2L9NA

Structure of the human shwachman-bodian-diamond syndrome (sbds) protein
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
250
structure length
250
Chain Sequence
MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Uncoupling of GTP hydrolysis from eIF6 release on the ribosome causes Shwachman-Diamond syndrome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Ribosome maturation protein SBDS
total genus 44
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2011-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01172 SBDS Shwachman-Bodian-Diamond syndrome (SBDS) protein
A PF09377 SBDS_C SBDS protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.900 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l9nA02
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2l9nA03
3.30.1250.10 Alpha Beta 2-Layer Sandwich Hypothetical 12.0 Kda Protein In Nam8-gar1 Intergenic Region; Chain: A; Ribosome maturation protein SBDS, N-terminal domain 2l9nA01
1ZPWX 2IVYA 1ZM4A 2XEXA 4TNOA 4MAKA 3B82A 1ZM9A 2I0XA 2I8EA 1DARA 4MYTA 5G4DA 3B78A 1FNMA 3EXCX 1KTVA 3E3XA 4ES1A 3UI3A 2KDOA 2EFGA 4QR1A 1ELOA 4ZCLA 1ZM3A 4ES2A 2CVEA 3ZZ0A 1U2RA 4FN5A 2NPFA 1ZM2A 4QR0A 3ZZTA 2E1RA 4MYUA 2J7KA 2BV3A 3B8HA 2L9NA 1VI7A 1T95A 3OQ2A 1N0UA 3LH2S 4ZCMA 2BM0A 2WBMA 2BM1A 4ZCIA 1NYNA 4QR2A 4M1KA 2ZITA 4ZCKA 3ZZUA 1N0VC 1P9QC 4ES3A
chains in the Genus database with same CATH superfamily
2KT2A 1WJBA 2B9SA 3V4MA 3JS9A 4KISA 2DY1A 3QFWA 4IFVA 1Q7LB 1SD6A 1ROFA 1WC3A 3CMQA 4BE0A 2M0CA 2IY5B 1GX5A 1Z6TA 2AYBA 5F8JA 3D66A 3CJTA 4NX9A 2ROPA 4ES3A 3BPDA 4UW2A 2V26A 5E20A 2WAQA 4BS2A 3I0RA 1EH8A 1UG0A 1VQNI 1R71A 2UUTA 4RW7B 2K4BA 3GX4X 2FY1A 1IM4A 2KM8C 3CDUA 5AE2A 1RT3B 3W1YC 3W60A 1D0ZA 1HPZB 4I6YA 4WFAQ 4J90A 4JX5A 2UUWA 3HHDA 1RUNA 1IUJA 3OY9A 2WVBA 4DUZF 2DD8S 4KH0B 4A48A 1JHFA 4K4ZA 5K14B 5DUIA 3QWPA 2CQXA 2GOXB 1SIWB 1VQ6S 2NRAC 2B0GA 4USVA 2ZH3A 2WTFA 4B3TJ 2VQHA 2Y0BB 2BRLA 4LF7J 5LXYA 1F4KA 3LH2S 2ZZMA 4M3BA 1JK9B 1K61A 5GP9A 1KC8T 2VT3A 3OS1A 2GGPA 4AL5A 1AYEA 3OYCA 1WELA 2HWTA 2LU1A 3OL9A 1NHUA 3OS2A 4RUAA 2XMTA 4LMZA 2PG4A 2WOMA 3E3XA 1Z67A 1CJTA 5DGBA 4DV1F 1D9DA 4IOBA 5A76A 2BANA 3DC2A 5IP7J 1AXQA 4IFYB 2F2EA 2V6CA 3MUTP 1S8NA 5C4JJ 1GXUA 4OZLA 2STWA 1KQGB 4CLSA 3K8WA 3TJ9A 5E18F 3RYPA 4UUSB 3ENAA 4Y2KA 3MAJA 2C2KB 2J5OA 5KT3A 4H0EA 4CTAB 1NK5A 1X19A 1FE4A 1H9TA 5KFFA 2DTJA 1JLEA 4YUDA 3V6DB 2DXIA 1HQUB 2MD5A 4IHVA 2CZ4A 1MN9A 5LBQA 5BOXA 3TZWA 4W1UA 2XWXA 3F0CA 4ZVGA 3FEXB 4BQQA 4UB8C 3K58A 4L18B 4A4JA 2CQGA 3R0JA 4X4VA 4YG2F 2QIFA 2LNBA 3K5OA 3HJFA 3K4MA 3BQ1A 3QO9B 4ZN1A 1RTIA 5E3OA 2RF2A 3MUVP 3G96A 4EJUA 4WK8F 4A12A 1H38A 4M74A 2DO4A 2KRRA 1JLCB 2QG9B 1X5PA 5LXRA 4Q8FA 1UFMA 1TFYA 4WKRA 1XMQF 2E60A 1VHIA 2IAJB 3R5DA 2XMUA 3Q0WA 3GBGA 1XSVA 1QE1B 2J7KA 3DBHB 3HOWJ 4KUMA 4ZHRA 1GMUA 4MKYA 1FD8A 1ZK8A 3MM9A 1VQ8S 2HTSA 3PR4A 3T5KA 2QJ3A 4ZIVA 1IRGA 2DPUA 3BBFA 4O3QA 1B70B 5KG7A 2ZMEA 1G7CB 1WDDA 2DCEA 1QO0D 1YJUA 1YKWA 4CP5A 5AT1B 3VAGA 4CM0A 3DLGB 4KKOB 4P74A 1HNXF 2WBMA 4A0ZA 2KFNA 4I6WA 3H98A 1KONA 1WI3A 4BXFA 1Y39A 3RAMA 3FQKA 1PVEA 5CYMB 3QT6A 5I3PA 4K4YA 3LUYA 2ZB9A 2U2FA 5CZXA 1HF0A 2Q43A 4QYZJ 3SI8A 3A1YA 2UVWA 2FJAB 2QGUA 2MSYA 1B99A 1HWLA 2YQ0A 1YJWS 2H51B 3NWGA 4YN3B 2RS8A 4F04B 2CS3A 3DKXA 3KLFA 2LDUA 1JXSA 4FTHA 3CCQS 4CYDA 2AGQA 1Y1VJ 1VK3A 2BOAA 2C2NA 2OQRA 1S9EA 1FIPA 2UU9J 4LQ9A 4Y2CA 3VSLA 3G9CA 2NXNA 5K8MA 1OQ6A 4YHHF 1FTTA 2C22A 4RAFA 1H3DA 2BE7D 4R1HA 3HYIA 1MROB 2UUAF 2RHSB 3BREA 3PFOA 2JFKA 3RKWA 4IQ4A 1O5JA 2EC2A 1NK0A 2XHCA 1J75A 2PJRA 3MPVA 3QGGA 1WHUA 3O3LA 1FXRA 2Y48A 2CVIA 3CJ3A 2EIJH 3HMJG 3TA0A 3UKGA 2E1MB 1AKHB 2QYOA 2P0WA 4ZPAA 2J76E 3BPVA 3AB4B 4RS8A 2XWYA 3PO3J 2PIIA 1AOYA 4B9SA 4ZCLA 1R8BA 2W9BA 4YIFA 5EGOA 2E44A 3F8FA 2QA1A 3J80K 4DR3J 3I54A 4M9SA 2H09A 4K4UA 2FLNA 2K27A 2EIMH 3DKWA 2VA3A 2HVSA 4LFAF 1X3ZB 2DDAA 2YWEA 5LJ3Y 2IAIA 3PY8A 2XPVA 5B5EC 1YIJI 3LL7A 1VISA 3CUQC 2BY3A 1SL1A 1WWHA 1HBXG 4JP8A 2HLUA 4C8KA 3CDHA 2QA2A 1BA5A 1EKSA 1SFUA 4KIAA 3GV5B 3HOYJ 2HNYB 4JX4A 5ETNA 1DZ5A 1RWOB 2LY2A 1RU1A 3P45B 4NASA 4NOHA 4D1QA 3CJ2A 2WW8A 1Y11A 4M72A 4F26A 2AHOB 2ALZA 3C46A 2HU9A 1T9VA 3C15B 5J40A 3DLKA 4D7MA 4ECUA 1C4CA 2B6AA 4NYOA 4ZK7M 1FZPB 4HX7A 4WU3A 2M7AA 3QT5A 1HHQA 1WUUA 3OUYB 3ML6A 1FX4A 3AB2B 5A8RB 3HEFA 2KIUA 2KO1A 4N8NA 5D6GA 3FVYA 2DHXA 1FKAF 4DR4J 1KBRA 2B51A 3L4BC 2HS3A 4AD9A 2J0SD 5LEJA 2DRDA 1AWCA 4HTIA 1JB0C 1PSDA 1UL3A 1XCVA 3H90A 3E6CC 4DX7A 2Y0SA 2UXBJ 2ZE2A 4XRFA 5CVIA 2HNYA 1QJHA 3HOTA 3MPYA 3KJVA 1HNIA 2ADBA 1KR4A 4QPQA 5FJ8J 2C6YA 4DBQA 1IN0A 2F9JA 1TQLA 3BSCA 3WTWC 4A0YA 3PNIA 3G1MA 4XTTA 3GCMA 4B3RJ 2YH0A 4HACA 4L76A 3THPA 2VODA 5GAEI 1X4DA 3CCVS 1APLC 1U78A 1LQ1A 3BBCA 3KLFB 4BY7J 2OZ6A 1FKPB 2JLEA 3BYPA 1WOOA 4M6XA 2XROA 3PSIA 4LIRA 1JKOC 5F08A 4CT8A 1T6SA 5BQTA 1MU2A 4KHPF 3AFHA 4K7QA 2YY3A 1TKTA 3SEQA 3S7RA 4EZ9A 2MQOA 3MKYB 5T41A 4PZJA 4FE7A 2EH3A 4V19J 2ACYA 3ZXSA 2X1BA 5FLXZ 4KHMA 3MMCA 1B6AA 4PUSA 2X6YA 5HS9A 1SKUB 2QBYA 4H4OA 2F5GA 2OCEA 3AQOA 2AHQA 2UXDF 2HHPA 3FM5A 1D1CA 3Q2TC 4NLTA 4YIRX 1IM6A 2HQAA 5B0AA 2XLKA 1LK5A 