJA 1SANA 2DHGA 3RTVA 4QR1A 5AXMA 1KHVA 4EBCA 4BU2A 3SXYA 2MLZA 1SJFA 4AQYF 4ZN1A 1VK8A 2IDLA 1RCOB 2NVUB 1Q7LB 1ZM9A 2OAUA 4C3JJ 2F8MA 3NBPB 3IGNA 5CZXA 3MR5A 1U09A 1DURA 2O5RA 1SKRA 3RPUD 4YS2A 2MSTA 3HK2A 4AL7A 4XPEA 5LRSA 1GDTA 2VFTA 3TVKA 4X4TA 2R4GA 4DPTA 3B73A 2LA6A 2FBKA 3TZWA 1RABB 1WTBA 3I54A 3NBPA 5L3GA 3AG2H 5ICEA 5CYJA 3F0CA 4ETZA 3JAMZ 3RG6A 3G6XA 2UP1A 3WGGA 4LIUA 1LDJA 4ANJA 2LBFA 4WXWA 3CJTB 1S1WB 4OHVA 2IT0A 2JX2A 4PXEA 3K8WA 1NAQA 3OYMA 1Y0HA 2RRBA 2OPRA 3K70D 2L4MA 3TI0A 2Y9YA 2GIVA 3R1LA 4KGZB 3CDEA 4QR2A 3CCQS 4BHPA 2L54A 1PSDA 2Q0OA 4HNVA 2BQ3A 4PJNA 4DZDA 1XR6A 3M30A 1V4RA 5HLHA 4CNYA 1H73A 3GCMA 3ZOBA 3KG1A 2OCEA 3CCTA 2WV1A 1TUGB 2H8WA 1R58A 2R7RA 5ED4A 2DMQA 5LT5A 3BJAA 3PHTA 3MCNA 3KLIA 3BTIA 1IBLF 4LRCA 3H9QA 2KIMA 4M6VA 5TISC 2GLOA 5ETTA 4X4SA 2BBEA 1VMBA 3S32A 5ETRA 5ADZA 3Q8UA 4KMUX 5FGMA 2HDDA 3OMYA 1H88C 3H4BA 5GMKa 4AM3A 5KFLA 3N6LA 5FIIA 3JCUC 3ECOA 4ECSA 5DYMA 1N5YB 2L2OA 1XMQF 3HULA 2W2OP 1D0ZA 2VKRA 3JW4A 1RT5B 4CWBA 2GWRA 3HRSA 2OTLS 1DU0A 3J80Y 1X60A 1K0VA 3F3XA 2ZJRF 2RC4A 3ONQA 4M5IA 1W26A 3L7PA 5A6PA 3PJRA 1U49A 4H4MA 3TZYA 1QSYA 4TY9A 1HR0F 5B1AH 2CPHA 4PJJA 3K2AA 1W5CC 3BZCA 2A3SA 1OCCH 4JI0F 2ZD1B 4O4GA 4ELTA 4GKKF 2V8VA 4BYYA 3A0HC 3M8QA 2XQCA 1FJEB 2PC6A 2VQCA 3LA0A 1OKRA 3CPWR 1LWCB 1VCTA 3NOGA 1U6ZA 1IF1A 2D41A 2V6AA 1EIYB 2JPCA 5HMYA 2UUBF 2XGDA 1B64A 1B7FA 3DM2A 3QIPA 2HGMA 3QNWB 1JTXA 3CCMI 4X2BA 2Q1ZB 2X1GA 3GSDA 1D5VA 1RTHB 4I99C 3BGOP 1XG1A 2ATLA 3DTIA 5J8FA 4KRWA 1FT8A 2VDIA 3OL6A 7FD1A 3HOXJ 2KDZA 3IM9A 1R27B 5J2PA 3TAMA 3Q0WA 2J5PA 4NYPA 5C2GA 3BY6A 1Z05A 1FESA 3I32A 4PYAA 2Y0SN 1KS2A 1K78A 4GGGA 4BEHA 1NSAA 1FF2A 3IAS9 3QRQA 1EARA 4JP0A 