1P9QC

Structure of a hypothetical protein af0491 from archaeoglobus fulgidus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
233
structure length
230
Chain Sequence
VSLDKAVIARLRKGGEEFEVLVDPYLARDLKEGKEVNFEDLLAAEEVFKDAKKGERASVDELRKIFGTDDVFEIARKIILEGEVQITAEQRREMLEAKRKQIINFISRNTIDPAPHPPSRIERALEEAKVHIDIFKSVEAQVKDIVKALKPILPLKFEEMEIAIKIPPEHTGRAISALYNFGGVTREEWQRDGSWICVMRIPSGMYGDLMDLLGKVAKGEALTKVLRRIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AF0491
publication title The Shwachman-Bodian-Diamond syndrome protein family is involved in RNA metabolism.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 58
structure length 230
sequence length 233
ec nomenclature
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01172 SBDS Shwachman-Bodian-Diamond syndrome (SBDS) protein
C PF09377 SBDS_C SBDS protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.900 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1p9qC02
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1p9qC03
3.30.1250.10 Alpha Beta 2-Layer Sandwich Hypothetical 12.0 Kda Protein In Nam8-gar1 Intergenic Region; Chain: A; Ribosome maturation protein SBDS, N-terminal domain 1p9qC01
4ZCMA 3B8HA 1DARA 1NYNA 1ELOA 1VI7A 3UI3A 4MAKA 4ZCKA 3ZZUA 1ZM9A 2E1RA 3OQ2A 1ZM2A 1ZM4A 4M1KA 3ZZ0A 2NPFA 1P9QC 1N0UA 1KTVA 2BM0A 4QR1A 4ZCIA 2XEXA 3ZZTA 4ZCLA 2IVYA 2L9NA 2BV3A 1ZM3A 2I8EA 1FNMA 4MYTA 2WBMA 2I0XA 3B78A 2CVEA 1U2RA 1N0VC 1ZPWX 3LH2S 2BM1A 3EXCX 4QR0A 4MYUA 4QR2A 3E3XA 5G4DA 4ES2A 2KDOA 3B82A 2EFGA 2J7KA 4TNOA 4ES1A 2ZITA 1T95A 4ES3A 4FN5A
chains in the Genus database with same CATH superfamily