1QZZA 1TW2A 2BABA 2LDIA 2I5JA 1OJ4A 2B6AB 1VQSA 5KFWA 5ETKA 1G4DA 3QRFF 4MKBA 3DLKB 2KFZA 1YG2A 4IVNA 2W2OP 1ZG5A 5IYCJ 3ILIA 3S8SA 5EWFA 1SB6A 1MMSA 5JLWA 1RAAB 4OJ3A 2FC9A 1N54B 5F1RA 4Y15A 3HT3A 5DDGA 4B9UA 1K6OA 1IKYB 2M45A 1RCOB 2NVQJ 2C3PA 1WC6A 5HBMB 1Y5LB 3CZ6A 3WX4A 1OMSA 1U3EM 3BSOA 2G2OA 1TLHB 4X66J 4ECRA 1WG4A 3GZNB 1ZYRF 1Y6IA 4L0ZB 2MLXA 4M3FA 3RU0A 4D3GA 1OSDA 3BGRB 2V4JA 1OCZH 3HULA 2LKPA 5IM0A 1UG2A 3K4BA 3W8GA 3BROA 1U49A 1POGA 2IM1A 4QYRA 4XLHA 2D1VA 2LG4A 2NOGA 2E1RA 5ILVA 2PLYA 1J5EF 1W7PA 3PKMA 1WF1A 2YNHB 3NWSA 2RQKA 1NJXA 3DOMA 1PJ7A 2QSGX 2GIQA 3HL2A 3EDPA 1S7IA 4WF2A 1P4AA 5D4NA 2NSBA 1HQEB 3N01A 2RVJA 1F2GA 2G2ZA 2HFOA 2C3UA 2KTQA 2CJAA 1WKKA 3A2KA 1IR2A 2DHGA 1NRKA 1S7HA 4RGXA 1R1TA 2EJRA 3F23A 1P27B 3P6YC 3ASNH 4RB2C 1GNKA 4A6EA 3GZ5A 1Z2ZA 4GO1A 4QJVA 2Q1ZB 1HCRA 1E3OC 4LLNA 1G8XA 3G1LA 1HQCA 5DD8A 4KFCA 2DK2A 2VH7A 2L5QA 4UY8I 5FO5A 5BPIA 1HPZA 2CQ1A 3IHUA 4XM3A 3CULA 4FYDA 3G87A 2HDWA 1B8IA 3HXLA 3FNNA 4PFPA 3QOPA 1E6VA 3VAMA 3CJNA 2IBKA 1EZZB 1Z7LA 4NLGA 3UQSA 3DOMB 4FF3A 3M7GA 1G6NA 3I4MJ 5G0RB 2FJEB 1T9YA 1N5QA 3PYDA 2J8SA 3CJTB 1RWNB 4JI8F 3DGPB 2F5VA 5KFZA 2H1YA 1HWIA 4OZJA 2QSFX 1A6LA 3M9AA 5L9NA 2KVQE 3NAIA 3NL0A 4EI2A 5HO4A 3BQ0A 3NCRA 4I99C 2H8WA 1MBHA 5FKKA 4IG0A 4BU2A 3IM9A 3LF0A 4PXBA 5CHCB 1T0FC 1R5HA 3TUJC 3WBZA 4V2GA 2ASDA 3I32A 3ZO7A 1S1WA 3ET6B 3P9KA 2CW0F 3GR1A 2VL8A 3W6JB 1KYWA 2AW0A 2HQGA 3HSDA 1V9OA 2Y9ZA 4B02A 3IS9B 3EZ5A 2XHKA 2GW8A 3CC2S 1MJAA 2YTCA 1LDDA 4EJVA 1SJ3P 4E2FB 3G4SI 4BBSJ 1NSPA 1UJ8A 5DTDA 4IO9F 4TYBA 2ZHAA 1Q82T 3FIWA 1PUEE 3DQVC 4ZDLA 1CSJA 1PC4A 4DCJB 3EVOA 2HHQA 2PT0A 1L3VA 1RIOH 1PAEX 4JB8B 2YQ3A 3JYTA 1BR2A 4B43A 4R8HA 4OJGA 3V81B 2NXEA 2Z33A 1LW2A 3OTCA 4JX6A 3IGNA 1HNZF 4KNYA 4ITVA 1TK8A 4EJTA 3LOCA 1CQNA 3M2RB 4C3MA 3QAHA 3OL6A 3ZTOA 2PMZN 4LRAA 2JWNA 2JSXA 3R7NB 5KFHA 5C42A 1FT9A 1UVKA 1TZ0A 1Q81T 3K4CA 1E6VB 4IFYA 1V5GA 3UCGA 3R2DJ 5H9FJ 5MAOA 2J6UA 1IN7A 3TA1A 3I5AA 4LR8A 1BUXA 1FNXH 5EEAA 1M5KC 5B0DA 4ED4A 3FRZA 3NP5A 5DS7A 4HSTA 4DR2F 4GKKJ 1SV5A 2K02A 4DPYA 1RT6A 1LW2B 1D1UA 5TJJA 4ZVPB 1NHVA 4CO3A 2KJVA 2RNEA 1NYNA 2G9OA 2D1HA 3GXOA 5K14A 4TU9A 3MUMP 2BQ3A 4L9NA 4XLAA 1RT4B 3N97A 1Z1DA 3SDBA 2OPQB 2PGCA 4DL0C 4J9RA 3AOBA 1FDAA 1A7GE 4CUGA 5KFEA 3I53A 2BBEA 1TMMA 2AO9A 3GTQJ 1UZDA 1V54H 4JI7F 3DLLF 4QIWN 1Q16B 2HMIB 2QL7B 1F3VA 1U1OA 4FCYA 4PJ0C 5A0YA 3HPGA 1U47A 1WSRA 5IV4A 2XMAA 1O6XA 2W84A 1T08B 4DX5A 4EK2A 3ESWB 3CCJS 3IWNC 1X1DA 4EUVA 1CBKA 4RR5A 3SCJE 1JKHB 2DMQA 5D4SA 3OSPA 1TKXB 3ABLH 4ENOA 2ZKTA 4CO2A 5L38A 1TP4A 2MYFA 3CQZJ 1DGRM 2X6WA 4ZZLA 2UVRA 4QTRA 3D5RC 2LCWA 3NS5A 2K4JA 1B0VA 1H89C 3R2CJ 1OKRA 1RGVA 4P9FA 2YKNA 2BDPA 1USSA 1TP7A 5EZGA 2VPYB 1KHWA 4CCLA 4EEYA 1XIQA 3KEQA 2AIRB 3KK3A 1XR5A 5FFXA 4N5SA 4DQSA 4LUBA 2VXZA 3B4MA 3NWRA 3KZZA 2EA2A 4AVPA 3L00A 1P2FA 3L7OA 1N36J 4LFAJ 6PAXA 3REOA 5IT9Z 4WK1A 2KRHA 4I6ZA 3U9GA 3MMAA 3J81K 1HWUA 3W9HA 2MHNA 1ZLJA 2Z2ZA 1ZH5A 3WG9A 2DBBA 1XMBA 1ETXA 4J19A 2VQEF 3RRGA 3QPTA 1YDLA 4IQMA 4W90B 1FPQA 1IXKA 1ETYA 1HMVA 3BR3A 5IY5H 1WJ9A 3SMZA 2H48B 3AFGA 4FYVB 2EIKH 3DFEA 2DNLA 2YKOA 3PACA 4TNOA 2ASJA 3A13A 5HAOA 4QZVB 1YSJA 3AHPA 1TKZA 1HI0P 3K89A 3P9IA 5GAGJ 2XPUA 4HA8A 4UV9A 4E7ZA 1URNA 2VI6A 3KLOA 1QSSA 2EBGA 2HLTA 4BAYA 2MLKA 2FU4A 3DBLB 3HVTB 4KC5A 2ECBA 4YEJA 1VQ8I 2WONA 3PFEA 4C98A 2HKEA 2RDIA 3SZ2A 4L75A 5LMUJ 1KGSA 4UZBA 1O7FA 4RLQA 3BGOP 3GIJA 5DQGA 1Y5IB 1FYMA 2CKWA 2DYRH 2QC3A 3MFHA 4ECVA 4O44A 1JIHA 1P4XA 4I0AA 1FD2A 1SC6A 3OYMA 2FMYA 2VIXA 4DV6F 2CPFA 1XGOA 2QO3A 3IWFA 2GXGA 2HXIA 3DMJB 3HHLB 2UP1A 3VAHA 2O5DA 2QMUB 4HHJA 4USJC 2WTEA 1IKYA 2EV0A 4CYUA 3CJ4A 2V2VA 2HRUA 2OA4A 4B4CA 3LSHA 4CLWA 1W4MA 3KLGA 2M5WA 4LREA 2DNQA 1HW2A 3MTKA 4UUVA 2HBRB 4R0JA 5E3NA 1RHRB 5J2MA 4CCHA 2GQCA 1R6VA 3KP4A 2V50A 2EEYA 4I1TA 1VI7A 4AL7A 1SFKA 5B08A 1N34J 5K5OA 3K57A 1UPPA 3TA2A 2EQRA 1HQ2A 4PG8A 2J0QD 4NRTA 3R61A 5HQMA 2M3AA 2R5YB 2D3OR 4I02A 2Y8YA 2M34A 4FVMA 3QRRA 1S9HA 2YNHA 1ZAOA 3KUHA 2ZXWH 2YNFA 1TQIA 4L3KA 5KFKA 2L3DA 3M4OJ 2NYHA 3PX4A 2DH9A 2M0MA 1BJAA 2NVYJ 3R7SB 1ZRFA 5IT9U 1JJCB 2WY8Q 2DU9A 4X4QA 2CO5A 2XCAA 1DP3A 1I51B 3LAMA 3VAKA 5EZHA 2DVIA 3ZR8X 4ZYDA 4B9NA 1E6YB 1NSKL 3FM3A 5DEQA 5EG0A 1VQPS 4IRDA 2PJPA 3NOGA 4KITB 5LEKA 2ZD1A 1XMXA 4X62F 3C3LA 2D74B 3D3BJ 4RB3C 1RTHB 2HW3A 2V9PA 1HBUB 2AZ1A 3N0VA 1CJUA 1IO2A 5LRRA 3TQ1A 3B82A 5L3CA 3QIPB 3BJAA 2B9XA 1YIJS 1UFWA 4Q5VA 2W1OA 4F91B 3MEGA 3MPDA 3VR1A 4IH6A 3JRIA 1H8AC 4FNHA 1NJIT 3G2BA 1YK9A 3HHEA 1XNQF 1RT5B 4Z7YA 3BZ6A 1LW0B 1R31A 2ZXJA 1FRMA 1TWAJ 4CO4A 3HUGA 3IMQJ 3QGHA 1R4MB 3RZDJ 4DZDA 3WC0A 2D3O1 2MA3A 4UF4A 2LECA 1U1MA 1X2MA 1RNLA 3JAMZ 2HS4A 3FMBA 4Q2MA 3RBXA 4ZVSB 4HHHA 1WFXA 4WIIA 3FF5A 2QA4I 1YTYA 2A68F 3PO2J 3KMQA 2DHHA 4LRDA 1WD6A 3KLIB 1SJ4P 2MGZB 1R43A 2OHDA 2FOKA 3JB9k 3HKZD 4BYYA 3EZOA 4JI3J 5CYQB 2EPIA 5JJBA 2DA3A 1OCPA 2EA4A 2OELA 4DR6J 3FXLA 3GTOJ 1RAIB 3F22A 4DYRA 2BEOA 1YFHA 3WIUA 3S1RJ 4RW8B 1HKSA 1FRXA 2AXLA 4G6VB 3OYKA 5DG7A 3L2RA 4IDKB 2OPRA 3RZOJ 5ICCA 1AB8A 4MTEA 1UWBA 2GWRA 1EH6A 2NS0A 4AE5A 1QDUB 5L3DA 1BIAA 2CPEA 3Q8VA 1U09A 1KP6A 1YG0A 3T5LA 1BD6A 