3MAAB 1RSCA 2OIHA 1VTNC 4HHJA 1LW0B 4E7KA 4F8RA 2BW3A 1TKXB 2F9JA 3PHEA 4Y17A 1CF7A 2BW3B 1TKXA 3IP0A 4Q7AA 1S7OA 3QLHB 3CZ6A 1P9QC 4B3MJ 4V1Ak 2OU2A 3MUTP 1TLHB 2OTJS 3P45B 1NJIT 1O57A 4M9SA 5DDPC 3CCLS 2K9LA 2XAHA 4I69A 5A2QK 4MFDA 1U24A 2RQPA 4DF4A 2XSFA 1FJGF 1DAXA 3UCUP 4LLGF 1S97A 4ECZA 3DRYA 3CCWA 1N48A 3WGHA 3OYGA 1FRJA 1F9NA 2X4HA 4LR9A 1K1SA 4NBQA 1S7IA 5LLQA 4B44A 1S9FA 4DDFA 2HGLA 4RW9B 2RQCA 4TY8B 3CF5Q 1FBUA 4DR4F 2KMUA 3P5JA 4LF4J 2UVWA 3FFIA 1RJJA 2K3FA 3W65A 1XMBA 3PNYA 1ZM2A 1SMYF 3MR3A 1Z6RA 2AP6A 3HOVJ 1R6RA 1WF1A 3CMAS 2XPUA 2ZXWH 3MMAA 1RT3B 4GC6A 4IYQA 1UVMA 5BMZA 3DRPA 4BDPA 2V79A 4NNJA 5DM7Q 4MYUA 3Q9VA 4GDFA 4LG3A 3VEPA 2FVPA 1LB2A 1TZLA 3FMQA 3BDDA 3G8SA 1F3FA 2CQPA 3NS7B 2CJJA 4BJTA 2YH0A 3Q2SC 1NBEB 4LR8A 4RWWA 2E5GA 3H9GA 2JFKA 2EILH 1AYEA 2EZIA 3QIPB 3DM2B 2IJNA 2LXFA 3FKJA 3QWPA 3H92A 4FPIA 5HLTA 4X4UA 2CQ3A 4NASA 1BIAA 2EJRA 2LSOA 3O3KA 4B3SJ 2RGVA 1UZHA 2P2CB 2CW0F 5BPIA 2V1NA 1VOMA 3V8KA 3X1LB 2L02A 2O0YA 4K4TA 1LK5A 2N8GA 3S2DJ 5E1XA 1LW2A 3QAUA 1VQ9I 3OSNA 4C3IJ 2IS2A 3W5XA 8RUCA 3FZVA 1QM9A 1FK9B 2IS4A 5E79C 1G2HA 4NLXA 1WDDA 4WWCA 4I0WA 1FKAF 1MW7A 3R5BA 3ZN1A 3RZOJ 3CJRA 2W7NA 1XNRF 2AYMA 4PXBA 2Q2EA 5LRRA 1H74A 5HVFA 3PY8A 2F5FA 2VE8A 1NUEA 1MDMB 2ZCWA 1HI0P 4WF2A 2XAFA 1OR7A 4IFVA 5E20A 3F8MA 3V42A 1FK9A 3HSGA 3F44A 4IG3A 3BR6A 5B0CA 2B7BB 2JN6A 1NHUA 2O1PA 4O3SA 3VYUB 5M2UA 3DN9A 2Z33A 1MKMA 2F7VA 2GJIA 2CQQA 2ZBRA 1BN5A 4NLWA 2W8LA 4FYVB 1S7AA 3OFFA 4BC7A 1R36A 1IG7A 3DLLQ 4LUBA 3T9NA 2VG5B 4DMZA 3BSNA 2PEHA 1XDUA 2Y8WA 2I9SA 5HOOA 4LFCF 4JI5F 1BJZA 3MM5A 4JV2A 2RU3A 4ZVOB 5DGAA 5K14B 4E98A 2YNHB 5AXLA 5IS2A 2LYCA 6PAXA 3K17A 1S9GA 1P1LA 3DXBA 4XBFA 