3PSFA 4Z2XA 4WXWA 1ETYA 1MBFA 2HLTA 1RTDA 2AJFE 3K4BA 2ZMEA 3GPAA 1P9QC 4ZPWR 4CCMA 2DHHA 1FCAA 3JQJA 2AJ0A 4CYDA 3MTJA 1L3LA 1X3ZB 4CP5A 1CJVA 5MAOA 4L5JA 3HKZN 3OUYB 1RR7A 2EFGA 1S9GA 5D4RA 2NS0A 2KU7A 4FX4A 4PJLA 4F36A 2JA8J 2PGCA 1CJKA 4IFVA 2PA8D 3HRSA 1UHMA 4WE1A 1TWCJ 3MM7A 1X9WA 3I0RB 4NI2A 2D3ZA 3TO6A 1A5JA 5JI6A 3MURP 1UVNA 3NGTA 3QGPA 4Q4ZF 4O5VA 3UVJA 1WOOA 1C1BB 5DDRC 2FPHX 4C4WA 1LOUA 4A47A 4P10A 2ECBA 4BHCA 3DRRA 2R7DA 3MM8A 4OI1A 1GV2A 2HTSA 3ZTPA 1IV8A 1LJ9A 2EBIA 1FT8A 4WF2A 4NLYA 3ENQA 1HNIB 1TL5A 3BJYA 1YBAA 2R2UA 3PIPQ 2IIHA 1USSA 2JEGA 4C7QA 3QYEA 3WHBA 3X2QH 2OTJI 3I9V2 5F8JA 2UXDF 1J7KA 4DCPB 4KQZA 1WF0A 3FMBA 3HDDA 4YN3B 5KT7A 2EV5A 4B3OA 4RAGA 3CJKB 2IM3A 1IKYB 4FX0A 1K44A 3GB0A 1ZM9A 1JB0C 2DGVA 4L9NA 1TTHB 5E3LA 2DYSH 1QE1A 3QIPB 3OSPA 1L3UA 1UWBB 4DR5J 1SQEA 4J37A 3ZN1A 1LK5A 3ZMVA 2P5LC 2L02A 1LE8A 1ETOA 1DPUA 5KFXA 2ZNYA 3C2HA 2ILZA 4JV0A 3QSYB 3H4DA 2R5YB 1T0FA 4DR2F 1EP4B 2XSDC 2GJ2A 1QJHA 2OEMA 3HHLA 1Q86T 1Z3XA 2XF6A 3DBHB 1H0MA 2BW3B 2GMJA 2KZGA 3EXCX 1KHWA 2ILYA 4CTAA 3VZHA 1MNMC 5DLFA 2KHDA 4PXCA 2HFSA 2EEYA 3QGGA 2W2OP 2O61A 3TA1A 1VQYA 3SYTA 4QYRA 2QCOA 3N97A 4ZYAA 3CULA 3M6WA 4IQ4A 3H2UB 4I6AA 3J7AY 4WJBA 4M8LA 3PRBA 3DM2B 3SI8A 3HZJA 4XTTA 1KU7A 4NB5A 3NOCA 5DEQA 2YPRA 4C6AA 2YWEA 3U02A 2IJNA 3WU0A 5EG0B 3H36A 2LVWA 5FDLA 2EBGA 2LY1A 2DEIA 3CD0A 1KQGB 1TUGB 4LF7F 4USJC 2W4DA 4ID8A 1YLFA 2ZBIA 3CDWA 1LVAA 1SC7A 5KAIC 4MIAA 1JGSA 1VQ9S 1D3WA 3PKYA 2Y48A 4B9NA 1U1KA 3T1YF 1NG6A 1REVB 3CCZA 3TMOA 4Y7NJ 1RT1B 1M5KC 4KE5A 1JUSA 5A76A 3N05A 1RBLA 2P2CB 1M1KT 4OI4A 4A6EA 2QMXA 3HVTA 3EYYA 1VHIA 1YWXA 1K8AT 2J6TA 3KLOA 3E01A 3RBZA 3DHWC 3V81A 2VPXB 2DO7A 1G6NA 5GPCA 1RU1A 1H2UX 5CHCB 1T8IA 1SFKA 4KUMA 1LWFB 3WX4A 1MNEA 1QZEA 2OIHA 4X2BA 1VF9A 3K5MA 2VG5B 5M5XJ 4X4NA 2LU1A 4P73A 2QA4I 1WI9A 2BQRA 1P6RA 3BG6A 1X4DA 5FGMA 1M1GA 4QR0A 5I4MA 2QSWA 4OWRB 1U09A 4ZH4F 2LBFB 2XBPA 1T03A 4JI1F 3NRVA 1QRYA 5FD5A 2XMMA 1ZRDA 1I6XA 2NYHA 1G1XA 4DV5J 3VODA 3EE3A 3R1HA 3HSJA 3BTJA 1RTJA 2Y1RI 2QVOA 4II2A 2ZUAA 3TVKA 2UV8A 2YQ0A 4FF2A 4JOMA 