1Z77A 1D1BA 2FLOA 2FJDB 3J81Y 1Q53A 3PW5A 3NMAA 4ASNA 2YKAA 4EJOA 4XIUA 1IUYA 3HCXA 2Y75A 2XASA 1MMDA 2ZC3A 1SVOA 1YI2I 1MNEA 2XCPA 1FDDA 1X4AA 3TP0A 4BBYA 5KT2A 2CXEA 3CUNA 5D8HB 1QE1A 2DB1A 4DL4A 1UEUA 3WC2A 4RW6A 4LK0F 1JNRB 1BI1A 4B3MF 1N6QA 2O3DA 4PG4A 1ZM9A 2OD4A 2IRFG 1HW9A 4X64J 1WC0A 2JC1A 3OL4A 3CCQI 4J91A 1NZ8A 2HKOA 4MEXF 3IBWA 4ZVTB 1AA1B 4ZTFA 4UOGA 3MVPA 1RAGB 4DWIA 2GFFA 2OSQA 2CW8A 1BC8C 1XG1A 2O1PA 4CLUA 4NMXA 2N4CA 4NHJA 1HA1A 2FHJA 2VICA 3K5MA 2B8PA 4NXMJ 1U1LA 1KU2A 2R8IA 3HHNB 4HDHA 2ZBRA 3CWJA 3QIPA 5HJYA 5D77A 2GAUA 2E2JJ 1M5PC 1LWCB 2C2ZB 2XSJB 4U7UK 3D68A 2XSJA 2QQ8A 3O6BB 3IH2A 3QFHA 1GTHA 1LB2A 1VQ9I 3K0LA 1VBXA 1LWFB 2EZIA 4B17A 2HXOA 2EZLA 3CD6S 2IT0A 5C25B 4RZRA 2O9LA 4X4TA 5HMXA 4ZVOB 3J80Y 4PDKA 3GG0A 2CDRB 1MSEC 1RTZA 1T02A 2JSPA 2MH9A 1DP7P 2I8EA 5KG6A 2JA5J 5GMDA 3D6FB 1U5TB 2B7EA 2H5EA 3DLGA 2IJRA 2XB5A 4C30A 3ISZA 5MLCV 3PX0A 1JX4A 1UAWA 3CF5F 1Y0HA 2Z3YA 1YJWI 2AYEA 1Q5VA 1IKXA 3GR0A 3DOLB 2DLLA 4PFOA 3QU3A 4FPRA 4BACA 4CSWA 3UW1A 2MEWA 3V6KA 4A8QA 2MJUA 3IWXA 2UWMA 3KK1A 3E51A 4O23A 2KHMA 1JWWA 1OCOH 3VGUA 2MKJA 2ELJA 1BW5A 4LD5A 3M1VB 1WHWA 5DG8A 1N6QB 3K9TA 2XY5A 4KICA 2PBIA 3DLHA 5CH7B 3OXLA 4HTJA 2G1HA 2CQPA 4XNFA 2M8DB 3BO2A 4ON0A 2V5HG 1SIZA 3CF2A 1RWWB 4ID5A 3H35A 3SCIE 2YWGA 1JLFB 1VBKA 1OPIA 5LJ5Y 5IV3A 2HFUA 1H88C 2KYZA 4NZ0A 1KYZA 4OHWA 1VFJA 1ZGAA 4YFXF 2ZSIB 5GTIC 2V8VA 2RAQA 1TKXA 1ENHA 3GJTB 1T03B 4FYXB 1H2TZ 2P5LC 2VKHA 4JI7J 3JTHA 1XERA 2JX2A 1T0TV 1IXSB 3KP7A 2W9BB 4CO0A 2CNKB 4K4VA 3PO4A 1WI8A 3JRBA 3SDEA 1XMOF 4ECWA 4CLYA 3PKYA 1VGYA 1NK2P 4D9JA 3PXGa 3QYEA 2E1CA 3IR7B 3KEYA 3ABKH 3TO6A 1IBLJ 4XLFA 4HNTA 1MIJA 1OYEA 3TW7A 4CHUA 3QNWB 3LAKA 4A3KJ 2PO4A 2VG7A 3QZ8A 5ILSA 2W2NP 2XZTB 3GLLA 3E8OA 2K9LA 2E5JA 3S01A 3H3VK 3GFIA 4FXVA 1SH0A 2COBA 4JI0F 2HYGD 2D2WA 4DSLA 5AE3A 3OR2B 1PJRA 4DV7J 4F7ZA 1AFJA 2IYIA 4KJZA 3OYJA 1S97A 2PI5A 1T38A 3ZQIA 2V1XA 2W7AA 4UUXA 2YH1A 3F6OA 4G1QB 4TY8A 2DGSA 2IC3A 3C8YA 2H94A 4ZLJA 1STZA 3T1HJ 4EWTA 2MFZA 2NS1B 1FE0A 2DA7A 2IFXA 1DQAA 4PCQA 4KHRA 2QLFB 5JXSA 5F8IA 2HR3A 3HRSA 1C0UB 1ZA1B 2BOLA 2EG1A 4DG1A 5J1PA 3ENQA 1OYWA 2PI4A 4NC8A 2M8HA 2CW7A 4CH0S 2O0YA 5DM6Q 2EKYA 1UJ6A 1VQ5I 5A8WA 4K2XA 1Y8QB 3BSAA 3C2PA 4PKDB 1Q1HA 2PMZD 2E5GA 1T9XA 1VBYA 5FD1A 2BANB 3IP4B 3LOUA 5IM0B 3HZJA 1Q8KA 5LGTA 3D1HA 4QWAA 4HPQA 4XIDA 2BW3A 4A6DA 5D4RA 1NG7A 4YR0A 1UA1A 3MKLA 1U2RA 2V2QA 3W3CA 4ZHRB 5E17F 1N75A 1LFUP 1UP1A 1ZAVA 2AGPA 2J9DE 3TW0A 1FWLA 1MZBA 2Z5UA 5KFXA 1OJLA 4Z2XA 4J9KA 2Y2ZA 1X0FA 3VZHA 2DCLA 2VQGA 3L2CA 2DNHA 2EK6A 4AXIA 3HPHA 1C2PA 3UD3P 2JVOA 3SFIA 4WFBQ 4FDFA 1VQPI 1FWZA 4CYCA 2HZDA 2C2MB 2NPFA 1H2UX 3L2QA 4IX7A 1XMQJ 1BQMA 3D5MA 2K7KA 1EARA 3BWGA 5L46A 3IR6B 2FMLA 3DRYA 2J6SA 2DQRA 2OFGX 2G0EA 1RPWA 2LQ8A 4BDPA 4OYXA 4CH1A 2QVOA 3WTUC 2KISA 2E5NA 3DRPB 1SKWA 5AJ3F 1YQHA 3T41A 4PUOA 1TAUA 5AONA 2RU3A 1Z0XA 2XGPA 1S7AA 1AHDP 3HSGA 4KQZA 2VKDA 1SFOJ 3D9BA 2VFTA 2A2DA 1X3WB 3K4LA 2CDQA 5F8GA 2XLIA 4GXOA 4MHGA 1ELOA 4XLEA 2MQ8A 2HFZA 3SQGB 1NB7A 4KV8A 2D9PA 4USUA 4BS9A 1JUPA 2VZ9A 1CS4A 1B0TA 1TT5B 3KLEA 2OH2A 2E9RX 3OTBA 3MAAA 5J8FA 4YS2A 3HRTA 2I0XA 1VQLS 2XKOA 1UKUA 4K4WA 4AM3A 1ITPA 2GM4A 1FEHA 1MWQA 2ME0A 1RWPB 2L41A 1FWPA 3HSJA 4W4MA 4PUOB 5D3GA 4E7HA 4DV1J 4KR0B 2LQJA 3M3YJ 4I2PB 4ECQA 3DEWA 2UV8G 4ZS6A 1BR4A 2KH9A 3DV8A 4ZDNA 4WXWA 1UHMA 1FT8A 2M52A 2NOJB 2XG8A 1IN6A 2OMOA 2KM8B 2DEIA 4HF2A 1IRZA 3CDBA 2UV1A 4AQYJ 3KX2A 4M8LA 2XYGB 4E6KG 2WVDA 3WGIA 1JT0A 2JOQA 4OYMA 1GVDA 2XC7A 3TQNA 1WSUA 5KK1A 3TOAA 3RTVA 1HKQA 5LGUA 1FFGB 3CC7S 3MM7A 3R8YA 3MZ8A 3DNCA 3M6WA 4A8YA 4A8SA 2CUYA 1BC7C 5KOWA 3UN2A 1C1CA 3GJRB 3VAFA 2HZVA 4IQXA 2ZVSA 4NLYA 4GVBB 1MNDA 2HHUA 3KK2A 3OHAA 2XEXA 1IJEB 3RIRA 4B08A 1LEAA 3MEEA 4WE1B 3VVTA 1RESA 4LF8J 2CQ4A 2DHAA 4M71A 3R5GA 2H65B 4MYUA 1M1KT 2OPSB 3ILLA 1VMBA 2GVDA 1S1VB 4ZP9A 5ETQA 1WG1A 1KDNA 1NM2A 4LT6A 3FBNB 4ZP6A 3CCRI 3CD0A 1O3SA 2HHVA 3FEYB 3N79A 4MKAA 2VBXA 2WAEA 4BQAA 3SYZA 1VR6A 3D3CJ 3JCUC 4DN9A 2C28A 3RKQA 2KIMA 1GDTA 1S9FA 5J1YA 3FQLA 4ZOSA 2M30A 5IQQA 2EWNA 1FRLA 5FIIA 2BW7A 1ZN2A 4EZ6A 3IC1A 5LM7E 1HKTA 3QBCA 3F9KA 3CDLA 4WTYA 3TAPA 4ZMMA 4AYBD 4EYIB 3JAMK 2GMJA 2YVSA 2A05A 3BTIA 3GV8B 2IJNA 3KE2A 1RYRA 1S29A 3TUZC 3R1LA 2PEHA 2FJWA 5HLHA 1DARA 4KO0B 1HSJA 3V4IA 2ZC4A 3K7RA 1JXEA 1BM9A 2LA4A 3AKZA 3CC2I 2JH3A 2L0KA 4DV0F 2DOFA 1YRUA 2JTVA 2MABA 2ZFUA 1X4BA 3FX3A 1N0VC 4UQTA 5CJ9A 3SQNA 3ZMSA 5GPCA 4YFUA 1GXPA 3KLEB 3TJAA 3LFKA 5ETLA 2C2OB 4KMUX 1D3WA 3BGUA 3Q23A 2O8XA 5TISC 4MQ9F 2HIYA 3AD9C 5D8LB 2QN6B 5ICFA 4C2UA 2VKVA 2Q2EB 2D45A 2HFSA 2IC3B 3AL0C 2XNQA 2ZH9A 2ZBPA 3TVYA 5KAKA 2BJ8A 4JBCA 5CA5A 4IO9Q 4HT5A 2VJ4A 3GJSB 1R89A 3JRFA 1XBWA 2DNNA 1JXLA 1H72C 4WFXA 2DNYA 4G6QA 2QLWA 3KHGA 2GJIA 1S1UA 2IMWP 2FBKA 2NYIA 4I0BA 1KVIA 2HVQA 5HLFB 2R7OA 1APSA 3BQYA 2AEFA 3OS0A 4ZPDA 1ZETA 2ZKZA 2AEJA 1NH3A 1UVNA 5GAHI 2HEKA 2F63A 1LUJB 3JXOA 2WK4A 1R1VA 2GBYA 1JNZB 4I4BA 1B9NA 4FP9A 5HJXA 3A8KA 1VCTA 3GLXA 2BW3B 4V2FA 4P2MA 3BPXA 5KFYA 2Z4PA 3IO1A 4AIDA 4P6QA 4F4AA 2YBVA 5M2RA 5HMZA 4GKJF 3M6XA 1U02A 1J5OA 3T1YF 5F8HA 2GIRA 5BS6A 2EFPA 3DXBA 3SQOP 