4YFKF 5LGUA 4CXFA 3F6VA 5CH7B 3J7YJ 4WK8F 1YG2A 4L5JA 1YGYA 4NXNJ 2J76E 4WXOA 1FKPA 4W90B 2WW4A 2V1UA 3TA0A 5H6RA 5L3CA 1FRKA 1XN9A 3PX4A 3M2RB 3JRHA 2XEXA 4FYDA 3F73A 3CT9A 2Y1LB 3WTUC 4IQMA 1TC3C 2OBPA 2G2YA 3IWNC 2RN7A 3T1YF 1KR4A 3HSDA 2LY1A 4KAIA 4LFBF 2YBVA 2LK2A 2B0GA 1V5VA 3H42A 4P2SA 1YWXA 3T5XA 5CA5A 2FGCA 4M3GA 5L1LA 4GFBA 4HVZA 4ES3A 4K0KF 1LVKA 1OFCX 2DMPA 2X1CA 1K0TA 4WFYA 1S7HA 4PRFA 2MKJA 1P7JA 2KFZA 3NGRA 1C0TA 2C3UA 3BS9A 3TAQA 2JLEA 4CDIA 3GV8B 3VAGA 1AKHA 3HX9A 3MD2A 3QT7A 3I58A 4Y2IA 2L9RA 3WODF 2BOAA 3WTWC 1EF4A 2R4FA 1TL4A 4A93J 2ZJ2A 3I71A 3GTGJ 2FGOA 4R79A 1SC1B 3WTYC 1OLTA 2FJXA 4NA3A 4BS9A 3K8VA 2V5HG 3QPHA 3DRRA 2XLKA 1ZLJA 2JZ5A 1UAAA 1FT9A 4BE1A 5BYRA 1C1BA 4B8XA 1BQMB 3GVAA 3O6QA 2ETHA 3IH2A 3SIPB 2M45A 3GFHA 2IBOA 1EHWA 6FDRA 1GUUA 4EJOA 3IHUA 2DXFA 2VJJA 2HIYA 2H4WB 1HBOA 3D5LA 1RESA 1BGXT 3BGRB 2D3O1 3FVYA 2M4KA 4MIMA 2LD5A 1YJ9S 2HWTA 3IG1A 3ZZ0A 1S1VA 4AYBN 5D8LB 2YU9J 1C0UA 2ZVIA 2UWMA 4USMA 1JB0C 2K06A 1B9NA 2ALYB 3CMQA 3IS9A 1IRFA 3A13A 1QBJA 3PXGa 4HG2A 3PO4A 2EFPA 3ZXWA 2CQXA 1DTQB 2YQ3A 2QG9B 4M95A 2RJZA 4O3MA 3CLQA 4I01A 1NTCA 5M3FJ 2PIIA 1XDSA 5F41A 4N5SA 2RRAA 4NQWB 2FNPA 2WSFC 1HF0A 1U78A 3M1EA 2VKVA 3TP0A 3QRFF 3ZZTA 5ETNA 5A2QZ 2QE5A 2EZKA 5E3AA 3NNCA 3G73A 5LOQA 2GQQA 4RAFA 4DQPA 2JQ7A 1XTZA 1VQKS 3KPHA 2LU2A 2K02A 3HMJG 1DY3A 1X4DA 1TW2A 5K5QA 1AFJA 4IHXA 2X51A 4DBRA 2CJXB 3I5AA 5D5UB 3BQ1A 5F8NA 4I2PA 4C2TA 3M8QB 2ADCA 2KYZA 5B3SH 4F2SA 1JE8A 2L9VA 3O3LA 1FBQA 2W57A 3PW5A 2HHUA 2LLKA 3HHLD 4HNTA 2DMTA 2C22A 1R4NB 2IA6A 3MEXA 1S6UA 2BE2B 5B5EC 4JBAA 3W9JA 3G6EI 3ZMSA 3SHFA 3RR8A 3MM8A 2DKOB 1SB6A 1RPWA 2KN4A 4I6ZA 5KNLA 4QPOA 1TTYA 2KHMA 5C42B 1X1PA 