1RACB 5CCLA 1BC6A 2V8VA 4B9TA 1XD7A 2HNZB 3GW2A 4ZLJA 2JSCA 3RZDJ 2VIXA 1XBWA 4FF4A 5A8KB 1X3UA 2IA2A 3E0JB 2DO4A 4QIEA 2RRAA 4CHUA 4PSWA 2VDHA 4ZK7M 3LSKA 2R3SA 5KT4A 5HDNA 3O6QA 4QR1A 3TJ8A 2EINH 2JVGA 2YKNB 2A10A 2DGTA 5DM7F 4IG3B 1J59A 1AFIA 4XM3A 2HK3A 1S1UA 2E1CA 1MU2A 1LKZA 1HFEL 2VPZB 1ORKA 1KHVA 2M8GX 3MKYB 3W63A 4DR1J 1FJ7A 1SBRA 5DDOC 4TQRA 1PUFA 2HWVA 5I3UA 2P5VA 3FK7A 4PAAA 2IAJB 2C6YA 3G82B 4NLWA 3OFGA 2CV0A 4HR2A 1F0XA 1A6LA 3BN4A 3BR9A 4J9PA 2JRMA 2Q0OA 3FZBA 3OTDA 2N3OA 2V8GA 2NSCA 1HA8A 4DV1F 2DY9A 2OHDA 1U8SA 2LCWA 2KKHA 3RB0A 3DLEB 1FD2A 1W7WA 4N9HA 3R5DA 3J81Y 3NNHA 4UOGA 4KPYA 1W2BR 5CD4A 4N4NB 2I8DA 2ELHA 1CF7A 4I7FB 2J0SD 3OYKA 5IT9Y 3UQSA 1B8IA 3CJRA 1WI8A 4XIUA 3CP2A 3S3OA 2W00A 1FDBA 2XMWA 4DG1B 4IH6A 3OLBA 4LFUA 3WTUC 1YI2S 1S3JA 3CC7S 4NCGB 2K3IA 3LWMA 3FZVA 5D8LB 1VMBA 4NEYA 4DS4A 4XQFA 3VVTA 3W2WB 2DXIA 1TK0A 1C4AA 1YRNA 3AB2B 4DSLA 1JNRB 5KHDA 1TZLA 4DF4A 3EUKL 4UUXA 5D5XB 3IAS9 2MTLA 2ALZA 4XSXF 4BEHB 2M7BA 4ZVTB 1S97A 4OJ1A 5KOXA 3LO3A 4PJ0C 2XASA 4J9OA 2XKOA 2WAEA 1E0EA 1K83J 3VEPA 4S0HB 1R8HA 1CPZA 2D2WA 4RA2A 2VG7B 4DBQA 5EGOB 3BF4A 4ZS6A 2O1PA 1MJBA 3WBZA 3KDNA 1GTHA 3CMYA 4CO3A 4O3RA 2J5PA 3KP3A 2KDOA 3GMGA 1FDNA 1V3SA 3DPUA 3DTKA 4X6AJ 4F0HA 2EB7A 1SPBP 3HOUJ 3CC2S 4A8MP 1MMGA 4UY8T 3AFHA 1OLTA 4K4VA 4ZVSB 2VJ4A 2HI3A 1DU6A 2F2EA 1PIEA 2E1PA 2QUFA 2X1GA 1HKTA 4Q43A 4NRTA 1STZA 3WTVC 2R2TA 1D3YA 4EZ9A 3FRYA 4UOHA 2VQLA 4P9SA 4LB5A 2FUG2 2FHKA 2DITA 4DV7J 5KFAA 2FJEB 4F0KA 3HPOA 1QAXA 4XR6A 3TUJC 2CJXB 1IDZA 2V94A 4KFCA 5F8NA 2JUGA 2OQRA 2JRSA 1Z4UA 2XGCA 2C2EA 4E7JA 2HQDA 1QHHD 4RLEA 3VGVA 4RW8A 1KP6A 3BSOA 1V55H 3CLQA 4L18B 3UNYA 2IP2A 4LFAJ 4RW4B 4XKVA 1K0TA 5HLTA 1GMWA 3BR3A 3ZC4A 3NS7B 1RBAA 2X1FA 1D0XA 1VRUA 1WC1A 4YB5A 4BXFA 3Q8SB 1BI0A 1PJ6A 2JQ7A 4ZJLA 3SEZA 2CNNB 2SXLA 2M0CA 3LSGA 3BR8A 3M32B 4Q0BB 4J7CA 2XS7A 