4NBQA 1R3NA 1QAIA 1JKPC 1P1LA 4LRCA 4N41A 1RUOA 1W7PD 3RB0A 4ZVHA 1T95A 2C2DA 2V6AA 4XL9A 1PGZA 3NGTA 2BGCA 4ZCKA 4DR4F 1U5TC 5CYQA 5E3AA 3CDAA 3BG5A 2F4OB 4F4XA 4C3IJ 5K5QA 4R5PB 1SQGA 1WSVA 1TV6B 1BIBA 2M87A 1E3HA 4URGA 4B3XA 1MSFC 2WB1A 4E7IA 4XONA 2HZCA 1TBXA 3A0BC 3FCVA 2STTA 3RGIA 1FXDA 3IRQA 4MK7A 3JSBA 3KMSA 1X5TA 4B3RF 3ZNUA 4FVCA 2NSCA 3AG4H 5KFQA 1YOVB 5H6QA 2HRYA 3DGVA 3HFKA 1TNSA 2PFBA 3W63A 2DKOB 2HEOA 2E19A 4H4KC 2DJWA 2G4BA 5DDRC 3ONQA 3OT9A 5FRNA 2Y1IA 3FZ2A 2X1GA 4DUTA 1VBZA 3WTZA 1IBLF 3LANA 3JSMA 4ED2A 1HBNB 2ZBCA 1EETB 1F5CA 2P6SA 3C15A 3LSKA 1TWGJ 2K3PA 2DIUA 2GXAA 4KGVB 2ZJ2A 3QT8A 1EJ7L 4EGLA 4IRHA 2B7BB 1RDRA 4P55A 4MFBA 2ZNZA 1NG6A 4OIOF 2OKQA 1U6FA 1JLQA 3M9NB 1R6YA 3OBIA 4YB6A 5CCMA 2PI0A 1FJEB 4C9DA 2DMNA 4V1Ak 5DLFA 3DF8A 2Y9YA 4E70A 4IRKA 3Q83A 3B6AA 3LSJA 2HQFA 4GCVA 1RRJA 1UJ4A 5K9FA 5LMUF 3OHBA 3W2WB 2QSHX 3FXMA 3I59B 2BZTA 2CIMA 4KN7X 1JLFA 3W5XA 4A46A 5AIPA 3B6CA 3KG1A 4J37A 4ZCMA 1VC0A 2EFVA 1R00A 3WTXC 2F5CA 1RAJA 3BYRA 1DY3A 3R97A 1T3NA 1KRPA 2MSSA 2AS5F 2MPUA 1LEBA 1N5YA 3I56I 2LK2A 2DYAA 4B44A 3MOJB 2FVCA 2L9SA 5CZVA 1KOOA 3KKFA 5J2PA 3S3NA 3IRWP 1NSAA 1GT8A 1X8DA 2GVZA 3PJXA 3TKYA 4NZ6A 4ANEA 2W7OA 1Q8LA 2HQRA 4EVIA 2E5IA 2M4KA 1FRHA 3VZIA 4CRJA 1T7PA 1KLNA 2V9KA 1U8SA 1LVAA 4ECSA 2DISA 2HNDA 4YELA 2V7FA 4TU8A 3CEDA 1YITS 4P75A 1HW5A 4RNOA 1SJFA 4MLOA 2A6EF 2HI3A 1FO1A 1KLMA 5JVHQ 4DX6A 5M5YJ 2HWVA 1IN5A 3DXSX 3EGNA 1PYSB 2QYGA 2WSEC 3CSKA 2JA8J 1I6HJ 3A03A 3W5ZA 3A1YG 3PYGA 3BZQA 2BJ3A 3BR2A 3HB9A 1M5OC 1UZHA 3NKYA 1XMKA 4NB5A 4IHSA 2MKYA 5HLTA 4KFBA 2YR2A 5DV5A 1VFCA 2IBOA 1NNDA 3ZXWA 1YHQS 3RTRA 4DFPA 2XMMA 2OUGA 1ICEB 2H1KA 2QQAA 2VC0A 2VPZB 4C97A 3LWFA 3CJQA 2ETHA 1J5OB 3KDOA 2G0CA 1S1TB 4MO7A 2GGPB 2JHEA 2ROEA 4DR3F 5ADZA 2VKZG 3M1CA 2AMCB 1UB9A 4KYZA 1LQ9A 3IAS9 3KJFB 4I2OA 1LE8A 5ILUA 3D2WA 1USTA 1QGPA 3E3VA 3N28A 2F5EA 2GV1A 2ASYA 4OI3A 3TZXA 4XOTA 5L3BA 3W6VA 5KFCA 5F64A 3RQIA 4C6AA 4N77A 2FF4A 4M5MA 2VL1A 1WRJA 1ZS6A 2FJVA 4ELUA 3P9CA 3VYRB 3CO9A 3AODA 2KPMA 2BA9A 1CJKB 4DR7F 1H2VZ 4DUYF 1XGMA 4MFDA 3W65A 1ZPWX 1BJZA 1YQAA 1K8AT 1XB4A 4LBHA 2HOAA 3TAMB 3HJEA 2B4PA 3F21A 2GVDB 5FKLA 2RN7A 2M8GX 4C11A 8RUCA 1S1WB 4EM1A 3B02A 3TWZA 1OR7A 5IFMA 3BTJA 2D41A 4UOHA 4AYBN 3GMGA 2OSRA 1KU9A 3IAM2 2A18A 4QW9A 3ULHA 3BR6A 2QKLB 1SAUA 2JK3A 1E0EA 2APOA 1FDBA 1LKZA 4WKYA 4FS2A 4MGRA 1S72I 2DN0A 4MTPA 3NCQA 3CD6I 1U9OA 2R5YA 1TL1A 4U95A 2O8KA 2IVMA 3PEJA 4PJNA 2FEZA 4UOFA 4F8RA 4M6VA 3CJRB 3EYIA 4F25A 4KO0A 3S17J 1FSEA 1XR6A 1GHCA 4KB7A 3GWZA 2M4GA 1QLNA 4QW8A 3E5UA 2W7PA 1XMAA 5T7LA 2YPRA 5M3MJ 3CMEI 2QBYB 5DG9A 1CGPA 1S6PA 5KFUA 4HLXA 1F1BB 4F36A 2X1AA 2ADCA 3TANA 1B64A 4XPEA 4RAZA 2ZDPA 1SKSA 3DOKA 2HBZB 1YRTA 1N5SA 1VC5A 2HVHA 2L9WA 1HW8A 3V6HA 2HNZB 4PRFA 4OU0A 1SVLA 2WB1D 1BQNA 3AA8A 3VAJA 1PO6A 4YIIA 2B4VA 3JTPA 3T1BA 1FK9A 1PKUA 1TK5A 2SXLA 1S0MA 1JTYA 1DTQA 4KFBB 1FVQA 1XGNA 1B3TA 1R9TJ 2DYSH 4XK8C 3R60A 1FOXA 2A10A 2C3OA 4MIBA 3IRXB 1XSDA 1XR7A 5AXLA 1U25A 1L0OC 4DR5F 4A0XA 2LMDA 4LF9J 4I98B 4H4KA 1RHUB 2QYCA 5HDGA 1GAOA 2JLGA 2VXDA 3EE3A 4LF4J 1PYTA 3IFEA 2FNAA 4DSJA 4S0MA 2O66A 3BG3A 3PQKA 5CYVA 4A69C 3HGGA 1JLAB 3M6UA 1YX3A 3AOCA 2A0FB 3G6YA 1F5BA 4FXDA 2P5VA 2Z2MA 2DXFA 4ECZA 2RH3A 2Y0SD 4GVBA 5JFRA 3V8JA 2LA6A 1U48A 2LYCA 4BNCA 3MKZA 3CCRS 4XLCA 1GXTA 1A0OB 3BZCA 4DPWA 5L3FA 1YRNA 5F04A 2E9ZA 3CP2A 3I3LA 1S79A 2EFNA 2KKOA 2E29A 4EYHB 4WU2A 2C2EA 2IP2A 1PG5B 4Q4ZF 3M8WA 1QAXA 2LR8A 2M4MA 3A02A 4DU7A 2GOMA 3NOCA 3O6QA 3HO1A 4IKAA 1YI2S 4HR2A 2N8GA 1HYSB 3MM5B 3RDIA 4LBPA 3MECB 4D3HA 2E5ZA 1VIXA 2WRMA 1R6RA 1PP7U 2QTWA 4KT6A 3HHLA 3ZQGA 3VPRA 2D1CA 1X58A 3QWLA 4LSLB 4NI2B 4IG3B 4IZZA 2XRLA 1QVTA 3GQCA 1VJQA 1U4BA 3C2GA 3VCDA 2XKPA 1SUQA 2GCFA 3MCOA 3S32A 2IS4A 4AU7A 2BQRA 4X2BA 4LF6F 4B9TA 1NK7A 2YPYA 4B3TF 3ERMA 4XRSA 4DPXA 3QYBA 3IH3A 1SJRA 2BJDA 1R4NB 4F4YA 3A8IA 1RKTA 4J5OA 4NZ7A 1VK8A 2K06A 1P92A 2FIUA 3K7AJ 4LOCA 4DR5J 2A6HF 3RPUD 5BJRA 3CC4S 2DT5A 1TL4A 3BDEA 3CLOA 5J1RA 4I64A 2DY9A 4J01A 4ED0A 3DRRB 4Y3CA 4HH1A 2C3YA 2IGNA 2U1AA 3MDFA 4QLCU 3Q0AA 3GG1A 3CIZA 2R2SA 2LYVA 2J7UA 1FESA 4LF5J 1VQ9S 3FXOA 1G2EA 1PYOB 3FSXA 3BDDA 4JI2J 3VALA 1KKHA 4O6JA 4BDZA 3JYTB 2KFDA 3QYFA 2R0QC 2IYGA 4AL6A 4CZCA 4G9YA 5DCFA 1YBAA 1NK6A 5JR3A 3LA3A 5DCMA 3N4WA 3PRVA 1XN9A 4PXCA 3BC8A 3QAUA 3BCAA 4JYAJ 1N33F 3OL3A 4GMKA 1X3UA 2BXYA 3TOBA 3TBIA 1O57A 1U1NA 3S2DJ 2YUSA 1BMQB 2AT1B 2P81A 3OR1A 2VLAA 4P2FA 5KAFC 4U6PA 2W01A 2MQQA 3NCPA 1NU4A 4A8OA 3QATA 1CVJA 5K5RA 2K3KA 1N0UA 1NO8A 1O8BA 4NYZA 1TKDA 2D69A 4ZVUB 3HRMA 4G65A 4DV7F 2VOPA 3H0PA 3E6MA 2R7VA 1DDNA 5HP1A 3KK2B 2W7NA 3MGJA 5CXTA 1C1BB 1GFWB 4U96A 2DW4A 2ZZTA 3BG6A 5CD4A 1FEEA 4NA2A 1ZBTA 3A3OB 5ETMA 4WF9Q 2VQCA 2XSFA 1OPZA 4UHTA 2AJ0A 3C18A 1MG7A 3U27A 4DR1J 1CJVB 4LF1A 4DL2A 1TL3B 4GRSA 4DSFA 4K8RA 4M5DA 1DLOA 1KFDA 3K5LA 2DA4A 4ICLA 4BE2A 3RAQA 3G6VA 1KQSR 5E3CA 1S6LA 3OSNA 3KDNA 2DA1A 2JA7J 5EX3A 3MAHA 2BQUA 3D1NI 3TI0A 3GMEA 1UCRA 3OOUA 1RLDA 3DPLC 5IOLA 1S6PB 3PDNA 1WKLA 4LF2A 3LSTA 4M94A 5LT5A 2AQ4A 1WVRA 1XTZA 1PCAA 1BL0A 4EO6A 1QVFR 2CNLB 1SV5B 3GPAA 2FHOB 2R2RA 3F3XA 2W4PA 