2P8TA 3E6CC 1K61A 4ID5A 1APLC 4I2OA 5C7PA 3OL9A 3MPWA 3RB4A 4NCBA 1ONVA 2C2DA 4JX4A 2DQRA 4ETXA 2MZQA 2R7QA 3DTEA 4XTTA 1U1MA 3KLIB 2HRUA 5KFPA 4FETA 2G1HA 2ZKUA 3QYBA 1A6LA 4LK1F 3CIZA 4F4YA 1W0UA 2OD6A 1A36A 5F6FA 4HDHA 2XF6A 2VG7A 5FD5A 4KE5A 5HDKA 2W4DA 4BWMA 2IM1A 5DDRC 4ED1A 2XI3A 4YFXF 3VODA 4OI0A 4RPFA 4LF5J 2BE9B 1WORA 3K6GA 3EZUA 4AYBD 4HT7A 3TKYA 3CC7I 2BOPA 5K5OA 4LQ3A 3X2QH 5M3MJ 2AGOA 4EJTA 3KK3B 2LH9A 2EFGA 1JXLA 4L74A 5LBQA 1U25A 4IX7A 1JGGA 3TOBA 1TK5A 1QVFR 2VC1A 5ETKA 4USJC 2XGXA 4X66F 1YS7A 2VN2A 3K7AJ 1FZPB 4WK3A 1W7PA 3CCLI 1SEUA 2XSJA 5GAGI 3S2WA 2F5DA 2VG6B 3CJKA 3W6VA 2HNYA 3EVMA 3UN3A 1XMOJ 2W82A 1WNEA 4HA8A 3GO5A 1KZHA 4A8QA 3BJOA 1WOSA 3PJXA 3KYDB 3MKZA 2H54B 2WOMB 2VQFF 4YUDA 2BE2A 1S7EA 2DYAA 1FERA 1Z77A 1BC7C 1I94F 3CVKA 2HNYB 5IV4A 3TNVA 5HQ8A 4PUOB 1NYNA 1XQIA 2FHJA 3V4MA 2TDXA 4DV0J 4DL3A 1YYVA 1Q5VA 4G6VB 5IZHA 4Q0BA 1GHCA 1FOYA 3ZO7A 3DKYA 4GXOA 3FBIB 2DXEA 5DS9A 2KVQE 5H20A 1XMOF 3ISPA 1REPC 4NL5A 5L1JA 4ED8A 4EZ6A 1YHQS 1N34J 2QSGX 3EUNA 3P9IA 2B9YA 2D3OR 5KT6A 1J5OA 2AF6A 5A8WB 1VF9A 4OHWA 2E66A 5BR8J 3ASOH 4QPQA 1WC3A 1MWYA 2EBGA 2ELJA 4AL5A 4DSLA 3M05A 2W2PP 4N7TA 4AIJA 2FZGB 4K4ZA 2XF7A 3L3CA 4O3QA 1KQSR 5KG3A 1VQNS 1HD1A 2K9NA 3MZHA 3QP5A 4OZLA 1F9FA 4Q45A 2DA4A 2EVZA 3J80K 4F3OA 1YTYA 4DYQA 5M5YJ 3FCHA 2XSJC 1LVAA 1RTIB 2GXGA 2P6TA 1JI8A 5J1PA 2G9WA 3OS2A 3P3DA 2V0NA 2JVHA 2FIUA 1U8WA 2WY8Q 4O44B 1MU2A 3TUJC 5A8RB 3K70C 4RW9A 1I94J 1J5EF 3DMJB 3OD2A 1W0TA 2E7XA 2JSCA 4ZVHA 4KIFA 4AL6A 3FSXA 5C5JA 3KP6A 3GMGA 3ILIA 2CSOA 2MMYA 3J7YU 4UVBA 3CO0P 1F3VA 4ZVRB 2NCKL 4BBSJ 2A07F 3I5BA 5JFRA 2PMZN 4RNHA 5HMXA 4HHHA 1IM6A 2M2BA 1I6JA 2KT0A 1RAGB 2V4JB 5A8KA 