4I01A 4H4KC 4HG2A 2FVCA 2L7ZA 4EM1A 3OS0A 1WSRA 1NH7A 3R5BA 3HOXJ 2QA4G 4K0KF 3CCSS 4ED8A 1X1CA 3CO9A 1QTNB 4JV2A 2DNYA 3Q8VA 4ZDPA 1MMNA 4L72B 3DI6A 3I96A 2CV2A 2EK5A 1GVDA 2JVHA 4JI6F 1QBJA 3W5YA 2K9LA 6FD1A 3EZOA 2KISA 2V63A 2VPWB 5E3PA 1LEOA 2FVRA 2XZWA 4IOAQ 3KYDB 1RT4A 1B72B 4W92B 4A93J 5THWA 1FNOA 1WHYA 1J5EJ 3IWXA 1BL0A 3AODA 4BGDA 1U8BA 1FEEA 1ETVA 3QYFA 3VVUA 5GPAA 4K5SA 4LRFA 2ACJA 3GFMA 2F40A 3V42A 4ZCIA 2K02A 1KU3A 2KDZA 1RP5A 2XM3A 2HSEB 1KOOA 1S0NA 3ULQB 5B0AA 3IH3A 2B6AA 4C3JJ 3HB9A 1WRJA 3ZZOA 2O5DA 3OT9A 2FRHA 1KU9A 2KP6A 2VT2A 2KJCA 5DS9A 3K4LA 4A3EJ 3LGHA 3RAMA 5D4SA 2AQ4A 3H5XA 4NZ6A 3FMRA 4NYZA 2BABA 4GRSA 4FKYA 2F5FA 3BDPA 4U7DA 4PXDA 5IYBJ 4B9SA 3JRIA 1ON1A 4G12A 1MJAA 1YE9A 2HQ5A 3JSMB 4PG5A 2OMOA 1SJFA 3DLLF 3ITHB 4OYWA 2UXCF 1MBGA 3EM1A 4L0YB 1UEKA 1ZAXA 2PMZD 3GTMJ 4CNYA 2Y30A 4UUTA 3I31A 4RW7A 1GK8A 3PW7A 1EAYC 2AV5A 1AA1B 5LBQA 1MGTA 4AQYF 2RHSB 5LFAA 4PYDA 3F3XA 2IVMA 1K78B 2IRFG 3LTOA 2VQCA 1WJCA 2UXBJ 4OAYA 4C8KA 3HD2A 1LPQA 1IM4A 4OJHA 3QLHA 3B02A 4ELUA 3HHNB 3AY0A 2E9RX 4FNIA 2RT3A 1AT1B 2OU2A 1XEZA 3SDEB 1WOSA 2CO5A 1NSPA 2X6WA 2CNLB 2MQPA 1VHFA 3MUTP 3G1OA 4LIRA 2YQ1A 4C98A 2PX9A 1CC7A 2I5UA 2NXNB 2H3EB 4AXJA 2EPFA 1S9HA 1R1UA 4WFNQ 4ECTA 2O8XA 5J47A 4P75A 2MABA 3BTIA 3IS9B 4LF9F 2VQEJ 4DFJA 3KK3B 1BWEA 5ETRA 4F4KA 1FDDA 1XX5A 3LA2A 1B0TA 4H54A 1HLVA 2XGQA 1SVOA 4HW0A 4P7TA 4IRHA 3AD8C 1FNNA 1F9HA 4XL9A 3V8JA 3QNWB 1NMEB 1YKWA 1ULRA 2BANA 5HQ8A 4PG8A 2CQGA 2OSRA 2PG4A 2GHPA 4LF6F 1T9VA 3OUYA 1RT7A 3HMJG 2CPXA 3MDFA 4LF1A 3GLLA 5KFNA 3E2EA 3D7SB 3B6CA 3BM7A 2ESHA 3WIVA 2HHSA 1W1WE 5J1EA 4CDGA 1F9FA 1UFKA 2AZ3A 1P1TA 1BOAA 2ZC3A 4G1QB 1J09A 5G0RA 5E79C 2B5JA 3M1VB 1XNRF 3DLBA 4OIPF 1JLGA 1V3FA 3OIQA 1S10A 2ZXJA 4O44B 2F4OB 4Z7YA 1QUVA 4OYPA 4KTQA 3LSHA 4IR9A 1I50J 2CUYA 1W0TA 5HLGA 4LBHA 2FJWA 3KX2A 4L9TA 4EUVA 3JAMY 