2RRNA 4DZJA 4IXAA 3UN3A 4CLTA 2X1DA 2BY0A 4PJMA 4IL6C 2MHEA 2RC4A 4MIAA 4CLLA 3CTAA 3FKJA 3HOZJ 3LP0B 4HX8A 4DCPB 1Z4UA 3K4JA 1PIEA 1S9EB 4WXHA 2CG8A 4PYAA 2E7VA 4P7VA 3JTNA 2VFUA 2V4QA 5HMYA 2LH9A 1EKEA 2R7SA 1NK4A 2FTRA 1REPC 3QZ7A 1ULYA 1MU2B 4CLFA 2ZJPF 3X3UA 4PWDA 1MMNA 2FOWA 2XO6A 2ERRA 1MDMA 3MFKA 3CJSA 3QWUA 1U0HA 1IW7F 1GQEA 3E97A 2VJUA 4F0KA 2BM1A 5JUMA 4QPXA 3FXKA 2CA9A 2JUCA 2DPDA 1NPRA 5DZ6A 1T9UA 3DI6B 5HDNA 4ILLA 3JREA 1VTNC 2RKIA 1TTHB 1RWMB 1ZM2A 2EFOA 4PJJA 3N5FA 3O8GA 4OI2A 2NXUA 1XK8A 4OJ1A 2HAFA 2CRLA 1JHHA 1FJGF 1XWLA 3RKXA 5CVVA 4CYCB 4XSXF 4B1RA 3QSIA 4IO1A 3CESA 2QZ8A 3FCWA 3IS9A 1P1TA 3BQZA 1VI0A 4F4KA 1FRIA 2P7CB 1AW0A 4UUWA 3LWLA 3WG7H 1VF9A 5J8CA 2ZJRF 2LXIA 2OUMA 1Y4ZB 2XF6A 3HD1A 2JA2A 3PW0A 2PX9A 2DK8A 3TEHB 3QODA 1JLGB 1LWXA 2Z99A 4D0PA 3G73A 2WW4A 3U2RA 3KOAA 3D1QA 4M5KA 5J2NA 1SVMA 2XAUA 4E7KA 3K4NA 3TP3A 3ZZ0A 3DEEA 1YBTA 5CPRB 3KZIC 1L3SA 1OLTA 2MKSA 2DITA 3JSYA 2J5PA 3R5AA 2VV5A 9ATCB 4N8OA 1JLQB 4DQ2A 5F0HA 3HIFA 2TDXA 3CT9A 5D5XB 1XN7A 1WC5A 1SMTA 1R0AA 3ZZYA 4I2QA 5FRMA 2FNPA 4YQWA 1IBCB 1U2FA 1PP8F 4B3MJ 2ZKUA 3PX6A 5CVRA 5L1KA 4RM2A 2GHVC 2DGTA 4X64F 2V8PA 4FISA 3GZ7A 1IUFA 3EJMA 1HHSA 3ILJA 3C6UB 4EGYA 3RW6A 4Q43A 5ETRA 1F9EB 3GFLA 3ABUA 2IA0A 1QPMA 2DRBA 4C0HA 5DLGA 2Y31A 3M8QB 4WIQA 1ZAXA 2ISYA 2FX0A 4L9VA 3HX9A 1S5LC 2EFGA 1ZGWA 2HVDA 3OTDA 4F55A 5FD5A 3JSRA 4IH7A 3SV4A 2V94A 3ELHA 2KZZA 3TO9A 5D15A 3H4DA 4B3OA 1EETA 1HR0J 2HQNA 2JUGA 4L5IA 2ZDOA 3DDIA 1WTFA 5L3EA 4G1IA 1RK8A 4OZ5A 2H3EB 3TP2A 4YP3A 2R3SA 4JK1X 2CJYB 4MKVA 1YJVA 1K47A 2ASLA 4LFCJ 3ITHA 1VOMA 2QENA 1DPRA 2LQ9A 4IEJA 5D0HA 4DLGA 2YX1A 2FLLA 3LP1B 2FY8A 2IS2A 2UXNA 2V79A 1RBAA 4DNCA 4IKFA 2KL4A 1QBJA 1H74A 1GUUA 3G8QA 3SSRA 3M8PA 3KHRA 2VD3A 2A5WA 2NS8A 4F4WA 3Q22A 1A5JA 2Q66A 2KZVA 1N48A 5ED4A 1M90T 3RCOA 2CUFA 1WH7A 4A3JJ 2CZVC 2GQ2A 4BC7A 1XCBA 2L9NA 2QV6A 4HEA9 1KSPA 3US5A 2V34A 1YJ9S 4ENNA 1K0VA 4HYEA 4OI0A 5I42A 1CJUB 1QPIA 3N05A 4PSXA 4P73A 1DAXA 3GCWP 4IPAA 3K1PA 4RW4B 2H54B 3W66A 3M7VA 4XKCA 4DW6A 2IA1A 4OIPF 5C2GA 3RPUA 3IUOA 1JMTA 1W5TA 3HSRA 2DODA 1OWXA 4LVNP 2JA6J 4NL5A 1N32J 5THWA 1EQMA 4TQRA 3MM6A 4KDPA 2AYGA 4BJ5C 2V67A 1KU3A 3MPUB 5CQGA 4DOZA 4FHTA 2CH0A 3OFGA 1T33A 2JZ5A 4FZVA 2VONA 3G1OA 2CU7A 2XRNA 2F7VA 2LC2A 2PMWA 3CCMS 1VQKS 4UUTA 2DFEA 2O67A 2ZOGA 1RQ0A 3E01B 1H73A 3OYDA 2W85A 4U8YA 2AQEA 5M5WJ 1AKHA 1QVUA 3F8NA 3RBZA 4LMYA 1K4TA 2HOTA 2CJ9A 1IKXB 1WEXA 3BN4A 4G7OF 4L9TA 1V55H 4RW6B 4LVOP 1G3OA 4HYKA 3DU5A 4X0GA 2LEAA 3P7NA 1G4CA 2EZKA 1RT4A 2CPIA 4ETSA 2DGWA 3GIMA 4K5SA 1RT5A 4QWCA 4MNUA 4DZPA 2E36A 1RTIB 1X1AA 4Y0FA 4ZVEA 3ZN1A 4QR0A 3QJJA 2ADUA 3ETMA 3C2BA 3IRRA 4EM2A 2JC0A 4J9SA 1J9IA 3F41A 1FMWA 1YBUA 2OEMA 3IKVA 4NLDA 2BE5F 4K0KF 3WE3A 4ED5A 5KFRA 1JJ2R 2MZJA 3EICA 2NUUG 4BHPA 2CSOA 1FX7A 3AXMA 4HSRA 2ZD1B 5FDLB 2MLGA 5LLQA 4C8OA 2KL8A 2XBPA 3ZRGA 2NZCA 1S5ZA 3PL8A 4ZLNA 4IUFA 4TY8B 1SKRA 2ZJQQ 3B54A 3GONA 3QU6A 1NDCA 4KGZB 1J27A 2V0NA 3PQJA 4CCMA 4A8XA 2YNFB 4YR3A 3FK7A 4X1EA 3PZPA 4ECTA 4ZA1A 1RUSA 3FXQA 2X3DA 3KFWX 4K5RA 5GADI 1YLFA 3EUHC 4RBOA 5B7WA 2PFDA 5DUKA 2ZE2B 3D0SA 3T1HF 5F8MA 3CCTA 3G2XA 3HUGB 4OX9J 5G4DA 1RHMB 5KFLA 1NKBA 4U9RA 1PYVA 4Y34A 3KNGA 2XF7A 4FN5A 5BYQA 2I2YA 3ZGKA 1RHKB 5DDQC 2BV6A 2RILA 2CJJA 5EGYA 2I38A 2NR0A 2GX8A 5F1JA 3S16J 1DQ9A 3F56A 3WTYC 4DF4A 1Q86T 1TC3C 3ZMVA 1YJTA 2HWHA 4V19X 3EUKL 2BMBA 1VQLI 4DGWB 2RHQB 3K59A 4OIQF 1RKJA 4CXFA 1W25A 4GFBA 3DLEA 1DURA 1CC8A 2XI2A 3E6BA 3PSFA 4C3KA 2ZUAA 4IDKA 2HAIA 3SV3A 2YNIA 2DTZA 4GKKF 2UUAJ 3PJRA 1IKVA 2E7WA 1KOHA 3Q8SB 3O3KA 5KCMA 5HVQC 2ILZA 1SC7A 1SJQA 2XO7A 3M30B 1KZHA 1B4SA 3G6ES 1UEVA 3TL4X 2R7TA 2BVMA 4ELVA 5ETPA 3HLUA 3QOEA 4LB6B 3DRSA 4CLZA 4QSHA 3HP6A 2MGQA 3ZQ7A 4YRVA 1UZCA 3SCLE 5KVRA 3R5BA 3GTMJ 4XKBA 2O7OA 2VN2A 3QMQA 3FKBA 2LXFA 3ZTSA 5FD6A 1CJKA 5E8IA 4ED7A 3B8HA 1K9MT 2B9YA 2QMWA 3KK1B 3K6GA 3OLAA 2VASA 1VQOI 4OFZA 2VG5A 2X3GA 3ZN0A 2JRSA 4WWCA 3Q86A 2DXEA 3AG1H 1OCRH 2B63J 2BW2A 2DNGA 1N5VA 2HDDA 5J2QA 1IKWA 1D8ZA 4WP8A 4WP3A 2HBQB 1IQTA 2ECCA 1V5EA 4TQSA 3GV7B 3GB0A 2AU0A 4EBEA 3BJOA 2W25A 3ABMH 1CPZA 5B0CA 3MAAB 1NKEA 1KN6A 1FOKA 2GHPA 1KQFB 2LDYA 3N6NA 2PSZA 2YKMB 4ZVQB 3A4CA 1TV6A 4HLBA 1ZTWA 3P96A 3QGPA 1MBJA 4JI8J 1PUFA 1F60B 5L3GA 2GZWA 2MQPA 2FVSA 2O6GE 1FKPA 2M8EA 2B5JA 4OYAA 1C0TB 2A6MA 5KFAA 2PQ8A 3TZYA 2M7SA 2BR0A 4KV8B 1QUPA 3VOEA 4XLPF 1U7LA 3NRBA 5EG0B 2VDIA 4NLOA 2DA5A 3PFYA 3BKFA 2OC6A 5CYMA 4A3CJ 3MEDB 5BYSA 3GYXB 1F5AA 1B0PA 5GADJ 2COLA 4HDVA 3HDDA 2W2MP 2RB7A 2GAHC 3U7JA 5DRKA 3RUBL 2BKPA 4ZITA 1ZREA 2VG6A 2CQBA 1RT1B 2Q6BA 2AF6A 2OPQA 2QSFA 4LF8F 1N77A 4PG7A 4EBCA 5CKTA 2GS8A 1UVMA 1D8JA 4CGZA 3GTPJ 2DO0A 3GTJJ 4CO5A 3QO9A 3CCSI 2HZAA 2MBFA 1FF2A 4BKXA 1SCJB 4BUPA 3TUPA 1ZAWA 2HK3A 1WNEA 3KHLA 3W2VA 3V5RA 3VGSA 1U0HB 3RBDA 5ICGA 4L9JA 3QJLA 2VUGA 3PUFA 1U24A 3H9QA 4E98A 2H5IB 3OYNA 3KP6A 3KCCA 3QRQA 3O5TB 1TT0A 1FK9B 4UQGA 1CQTA 1C0TA 2CQ3A 3HZGA 4ZYEA 3OTOJ 2F5FA 4Q48A 3OSFA 3M2RA 5H20A 5LRSA 1V5IB 1TKZB 4MT1A 3MD1A 3H59A 2XHWA 4AUXA 1CF7B 4TN2A 2LP4A 1QZEA 3V7SA 3HI9A 1NB2A 4CNYA 3DLBA 5FJ4A 2V2ZA 3VYUB 1QM9A 1GTEA 4XKVA 