5SZTA 2BJ7A 2P5KA 3VQTA 3LSRA 2ZJPF 2LEAA 2LQJA 1RKIA 2ZFUA 2CH0A 3FBEA 3U2RA 4ICLA 5IM0A 3FWEA 2GGPB 4D0PA 1JLCA 2O7OA 1SCJB 5B0BA 3TEHB 1VHFA 3EMTA 2ATCB 2W00A 1T9WA 4WFZA 5M5WJ 2CUJA 3R5GA 3DFGA 4CM0A 2R3SA 2HZDA 2A6TA 3TO9A 3C14A 3CO7C 2FLOA 1D1CA 1WD6A 5CVVA 1S48A 2R7WA 2AXTC 3AQOA 2VKZG 5AT1B 2DPJA 1Q4RA 4I0AA 1FD2A 1TBXA 3RKWA 1N56A 4G6QA 2C3MA 1XX5A 2MSYA 3BQYA 4NRUA 4YHHJ 2DHAA 1X4PA 3QJJA 1OCOH 2VODA 1VQMS 1RHUB 3D66A 1X4HA 4IRCA 1F0XA 3KNGA 5D78A 2XG8A 2EZLA 1RCXB 5M2RA 1FNXH 1SJ3P 2DNHA 4ANCA 3I55S 5LD2C 2HVQA 3J7AO 4GCVA 2M8GX 3T3FA 3TEGA 3CESA 3HXMA 3CC4S 3DHWC 4KV8B 3EGWB 4BQNA 1OJ4A 2GIQA 3O1LA 1QPMA 2JWTA 1E3OC 2HQ3A 2QQAA 4O44A 1QGPA 1HLVA 1N32J 3MKLA 3DMJA 4WKYA 2AV5A 2GNKA 2FHJD 2ISZA 3OL4A 2B0LA 5A2QU 2XMTA 2XKOA 4RWXA 1Z67A 1UPPA 2NLWA 2NXNA 4DSJA 5J2QA 2ZBPA 5BYQA 3H35A 2PMHA 1BXNA 4RM3A 4RUAA 2PBIA 2K8GA 3B54A 2QRRA 3C15B 3T5LA 1HNVA 3PFEA 4I7FB 4E7LA 3AG4H 1HQCA 3T6JA 1HR0J 1OS5A 1IN5A 2BE5F 2OEJA 2XV4S 2RT3A 1U1KA 2RV8A 3L2CA 3FEYB 2PA8D 4WFBQ 3OFGA 3HHGA 3NCQA 3BR2A 1UFWA 2CQHA 3DOKA 1RTDB 3CF5F 2QKLB 5HS8A 2DR7A 1LFWA 5K8OA 3NRBA 4H4OA 1AZSA 4ON0A 5EJCA 3MR7A 3ABLH 2KZMA 1JNRB 5GVQA 1B72B 5F8IA 1N5QA 3BTLA 4IJAA 1YQHA 2G0EA 2OPPB 2H4YB 5GAEU 3MR6A 4X64J 5U47A 3ZP5A 4YIIA 4C8MA 4Z2YA 2K9QA 1R8AA 2NVQJ 3AQPA 4YHHF 2E29A 1UG2A 1PC5A 2QGFB 2LCWA 1RT1A 5L3BA 4XN3A 2AJ1A 2R3VA 3E3XA 1M90T 2VG6A 5KG7A 3M2VA 1VQMI 2CFOA 4CLWA 4NA1A 1S1XB 4FNIA 5CQGA 5BS6A 1ZTWA 4RGXA 2V9KA 4CCLA 1FA0A 3D0HE 4R8HA 4MTEA 3TP2A 1RTDA 2YKAA 4MYTA 1QUVA 3V8LA 3ENAA 1PYVA 1KOOA 1CC8A 2DK2A 1KDNA 4KHPF 1MMGA 4RGUA 4EMSA 2YWGA 3ELHA 2QZ8A 1QA6A 4NMLA 1VZ0A 3UCGA 4ANDA 4D1QA 2HFZA 4ECYA 4KB7A 2KFDA 4KBIA