1QNTA 4DL4A 3G1LA 3T5KA 2XB5A 8AT1B 2RKIB 3AD9C 3TWZA 3B4DA 1Q4RA 4FT8A 1O3TA 4G1PA 4RBUA 1L0OC 3GSIA 3QU3A 1FTTA 4BHQA 3QOEA 4UUSA 4OX7A 1N0UA 2AP6A 5CZXA 3W8PA 3CJKA 2XSJC 1M5VC 2UU9F 2F5DA 2DNNA 4LVNP 2IRUA 2RUGA 1X9MA 4XRSG 3R2CJ 3EDRB 3MECB 2DKOB 5ILVA 1NJZA 9ANTA 4I69A 4KGKA 3OVBA 3NAHA 2HHHJ 5HVFA 1UZCA 4URGA 3ML6A 1UWBA 2Z4PA 4K8RA 3FEZA 4DR3F 1R22A 3BR1A 3F44A 2V8PA 4CLFA 2A05A 1Y8RB 4Q7AA 5CA5A 3OOPA 3K6GA 1HNZJ 1D0ZA 1WELA 4DCJB 2WB1N 2R5YA 3LSJA 1ENHA 1BI1A 3VYUB 1EP4A 4PUSA 4ZPDA 4QYZJ 5IQ6A 3D6HB 3CCRI 2YPYA 3H7HB 4USMA 4LUBA 1IXKA 3F41A 1UB9A 2VG6A 2VJ5A 3K4JA 1WFXA 2Z33A 3NY0A 2YNFA 3BDEA 4MTDA 2FLNA 2X3GA 1O3SA 1PYVA 4IH5A 4C3KA 3S1QJ 4WK1A 3U7JA 2RF2B 1E3OC 3H25A 2W01A 1YVFA 3S8SA 2HLUA 1HPZA 2ZC4A 4NPOA 2WV0A 4D5FA 1RSCA 4M1KA 1KQ9A 5TGTA 1T9WA 2ZC2A 1MMSA 1R6VA 2W7NA 4K4XA 4Y34A 2HZTA 1R4MB 4B3MJ 2W7PA 1UW4A 2MFZA 3DDIA 5HDKA 2FEZA 1B0PA 4D0PA 1RETA 3NAIA 5GAGJ 4BUPA 1QU3A 2KVQE 3SFUA 4ENKA 4LK1F 4K4SA 1OFCX 2K2PA 3HM5A 1FSEA 1LKXA 5F9LA 2XSFA 2Y2ZA 5LXRA 3HOWJ 3DOMB 4MIMA 2C28A 3FQLA 2WTFA 3CJ5A 4ZCKA 3HPHA 1FXDA 1ZAOA 2OLWA 2KRFA 3M9OB 4DIQA 2HYFA 2EFNA 3GG0A 4R0EA 4OZJA 5KFMA 4F26A 1KLMB 4NQWB 1JKPC 3KZIC 8ATCB 3E97A 5DM6F 2GGPA 4NLPA 2UVVA 2OPSB 4PGHA 1YRUA 2MMYA 4EYHB 4XRFA 3VWBA 1LWEA 2EVZA 3LP1B 1Q78A 4IXAA 1BLUA 3IBCB 5GAHJ 4YDXA 3T1HJ 3D9BA 2XMAA 2PEBA 3PFYA 1O4XA 2WBRA 1GQEA 3KCCA 1LW2B 3PW2A 3RPQA 4OOIA 2BJEA 2DNLA 3HOVJ 2WW4A 4KPCA 3NGDA 4IOCF 3K4NA 2CUFA 3Q0VA 4RB0A 1Y11A 5KFGA 3KJVA 4X64J 1ZM3A 1S9FA 2W24A 4NLOA 2P5KA 2B4VA 1SUQA 1BC8C 5DDQC 3DLGB 4DX7A 1CULB 2XPUA 1SIWB 5K9FA 4IG3A 3BOQA 4ZYGA 3M6UA 3QPLA 1G59A 1ZM2A 2VPRA 1WSVA 4QIGA 2LQ8A 3NS6A 3CJ3A 1FNXH 1U47A 5A2QY 1I51B 2HNYA 2GAGC 1I6HJ 3HKZD 2DRBA 1R6YA 3Q8UA 2GNKA 2UUBF 3QGIA 1VCTA 5AE3A 2IAJA 5D5WB 3CMAS 4E7ZA 1VQMI 1BW6A 2YNGB 2HYGD 3FMSA 4Z37A 1N75A 2QMWA 3KG1A 