2HNDB 1ZG3A 2PMUA 1NPPA 4LR7A 1HHTP 4DQIA 1L3LA 2PJRB 1NJYA 5EWGA 2VIHA 2CFOA 1T11A 3DOKB 2XS7A 3D5LA 5HSPA 3GUDA 1CG2A 4RJVA 4QIFA 3NAUA 3GLJA 2VQFF 3BTLA 3BKTA 4OHXA 3T8RA 2LEPA 5KFGA 3D0GE 1ON2A 1RT6B 1ZA2B 4DIQA 5EDNA 2K2PA 1KA8A 5A8KB 1NDPA 1CJVA 3LA7A 3D0IE 2WAFA 1M5VC 5K8PA 1JUMA 1J7KA 2NNNA 2CPZA 5H9FK 4HV5A 2R5ZB 1IAWA 4CDIA 4NC7A 1CS4B 2VA2A 2GIVA 1X4OA 3CCUI 3ZQFA 3EGZA 1S99A 4Y2IA 1RR8C 2UXBF 3CDWA 3DCFA 3S2HJ 4DEZA 2DFFA 4RB0A 1K1QA 3RPQA 2MQNA 1J59A 2CQKA 4A2UA 2EBIA 1E6YA 2BJ1A 1VJWA 4CM2A 5F0FA 3S1QJ 2DOAA 2KJCA 2MC4A 2CG4A 2NCKL 1ITYA 1RKWA 3U1KA 4BJTA 1F36A 1LJ9A 4K2JA 3C3WA 2A2CA 2W2PP 3H92A 4P10A 3H36A 1XMOJ 5GAHJ 2M5YA 2AP6A 3UVJA 2CWEA 3HOUJ 2IDEA 1AT1B 2A5YB 3MI7X 2FD2A 2Z2YB 1IXCA 1UVIA 3SZGA 1K7AA 1RHJB 1XDSA 5L8RC 1RTJA 5HNFA 4KGKA 3M8SA 2MSTA 3PV8A 2BE2B 1ZKGA 3Q8YA 1RT1A 4X65J 1WJFA 3A3NB 1LOUA 1RTDA 3WU1B 3BGFA 5BXIA 1UCNA 3OR1B 1G3TA 1K78B 1O3TA 3T8TA 3BPSP 1FDNA 3FISA 1U9NA 1XPXA 4ZIWA 1RR7A 4AIKA 3OFEA 1GMWA 3KLGB 3T1YJ 3V7RA 2E35A 2W8KA 3LTOA 1FP2A 2IA6A 3V7CA 2R7UA 4WFYA 5KFMA 4XPCA 3P5BP 4O5VA 1TUWA 4NXNJ 5K8OA 4WPAA 3JAMY 4DL5A 1RETA 1EP4A 1YX5A 4NQWA 4WXCA 4IG0B 2IRYA 2AX0A 4PG5A 1D8YA 1WJ5A 4LITA 1HOMA 4DV5J 2M88A 1HD1A 4RU9A 2J9DA 1WJDA 4B3SF 2L9VA 5C42B 1NKCA 2IVYA 2MZQA 4CCJA 4B9VA 2A07F 1YW9A 1VDHA 4HQMA 2BACA 3I4HX 4YDDB 1SC1B 1MN7A 4BL0B 3R27A 4NEYA 4OHZA 3CD5A 5FKNA 2BVLA 1Y1WJ 5EHHA 2IW5A 2B9WA 2NQPA 1VQOS 3ECOA 3BGRA 3Q8QB 1O7LA 3V8LA 2X6XA 5FLMJ 4WYLA 3J7Z5 2UU9F 4K59A 3OL8A 1JGSA 3CUOA 3N5BA 3VQSA 2KU7A 5E33A 3ZQCA 1WGXA 2FZGB 4F67A 4R8UA 2E9TA 2EFWA 3HSEA 5A6WA 1VRTB 5SZTA 1ETOA 2GO9A 5M3FJ 4ETZA 3UR3C 4P52A 3MCZA 1WEZA 3KIOA 1P7IA 1B72A 1HNZJ 3D1OA 4X65F 1XQIA 2HFHA 5LHGA 1Q0NA 3UNGC 1Z1ZA 3OPKA 2Y30A 2ZCWA 1KTVA 2DGQA 4L5EA 4EBDA 1S0NA 3RR8A 3J7AN 3VTIA 2Q79A 3G86A 2F1FA 1NH7A 2ZM6J 1Y10A 2OMLA 4JI2F 5A2QZ 2QLJB 1NDLA 3LSMA 3NAHA 2AJFE 1NEEA 5M2UA 3IKTA 4C0BA 9ANTA 4J9OA 4ECYA 2UUCJ 1B4AA 2J7WA 3DN9A 1R5GA 1MH4A 3SEOA 2FQ3A 2DR6A 1TK0A 1QA6A 5J4YA 3S1NJ 2E2IJ 2DMUA 2ZUGA 5GAGI 2HQCA 3COAC 1PDNC 1SFXA 4DCOB 3CP8A 2MKCA 3WE2A 2Z30B 3S6EA 4RW4A 3PR5B 5IT9K 3C16A 2W4DA 2E34A 2GZOA 4RUCA 2KKHA 1NZAA 1ULRA 3QGIA 3CC7I 3TNVA 2YKQA 3G82B 2QA4G 2XGCA 3FSYA 2DOEA 4ZPVR 4DG1B 3OVSA 4PJLA 3ZMTA 5DJBA 3ILOA 1GEHA 2JT1A 3W2AA 1K83J 4DYQA 2NVXJ 2LF7A 4N47A 5A8WB 3OIQA 1M5SA 4C11B 4NXMF 4L73A 3BR1A 3K17A 3QP6A 3IRXA 5G0RA 4S04A 4JBAA 3P5JA 1TL8A 5IT0A 1XNQJ 4OX6A 5F0WA 1V5FA 2CVEA 3KLNA 1HARA 3H9JA 2LREA 4CCKA 1I6XA 1NJZA 1I1SA 3P5TL 1VQYA 1Q78A 3KPHA 3VB2A 4NQWB 2OGUA 4KGMA 2ZITA 2B0LA 3NS6A 5IS2A 2MGZA 1JT6A 1X4FA 3THTA 3NBPA 5IYDJ 2NVUB 2WBRA 3BSNA 2UUBF 4HDUA 1I5ZA 1Q1VA 3EDQB 3K8VA 5I3UB 4AQYF 3NLCA 3LP1A 4YR2A 5E3RA 2CQ0A 2RDJA 5C3EJ 3R5CA 2HURA 4NLWA 2Z0GA 1FEXA 4BGDA 6FD1A 2HHTA 3FXUA 1ZR2A 1WZ2A 1T94A 5B09A 3JSOA 2F5DA 2VG7B 4NA3A 1S6UA 3CJ8A 2IEKA 3AG2H 1HD0A 1LFBA 4JI6J 3CJQB 4ICLB 1VZ0A 1TVRA 4W98A 2BHZA 4M9ZA 1S6QA 3BP8A 3L1PA 3HKZN 1FBUA 4JV2A 3LPEA 4JI4J 3TDZC 5KG3A 5KFTA 1SEUA 1JLBB 4LBIA 1KD1T 1HNXJ 3A3PB 1W0UA 5ETOA 5L1IA 3OD2A 1MD0A 3PW2A 3N6LA 4A3GJ 4WBFA 2N3LA 2FE3A 3BR0A 4LF9F 3AAWB 3M2UA 3MTJA 4XN3A 1R8PA 1G6BA 5B1BH 3MXHP 1LKXA 6AT1B 1P6RA 3NEUA 3V81A 3TAMA 3LSRA 4RGUA 3C16B 3DHWC 3OYFA 4XSZF 3ENVA 1NUEA 3UD4P 3HTUA 3K70D 3QT7A 4ID5B 4CLKA 5GTHC 3WU2C 4U88A 2O61A 5A6PA 1JLGA 2HGMA 5JI6A 1U8WA 3CCWA 2PFFB 4M3DA 3TQEA 1K0TA 1QHGA 4G94A 4CCNA 1ERDA 2HMIA 3S15J 3W61A 4F3MA 5T14A 4LRFA 1RCXB 3MZIA 3CC4I 2POKA 3TOQA 1Y8RB 3JQKA 4BC9A 4N9IA 1X7VA 3EYYA 3HM9A 3VFZA 2F3JA 2DNKA 4M5JA 1QZYA 4PSWA 1REGX 4M1KA 1OS5A 5F3ZA 1I39A 3QSYB 2K1RB 3DMJA 3D28A 2JQ7A 1Q4RA 3I31A 3E1SA 5KFBA 3KUGA 3MAQA 5HLFA 3F73A 2VKRA 5KFDA 3IL2A 2IRXA 2XSDC 1L5UA 2PA8D 3FMWA 5I3QA 2Q6CA 3LQRA 3KTQA 4C8ZA 2DR7A 2K7LA 2LY9A 2BM0A 4O0NA 1YJ7A 1L3UA 2XZWA 2EINH 2V69A 3ZZZA 4C3JJ 2IA2A 3B78A 3F44A 3UE2A 1SD4A 1SQFA 1FNNA 4ESFA 1S49A 2R3VA 1J5EJ 1JLBA 3GYNA 4RBVA 2BJEA 1X4GA 3EVWA 4Y4RA 2G13A 4HDGA 1BXNA 2HVRA 4WTOB 1HBMB 1Y7PA 3DM2A 4LFUA 3MR7A 2NZ4A 2H4WB 1D0EA 2XC9A 4JV5J 4QBUA 4LF5F 2EV6A 4FYYB 4QIVA 4M95A 4U67Q 3BJYA 3DBRB 3QLHA 3V42A 5ITHA 3ZQQA 3E7LA 5HROA 1P9QC 2VT2A 2MXYA 2VOOA 3C14B 4K4TA 1JJ6C 4V19K 3EM1A 2F48A 3CCMI 4Z7CA 5AJ3J 4DPTA 1MSWD 5DDPC 3EDRB 2ZH6A 2YWKA 3ZC4A 3HDSA 4B9MA 1MBEA 2CAJA 2AEMA 3FSIA 3HHHA 1TWCJ 3MCNA 5AXNA 5FKOA 2M0GB 4CZZA 5L1LA 1HL6A 3MMAB 2Q8KA 3H5AA 1BBYA 3G71I 3SYTA 4TY9A 1FHTA 1NBEB 3OV8A 1JQGA 3A0HC 1KQ0A 1NPKA 2RREA 3K2AA 4JI5F 1TFWA 5E0OA 1SL2A 1RC9A 2HHXA 1UWBB 1FNMA 4NLRA 1R0AB 1SJ1A 3ZTRA 2DAOA 1RA6A 5C24A 3I71A 2YKNB 4OAZA 3HSZA 1J5YA 4A8WA 1RP5A 5HVFA 4QPOA 2IVFB 3MZYA 4B8XA 4NDLA 4HQEA 1XC5A 4Y00A 3M32A 2WHOA 4NUBA 1WPKA 4BEHB 3S93A 3DCAA 2AJ2A 2J8AA 1SH3A 4BHBA 3H9GA 3M2VA 4RMNA 2EW9A 2V1DA 2LFBA 4OZ2A 5GVQA 4LQ3A 1K4SA 3NRVA 5E3MA 1NTCA 1FIAA 3KP2A 4LSNB 4DI6A 2E7XA 2MZ1A 1WF2A 2CFXA 3I9V9 2RUSA 4LF6J 5A8KA 1SMYF 2DMTA 2DGXA 4URSA 4XO0A 2JRTA 1F9FA 1ACIA 3CF5Q 2V8GA 2KQRA 1DU0A 1Y5NB 5J2QB 2VPLA 2RKHA 2Q3PA 1J09A 2Y9HA 3TEGA 5J6XA 2NYXA 1GXLA 3KJQB 2ZH7A 5EN1A 1K78A 5IC4B 3R3TA 2V68A 1FRKA 4UY8T 4CH7A 2EFQA 5H9EK 3FCHA 4GDFA 2R7XA 2CPXA 3MD2A 2M7BA 1RWUA 1DTTB 4DQPA 5HVHA 1WKMA 5D6EA 4B09A 1R58A 2QX0A 1E17A 2XY7A 3Q5FA 4BQOA 1BGXT 2MQMA 1U2WA 1ODDA 5HDKA 1Z3XA 5E1XA 4MQVA 1FX2A 3KZYA 3VAIA 5IT4A 4Q0BA 2L54A 3DP7A 2E1AA 4DQQA 3LP0A 1QAYA 2VPWB 4FKXA 4L3NA 1FTZA 4DV5F 4ED6A 4HEA2 1OY8A 1OMIA 4DPUA 2RNGA 3L7PA 3EUNA 3FBFA 5FKMA 3LPYA 1BY9A 1H7WA 3QPIA 3W2VB 4KJIA 1LPQA 1X9MA 4KTQA 4OMZA 4QQBA 2WV0A 1U6ZA 3FDSA 3RJMB 3D6TB 3CUQA 3MM9B 1OYIA 1CLFA 4JUZA 1YWXA 1U45A 2MZSA 2CQ7A 1BI2A 2Z58B 4QWEA 1IN8A 3J81Z 1U1QA 1AZSB 3SXLA 4FF4A 5ETSA 1LVKA 3EPIA 3E5XA 2ID6A 3ICLA 4HW0A 3MM8B 3MMJA 1SD7A 1Y56A 4C2TA 2IIHA 4M5DB 2LLZA 4N4OB 2VE8A 4NCAA 2BY2A 1GMWD 2OQGA 1X1BA 2JLFA 3UCUP 1Q5YA 3KK3B 2Y1JA 4NNJA 4EMSA 1RAFB 2FJ1A 2KDZA 2L08A 1FTRA 3IV5A 5HLGA 4MTDA 3S14J 1XDUA 2MY7A 3RRHA 2VJJA 1Z2LA 1CF7A 4IHWA 3RBEA 3B6BA 5BMZA 1O3RA 1JJ8C 1V3RA 1S76D 4PEOA 2M70A 3MEEB 1R8HA 3CMAI 4DR6F 4PXDA 2W9AA 1X9SA 3BR5A 1FKOB 2HHHF 2C2RA 4E4HA 1JKHA 3OLBA 2VKEA 3MF5A 2FVRA 3R1HA 1NMEB 3HVWA 1QRYA 1UELB 2VE9A 1Z9CA 4O3OA 2LKSA 2JEGA 4CTAA 1X0PA 2VBYA 2X1EA 3TMOA 5DS9A 4KT5C 1FY7A 4PAAA 2CMPA 2L4MA 4AFFA 3OYHA 2DPJA 1XEZA 1O51A 4F02A 1IV6A 2QEXS 2E66A 3PIOQ 3VDXA 2EK1A 3AJDA 2ZBIA 1W2BR 1D9AA 4CT9A 2I1RA 1NCLA 1VC6A 3OTOF 4N56A 5IQ6A 2K8GA 5SUHA 3HPOA 1PAUB 2BXZA 2RS2A 1S72S 1U26A 4PXEA 4Y13A 5GADU 2CNOB 1TELA 5AXMA 1IBMJ 1G1XA 4LF4F 3KETA 1LFWA 3MR6A 4ZDPA 4RGRA 5E3PA 4Q45A 3BKUA 4P9SA 4F50A 1UW4A 4OYPA 2ACJA 4R0EA 5KG4A 5EYRA 2DI3A 3BM7A 1HNVB 5FFZA 1BQXA 3O44A 4RWXA 5ETVA 1W36C 1RJJA 2JFDA 1W5CC 1RAHB 3MQ0A 1VLOA 3CUQB 3OIPA 3N6MA 3GSIA 1CEZA 2CQQA 2GXBA 2XGEA 1EJ9A 3ZFVA 2EVZA 3ET6A 4KH1B 4CWBA 5EUHA 2R8JA 4P96A 1TL3A 4ELTA 4U7CA 4DDFA 5CYJA 2XNRA 1RYSA 2GA2A 5FB2A 3W9IA 2AJ1A 3MD3A 5LHIA 1F5TA 3POTB 4G12A 2CQCA 1D09B 4QU7A 2YNIB 3BF4A 3C19A 2BKNA 2BRKA 4N4NB 3G3ZA 2DO7A 5BR8J 2IGMA 2PEXA 3PUBA 4FXWA 4HKQA 2K9SA 2ZNYA 2W00A 1YJNS 1KQKA 4F52A 3IG1B 4C8NA 4OHYA 1ZTRA 5DO2A 1TWFJ 3FWEA 3GJQB 4WZMA 5KG0A 3FHZA 4WX9A 4CO8A 3WHBA 1LWEA 1I1GA 4X6AJ 2AJ4A 4RDUA 2X6OA 2QGFB 3SEZA 3OVBA 4IH5A 2BVZA 2CPJA 3GFHA 3C6TA 2DNMA 2V8HA 1N56A 3GTYX 4FBTA 2XMWA 1S1XB 2QLBB 2VG6B 4ED1A 5LOQA 4OI4A 2IXSA 3MCSA 3C14A 2O5RA 2OEJA 1ZGJA 5KG1A 2KT3A 4R25A 3CMMA 1C0WA 1KVJA 1PJ6A 4HH0A 5EX0A 3FKIJ 2Y3YA 2HS5A 2Z1DA 3MMCB 3AAFA 2LQ5A 1X1PA 2P9GA 4DUZJ 1VQ4I 2DH8A 2Z9OA 4ZC3A 1EAYC 5DD4A 1ZM4A 1O0PA 5E2QA 4EO8A 1X4CA 2A3SA 1W26A 2QCOA 3OFFA 1Q7YT 2B56A 4DSKA 4HX4A 2R93J 3J81j 1MMGA 5IOZA 1SBRA 2XTJP 1SC3B 3HK2A 1D1AA 4S05A 1BOAA 3PTWA 1LWFA 2F65A 3DHXA 2UXCF 1OY9A 3SDEB 4J7CA 3AXKA 4USHA 3HOSA 5FLXY 4G6DA 3ENWA 1VQMS 3CIMA 4AD6A 4WYWA 5LSRA 1OR7C 2KVIA 2RVCA 5DM7Q 2XAHA 1IZ1A 2KI2A 3OQ2A 5H9EJ 4LLGF 2ZH4A 1RWXB 5KT7A 1RZMA 2ZH1A 4FBUA 4DL3A 2JPCA 2UXXA 4C7QA 2LSOA 2UZKA 5A2QY 1MMAA 4FE4A 4DV2J 2KIFA 4RM3A 3DKYA 2RDPA 2LVSA 3ZMDA 2WZ1A 2VJVA 2AX1A 2L7FP 1HC8A 1N5YB 1O3QA 5KFOA 4Y2AA 2XF5A 3FMRA 3BBBA 3EPGA 4KHPJ 1F3FA 4BHCA 3C6TB 2Q0OA 3WZ0A 1I50J 2E5LF 4BBRJ 4OYBA 4E7SA 3RG6A 2W24A 1I3AA 4RA2A 3SSQA 2HTJA 4JP0A 2OJ3A 4RW7A 4Q44A 3QIDA 1SD5A 5E1ZB 3T9ZA 4GKJJ 3ETOA 4ENMA 4W92B 2HPMA 3Q0VA 5AE1A 3HVAA 3HHLC 1KVKA 3CJKA 2DA6A 3FC9A 3NGSA 5FGMA 4RBTA 2W4CA 2LKXA 4OYIA 4FX0A 3E5QA 4RNHA 3UD5A 4A8KA 4WWSA 2V2KA 3MWMA 2I10A 1T03A 2YX7A 5HS8A 3J7ZI 3ZNJ1 2DPIA 3ZOBA 4LFBJ 4QIGA 1ZARA 5K8NA 2XAGA 1TR0A 4IRIA 4IQJA 4EJWA 4ZVFA 5C7PA 2LEBA 1TUVA 2BUNA 1CC7A 3CJ0A 3D0HE 4XQFA 1B7FA 1D8KA 1TVRB 2VHGA 1TAQA 2R5ZA 3CVKA 2ME6A 4X66F 1QTMA 2DQLA 2N7CA 1VIOA 2OPTA 4FYWB 4A47A 1Y0NA 3EX7B 1RU2A 4QYZK 4AT1B 2PMZA 1WQ2A 4NXNF 4DL6A 3DKDA 4M5NA 2R8GA 3CCYA 4YFKF 2FQ4A 3OW2R 5B3SH 3DOLA 4KIGA 1FLIA 5HL7Q 5DQIA 2XLJA 3GIKA 1YRXA 3L7UA 1K79A 1N33J 5AXKA 1VQ5S 3H4BA 2FD5A 3OXGA 3MR2A 1FBQA 4MH8A 4RWWA 2YWHA 4LIUA 1I5OB 3IWZA 2QL5B 5HODA 3M8RA 3H0GJ 4GRIA 5IT3A 1ZOTA 2W2QP 1ZZFA 2F4VF 2FLPA 1OIAA 1FXLA 2B4UA 2OTJI 3BOQA 3MOZA 1QQIA 3UI3A 4HOBA 1HQEA 4X4PA 1V5VA 4Y6IA 3GTKJ 1RT2A 2DT7B 1N88A 2QQ9A 2HHHJ 1NK8A 4ZCIA 3I59A 2VJ5A 4RO0A 4CLPA 2ZH5A 4EGZA 1HA8A 4BEHA 4C9YA 3MMBB 2MZTA 3DWLE 2X0LA 2IJFA 1FC3A 1HBUA 3R6GB 1YIOA 4KA4A 2OI2A 4LFBF 4MIWA 3MN2A 2LRDA 3U1MA 1WJEA 3L2UA 4ZLLA 3G8TA 3K1MA 5HANA 3SSSA 1HSTA 4HV6A 4XBFA 3G8SA 4J9NA 3PW7A 1MLAA 2QSWA 2RD5C 1R23A 4I76A 2C3MA 4P71A 5IXUA 3CE8A 4RW8A 4YOEA 5IOYA 2CQ2A 4ECXA 4OX7A 3OYBA 2RV8A 1UA0A 3T19A 3FEZA 2NNYA 1RT2B 4Y7NJ 5GMEA 4G7HF 4F3OA 1IBKJ 2VUMJ 5D4LA 2QA4S 1WCMJ 2MZRA 1MWZA 1HDPA 1NJWA 4ILMA 2X1CA 4TLRA 2CPHA 4NCBA 2YNGA 3EMTA 2KN4A 1Y3JA 2L48A 1HNVA 3Q3SA 1X1CA 2BE9B 1OO0B 1PJ5A 1ZR4A 4PWWA 1VQMI 5J47A 4OYWA 4EQQA 4DS4A 1UW9A 1R0CB 4RU2A 4QOTA 2RDDA 4ZPBA 2LOOA 2O3FA 5BPDA 2F8EX 1XJWB 4Q5SF 1DU6A 2AXTC 4NCGA 1ETKA 1R22A 4J00A 4H4OB 1ONVA 2XYPB 5GAGU 1SC4B 1FCAA 2E1MC 3QLHB 2KJWA 4QWDA 3HOXJ 2BHYA 1G3SA 1RXOB 1QTNB 4CA0A 3CMYA 4EU0A 2DTRA 5D0EA 2EK5A 3FDYA 2R8HA 1XNRJ 1TKTB 4ANCA 1OISA 4PWDB 4O3PA 4G1PA 4M5LA 4C0OC 3C6UA 5IP6A 3VVUA 2FB0A 3RB6A 5JMNA 5M2PA 2LKZA 3WODF 4IRGA 5K7FA 4KBIA 3H3UA 2WONB 1V3SA 1A6QA 1YW7A 3Q9SA 2HSEB 4N9HA 2JRMA 1HNIB 2HG4A 3SJMA 3ZZUA 4B3AA 4OV6A 8AT1B 3JAMU 4RNNA 1ZTTA 4OIRF 