1T08B 3ISNC 4MFBB 3BO2A 4ED7A 4YQWA 2P7CB 5GAEI 4IG0B 1T8EA 5F8HA 2Z16A 1EETB 1ZRFA 3ZNUA 3DLEA 2VOPA 5HS8A 3BJOA 4EVIA 3OMYA 3OYNA 3WIUA 2ZH6A 1KA8A 2Y8YA 2ECCA 4QZVB 4CA0A 3IAM2 1R4NB 1B9MA 4HHHA 2LA4A 4RKUC 3C2PA 4L5IA 2XYHB 4UB8C 1VLYA 3BZQA 2KM8B 4BCAA 1W36D 3VAHA 2Y0MA 3GMEA 4A8OA 2BZTA 1G4DA 2PLYA 3OTOF 2VFRA 1WG5A 3I9ZA 4F4WA 2LQBA 2VT3A 1DTTB 4KC5A 5DM7Q 4X65J 1NHVA 1F9EB 4LRAA 1XC5A 2ZSIB 4QJVA 3PY8A 1SI9A 5BQTA 2VICA 1WEXA 3W60A 3W2WA 3FM3A 2LP0A 2W1BA 3G9CA 3P49B 2QLJB 2M70A 4HDHA 4C9DA 3AG2H 3R5AA 1X0FA 4W97A 2CUJA 1FVQA 3ET6A 3KLHA 4BEHA 1KVIA 4YDDB 2L9VA 1S6PA 2D5VA 3DMJB 2R8HA 4LFCF 4XPEA 2EZLA 2JZ5A 1P6TA 2WONA 1HW9A 4ZVQB 5HROA 1CLFA 4NRUA 5J2PB 5EGOA 2YQ3A 2XB2D 1BW5A 5K8OA 4NXMJ 1S8NA 3W9JA 4OV1A 3K2ZA 3EGVA 2V1NA 3SZPA 3I87A 1GXTA 3HSRA 1HNWF 4BDYA 3DKXA 1UJ8A 4DL6A 3KLVA 4AD9A 3QQCD 2WBMA 4R5PA 1G3YA 4EO6A 5LSLA 1H72C 2PFBA 4DLGA 2IPQX 2LK2A 5F64A 2M2BA 3EMTA 1WSUA 5DG8A 4N9IA 1WZ2A 3G3ZA 4G7HF 4DOZA 3ILIA 2FQ3A 4ZVUB 2ZBRA 2V67A 1TWAJ 2FE3A 2LQJA 3VAMA 3IG1B 1WH5A 3LOUA 2OGUA 3MGJA 3ASOH 2DR6A 1POGA 4MKBA 3NGUA 5L1IA 1FRXA 4Q45A 4Z2YA 1LWCA 2D1CA 2RN7A 2EILH 2LTPA 5FKNA 2E5GA 3HHGA 2AHQA 5FRNA 3MD1A 2IA0A 3CF5F 3E5QA 3GF2A 2XAJA 4M6XA 4UVBA 2G1HA 4DV3J 4DCOB 4FS1A 4N7TA 4JI7J 3JRGA 4PG6A 3V2UC 4Y17A 3EVMA 2PMWA 4RPFA 3IC1A 2VFVA 4IDKA 2MC3A 2OPTA 1FTZA 1FY7A 2X6XA 1XN7A 1XMKA 3DLAA 5E3RA 2WADA 4MK8A 3FUYA 3A8IA 2D1HA 3PYFA 3MWBA 1Y56A 5IP9J 3MAHA 2MQQA 5E17F 5HK4A 1VQNI 4MK9A 3M32A 1VJWA 1IBKJ 3DBLB 1JLBB 1BQNB 4DL7A 2IGNA 4E0DA 1MROA 4OIRF 3I54A 1VQ4I 2GO9A 3W64A 3GP9A 1FIAA 1VQKI 2V50A 1F1ZA 4RNHA 2ZKZA 1HXDA 2ZSHB 4BAYA 4FCYA 1XIQA 2YWGA 1TT0A 3CW2C 2NPIA 4PWUA 3F6OA 3PUFA 3DRPB 5EX0A 4F92B 3GJQB 2BYVE 1X5OA 3HGGA 4RB3C 4DNCA 3CUNA 1CGPA 2ERRA 4BE2A 2XROA 1GXPA 1TAQA 4C0HA 1HWIA 1KVKA 1W5SA 2HVIA 4L9VA 1WDTA 2AEJA 3H42A 1VQOI 3QBCA 