1XS9A 4QR1A 2BBYA 3H5YA 1N4LA 1QHHD 3GFXA 4JQFA 1N5TA 4F4ZA 4ILRA 3ADAC 2ATCB 4OZ3A 3LAPA 4TLQA 3GYGA 2Z56B 3LGMA 2HVZA 3I0SA 3ZPLA 2HYIB 4GYIA 4BCAA 5JVGF 3W6KB 2O03A 1ZHFA 2RQPA 2NVTJ 1DGWY 3CCVI 4OLPA 5KNLA 1R1UA 4YHHJ 2XSJC 3HHKA 3FHNA 2GIFA 2RIJA 3ISNC 3Q24A 5K1YA 1QUVA 4XRMA 3PIPF 2KZMA 2J5AA 1TL5A 2LP0A 1VNDA 1W1WE 3M1EA 5KG5A 1Y00A 1RTHA 4H4MA 1OSCA 4IRCA 3NNHA 3OYIA 2ABYA 4NLSA 3Q8PB 3P4UB 3GW2A 1RBLA 4URQU 1C1BA 5D5UB 3RW7A 1BI0A 3M07A 2HPIA 5DM7F 4I01A 1NAQA 4DLEA 3OYAA 5D0RA 4Q7AA 3J7YU 3POTA 5HI7A 3TZZA 3NXZA 5D4PA 2ZO4A 3T0YA 1URRA 3DLEB 1ETVA 1FFSB 3SBMA 3CB4A 3G71S 4JI1F 2NUHA 5LMNJ 2LBFA 3DU6A 4E0DA 3KUEA 2VPRA 5I4MA 3KHHA 4F93B 3BJ6A 5L39A 1K6YA 2FGCA 2HDCA 1HNWJ 3I5BA 5A0YB 1T9TA 3VF0B 4UXNA 4C3HJ 4C8YA 3BTCA 2V1NA 3KLIA 1RWVB 4WFNQ 2AJQA 5HN0A 2M3DA 4PYDA 2YKMA 2KRFA 1BQNB 2LU2A 4G8XA 1LDJA 4UVBA 5LFAA 2OTLI 2NXCA 4ZTJA 4M9XA 2OLWA 2IAJA 2ZJRQ 2R9LA 3K2YA 1REVB 3RB3A 3RKYA 2B8QA 4A8FA 3M4XA 1FOYA 3EUHA 3SZPA 4XDCA 1Q95G 1VQ7S 4A3IJ 1C4AA 2EI5A 2NXNB 2KRBA 2IS6A 1V6HA 4ZH4F 3HZEA 2H1LA 3CXCR 3RQ4A 2E1PA 5KT5A 4LG0A 1QAJA 1ZPVA 3L7WA 2VQLA 4U7BA 4ANJA 1NDKA 2DEJA 4NLQA 4MIMA 4USKA 2F9DA 4I68A 3NGDA 3KG4A 3CGIA 1AA7A 1KWMA 2VBWA 5C4XJ 4MFEA 2JPBA 5FROA 4QWQA 1FYLA 4Y3OA 2QLXA 4LRBA 5K5MA 1YO5C 1MH3A 1FI4A 1FKOA 2GMHA 4ETXA 2CGPA 3IG1A 2WC2A 3C7JA 3RYRA 3BV8A 1W7PB 2X1FA 3WU0A 2UVVA 4Z6YA 1YE9A 4LB5A 4ZZDA 3FBCA 3IGVA 1U0JA 2JN6A 1S7EA 4NPOA 4C2MA 1HBOB 2WADA 1UVJA 2ZBKA 3WX8A 3J7ZT 4JI1J 4C3LA 2KXNB 3AD7C 1RAOA 1IJFB 4Y17A 4C4WA 4XLNF 1HI8A 4KKOA 3OYGA 2NS7A 1OQYA 4DZ6A 3BO3A 2JNJA 2EWHA 4F2SA 2EC0A 1S0VA 1T8IA 4PWUA 3W9JA 3FK6A 1RHQB 2VJIA 3B4DA 4ER8A 3NGUA 4LK1F 5CQEA 3MPWA 4EMDA 1HLVA 3D5SC 1NSQA 3K1NA 2A1BA 4Y52J 4KRWA 3BG9A 3SDGA 2ZJQF 4FT8A 3WHCA 1D3YA 1YLXA 3KYLA 3I5UA 2LF8A 1AZSA 4UZCA 1RTJB 3LSIA 2MH2A 5E1WA 2CQNA 2ZM6F 5JHFA 2VF3A 3J7AO 4BWJA 2KYXA 3PHTA 2CPYA 3EXYA 4GC6A 3OMYA 1OYDA 2B4OA 3MKWB 2L7MP 1P9YA 2DA2A 2HRTA 5D78A 3HG9A 3H5XA 5IC6B 5D0GA 3E0JB 2DNRA 5DETA 3OR2C 2F4FA 2LQBA 2ICWG 3IP0A 2HYJA 2H6BA 4BLGA 3DGPA 2R2UA 2TRTA 2OD6A 3KG0A 3LGNA 4NLPA 1GX6A 2BX6A 5F27A 4X84A 2JDJA 4FF2A 4CCOA 4ENJA 2HOEA 3S3OA 3HGYA 1X4EA 4AIHA 4UVAA 4O0IA 4P9UA 2XS5A 1VLYA 4QIWD 3TUIC 3QPHA 1UETA 3ZQLA 2FXAA 5KTQA 2ZH2A 3PG9A 2P6TA 2HNZA 3AY0A 4MMOA 4CI0B 1KQ8A 3ULQB 2KT0A 4DU8A 2FDNA 4KE5A 2E5HA 2KHDA 3CDIA 2QLZA 2Z2SB 4I56A 3H20A 1K1SA 1A36A 3KNAA 2QEXI 4WCEQ 2XM3A 2DGVA 2E2HJ 3X1LB 3CW2C 3WTVC 3PYFA 1TNTA 3PCOB 1KQ9A 2ZBQA 4XK4A 1YGYA 3MHYA 4K4XA 2OAUA 4RW9A 2ELHA 1QVGR 4CDGA 1W36D 1R7JA 4DN0A 4RW9B 3K5PA 2M2BA 4C8LA 3H7HB 1ON1A 3HF5A 3PHEA 4JV1A 5D3GB 3OOPA 2X9DA 2MQLA 2Z57B 6FDRA 1O4XA 3BO4A 3QRPA 3TGNA 2R7FA 4KIBA 4DPOA 4A5NA 5A2QU 2Y0MA 2QRRA 2LVWA 3V4GA 3M2VB 1RABB 4A3BJ 4RGSA 4OINF 2QL9B 4WXDA 3AJ2A 3HFZB 5KT6A 3UVJB 3O8HA 3CJRA 2AQFA 1X9WA 1OCCH 4DV0J 1BR1A 5B0EA 3IR5B 3THVA 2HYFA 5E3LA 2DCUB 4AXJA 4OMYA 2E1NA 2HGNA 2R92J 1TW3A 5E7OB 1A6IA 4X4SA 2OJED 1ZRCA 5TRDA 1WH5A 2ZHBA 4I2QB 3TO7A 2K86A 1UWAA 2K9QA 2WA0A 2HFNA 1ETWA 2MDAA 3FK4A 4ZJLA 4PABA 4Q0BB 2M2EA 4X4NA 2F4VJ 3I96A 3LA2A 1QY7A 4XKWA 2IBDA 2JVHA 3VODA 5J3LA 2J9CA 3FFIB 2W82A 2HBYB 2E71A 1B1BA 2BZ2A 4BXXJ 3R6LB 4ZVRB 3KEOA 4BXUA 1Y3KA 4IG3A 2J0WA 2PC6A 2RQ4A 4OX8A 3NNAA 5CVUA 1WOSA 1XC9A 3PIOF 1KTQA 1S7OA 4G1QA 4IJAA 3K4KA 3BEGB 1N78A 2DGUA 1JUSA 1GXQA 2H4YB 1AUDA 2M9KA 2JWTA 1X60A 3JW4A 5EF6A 2YU3A 3M8PB 1UVLA 3F8CA 1B7YB 2V6EA 2ESHA 1FYKA 1F9HA 3ZZPA 1YX2A 3HD2A 3P3DA 4TU7A 2D5VA 1FNOA 4IHXA 3M8EA 3AJ1A 4XICA 3I0SB 1ZYQA 2MYSA 1RWKB 3PYEA 5FLVA 2COMA 3RR7A 3MEDA 2XUBA 2ALYB 3G4SS 1LE8B 2WSFC 4B3OB 1ZRDA 3J80Z 5E8GA 3M8FA 4GO5X 3O2PE 3MEGB 2L7KA 1YVFA 4YB5A 1K44A 2FJBB 3CDEA 1N32F 4F0HA 3D4JA 1FSHA 1S9GB 1CQMA 3V2UC 2XGDA 2ATLA 3IH4A 2A6OA 2P8TA 2Z2LA 2MD0A 2B5JB 4U0VA 3UNYA 4I09A 3E2EA 3DRRA 4J9UE 3PO5A 1C0UA 4FPIA 4K2EA 1HWKA 3C2HA 1M1EB 4LGWA 4A5MA 3HVTA 1U0SA 3ZTPA 3MURP 3SHFA 3FBBA 4M6YA 4OYZA 1U1RA 2OU2A 1VRQC 4BE1A 1SAXA 1EH7A 5GPAA 1BC6A 1PILA 3O1LA 4YB1P 1PC5A 2AV5A 2WOMB 4ZP7A 1Z3YA 2FUG2 3EZUA 5K7HA 4MYTA 3GFZA 1SFEA 2GNKA 2MC3A 1Z05A 4NMLA 3MMYB 2MKHA 3JSPA 2HGLA 1IR1A 4DL7A 1UJ5A 3L09A 1G3WA 4DV2F 2K1RA 4M63A 2C42A 4JI4F 2JEIA 2AWZA 1IQZA 4KGXB 4D7NA 2GHWA 4RUBA 4XRSG 2DJIA 4HLYA 2JL9A 3GF2A 3W64A 4WP9A 4P2XA 2FGOA 1EV7A 2KG1A 4ZLPA 2MY8A 2W8LA 4PQUA 1YW8A 5EEHA 4XN0A 3SFUA 5DQHA 1AUSL 3S1MJ 4CYUB 1JXVA 1FJ7A 1BI3A 2R4FA 5IWAJ 2XDVA 2ZHOA 4X4UA 4GVLA 4JI5J 3M30A 1Z6RA 4PR6A 1S57A 2JJ4D 2KXHA 4P5OA 3ECHA 2ZXHA 4IOAF 4PPZA 5JVGQ 4MK8A 3M05A 2ZXIA 1WDTA 4OQJA 1LNWA 2K3FA 1U2CA 4PK4A 3L3CA 4NLXA 5C44J 1S3JA 3J80U 4YY3F 4GYGA 1S48A 2IRUA 4ES1A 2QF7A 5J4VA 3W3SA 2XAJA 3HHLD 5J1EB 3U1LA 2CRGA 2PMHA 2EILH 1DTQB 2BJ9A 1LXJA 1WHYA 1HFEL 3DEUA 1B8IB 1F43A 1A9NB 2GJ2A 1T05A 2V1UA 3Q9VA 3GFJA 3BT9A 1MNMC 1T2KA 1KHVA 5IT9Y 2HGCA 3QP5A 5H1SV 1OY6A 3M1VA 2LD5A 1MJ9A 4UB6C 2QM3A 3JRHA 4PGHA 1MBGA 4ZYGA 2WAQN 2RJZA 4LFCF 1MGTA 4HRIA 2YS9A 3NMRA 3ISPA 1YJNI 2KIQA 3NGKA 1IDZA 2F8HA 4F0MA 2IMOA 1Q79A 3DTEA 4OZ0A 1VRUB 1HNWF 5L1JA 2Y69H 1U6BA 2HZTA 2DT6A 2G9WA 1T9WA 1W5SA 1EHWA 2OO4A 2ZVIA 4D5FA 2DIVA