2ZBQA 2X1AA 4PCQA 5FLMJ 3VDXA 5KG0A 3DOLB 4S0MA 1AKHA 1WHUA 4B17A 1U2RA 4OZ3A 2XGPA 3CZ6A 2EXUA 3AJ1A 5KG1A 3UDCA 3MD3A 2Y9HA 2DPUA 2XAFA 1HR0F 3U1LA 2LREA 4R79A 5K5QA 3CCTA 4CM0A 4QBUA 1SAUA 3CUQB 3V8LA 5FKMA 2HNDA 4RUAA 4DZJA 2Q79A 1BJAA 3BEGB 4MFEA 3KG0A 3JREA 3WTXC 2HVDA 3JSMA 2DK2A 1XDUA 5TJJA 3DCAA 1VNDA 3CD6I 1H98A 1WQ2A 2PC6A 1HLWA 3DBRB 4NHJA 4DHVA 5EDWA 9RUBA 1Q8IA 2OUMA 4YR3A 3SSQA 1H3DA 4ZTFA 5CYQB 4QR2A 1FT9A 3ZQIA 2QA2A 4B3TJ 1YITI 4AIDA 4TNOA 3WDOA 3BQ2A 3HDSA 5H20A 2AJ2A 4DN9A 3ABLH 1D9AA 4LSNB 1I3OB 2QF7A 3BY6A 4BQNA 3W1YC 2O8KA 2XDVA 2GVZA 4KDPA 5EN1A 4PJNA 1ZA2B 4I56A 1USTA 3GJSB 1HCRA 2DTRA 4TU8A 2L4MA 1ZQ3P 3K10A 3GUDA 2NXNA 5LL6d 4L3KA 2XYPB 4OYXA 2NVQJ 2JA6J 4FXWA 4NASA 1YW7A 1LVKA 3HUGB 3WG7H 4DJAA 4F3MA 1B4AA 3TL4X 2AEMA 5AE1A 3KZYA 4B9VA 2LF8A 3GIKA 1DQ9A 4RWXA 3KK3A 4F52A 2N82B 3GTQJ 5ETVA 2QA4S 2R7XA 3OFFA 1WJ9A 1HDPA 4DUZJ 1FWPA 1XMOJ 3DLLQ 1S6QA 2HZAA 3MMBB 3C15B 4F2SA 3UFCX 3O3LA 1VC5A 3RPUD 2MGQA 3NQOA 2HURA 3CO6C 1IN5A 1NRKA 1NSQA 2H5JB 3C14A 5HN0A 3LA7A 4J9UE 2PI0A 2ZH5A 2DGWA 1JXVA 4YHHJ 3BSAA 3RZAA 5ILUA 2CQ2A 4HNUA 3O8GA 4DSKA 2QLXA 1N5SA 1R36A 4K4YA 2NR0A 2F4FA 1HKQA 5B7WA 1ACIA 2HZDA 1PBAA 3IP4B 4QIFA 1JIHA 3DEUA 5F27A 2RSQA 3LQVA 1TKXB 2Y1IA 1KBRA 5D5VB 5D5UB 3HVRA 3CMEI 2CQHA 2TCTA 1VDHA 3OR1B 4N56A 1TL1A 2Q2EB 4P9UA 2W4PA 3I59B 2QLFB 1UFMA 2P9GA 4K5RA 1ZARA 2O7OA 4J9KA 3FXOA 5D4PA 2RS8A 2OA4A 2XPWA 4FBTA 4LRBA 1PJ7A 2M7SA 3OOUA 2IBDA 3OSFA 3HSEA 4J9QA 1TWFJ 2IC3B 2GAUA 2VU5A 2KRBA 4ZVFA 1E3HA 4FVMA 2BRKA 4AE5A 3BWGA 2R0QC 1XGNA 5A6WA 3MECA 5GADU 5KFLA 4OHVA 4LGWA 4DQSA 2OPQA 3I71A 4DFMA 1H38A 3VCDA 2F9JA 1ULYA 4JI3F 5KFPA 1BOBA 1RWOB 2YKMA 2EQRA 3FZ2A 3MR7A 4HOBA 3MMAB 1YX3A 1RYSA 1TKTB 3JQMA 1OJLA 2CQIA 3AFGA 3O2IA 5LRSA 3T8TA 4WFBQ 5D77A 4E6KG 2H48B 1RCXB 4TYBA 1KSPA 1WC3A 4NA1A 3DKYA 2D3UA 3V6DB 4U0WA 2HOAA 2PO4A 4PZJA 2IBKA 2R7TA 4D3HA 2RF2A 5C2GA 3A13A 2LFBA 4KGMA 4QWQA 1ZKGA 1JXLA 5C3EJ 1MN7A 3W5ZA 2WCXA 2HHVA 5D8KB 1IN7A 2QLZA 2CPDA 3BR6A 1NDPA 1CJUA 1IBLF 1TKZA 3D0HE 4RJVA 1RA7A 3IM8A 1S1XB 3POTB 3G6EI 1X1BA 2NVYJ 2TRTA 3R5GA 4LMYA 3CGIA 1SVLA 2RDDA 3CCYA 3BPXA 1RK8A 3N01A 2JA5J 1AZSA 1AROP 3BQYA 4TQSA 3B82A 2RJZA 1NJWA 1TMMA 4X4RA 3NGSA 1XJWB 2GHWA 3BQZA 2L2OA 4D5CA 2WC2A 3OYIA 3R4KA 3EGNA 4H4OB 4DDFA 1G2EA 4PPZA 1WKJA 1BJZA 1VQ8S 4HSTA 2CJBA 4NLVA 5LMUJ 4BJ6C 1ITPA 3I3LA 4AIHA 5FD1A 1H74A 3OBIA 1F2HA 2HFNA 4E7IA 4GMKA 5ETKA 3S32A 3A4CA 2HHUA 2CPIA 1S12A 4OZ5A 1SAXA 2HRTA 3HRUA 3BBFA 3ETOA 4TKTA 3D68A 1IJEB 3OR2C 2V2KA 1C4CA 3I4HX 4X65F 2P0WA 1DLOA 1UAWA 2HS3A 1X58A 2MKSA 2NYIA 4WK3A 5EX3A 4X62J 2A1BA 2W82A 1LW2A 5JLWA 1JLEA 1HWJA 3SQNA 3BCAA 1LQ1A 4TN2A 3DPLC 1AWCA 5F0FA 4UOFA 2ZHOA 3BREA 3CQZJ 1YZ7A 1TW3A 1Y10A 4DV0J 5KK1A 1X4AA 2RREA 1VBXA 3RTRA 4MQVA 5C24B 4OZ1A 1RYRA 1W7PD 5KT6A 3HOSA 1JJ2R 3FEXB 3SBMA 4B8XA 3ZZ0A 3H5NA 4NBQA 1O51A 2VQFJ 2BXYA 3LALA 4KRWA 2HYIB 3DLJA 4A3BJ 1ODDA 1T9YA 5LGNA 2DXEA 2DGXA 3GSDA 4GKKF 5C2CA 5AIPA 4W1UA 2AYMA 5GP9A 3LF0A 1OYYA 1DU0A 3AL0B 3M2RB 3NCQA 3LA3A 1S0VA 4U67Q 4L3NA 2M52A 2N8GA 4C8YA 1X1PA 1BGXT 2ZH8A 3FMQA 3KG4A 4J90A 1MH4A 2JLFA 2YNGA 3P5TL 5IT0A 1EH6A 1KFSA 4MT1A 3CC4S 1SJ3P 3ICLA 4FF1A 4FISA 2E2IJ 3JW4A 2GQQA 1FLIA 4WPAA 4I2PA 1RLCL 1EETA 3J81Z 3VYSB 1OY8A 2IVYA 2Z2ZA 3O8WA 2DK5A 4R1HA 1S48A 1J2VA 4PQAA 3GU0A 2MZJA 3MEXA 1OMIA 1HOMA 3ECOA 1VBYA 3FNNA 1WEYA 3OXLA 5J1UA 4HPQA 1U25A 2QYOA 1GH8A 4UNOA 4IL6C 3TAMA 3RU0A 1JTYA 3TGNA 1Q7LB 2RB7A 2XUBA 1VJQA 1UJ5A 4UF4A 4D3GA 1R89A 2RV8A 3BO4A 1KOHA 4PJMA 3S6EA 4EI2A 3EUHC 2B9WA 2QSFA 1VQSA 4RNNA 2KH9A 2A07F 2AEFA 2LXFA 2V0NA 2UXXA 3MM5B 1S29A 4CZZA 3DMJA 3TUPA 2XAUA 2W25A 1T3OA 1NYNA 4AFFA 1U4BA 3RBDA 1LEAA 2MBFA 5M2PA 2D7SA 1F5BA 4O23A 3SQGB 5ICFA 3TARA 1QHGA 4RUHA 2MZTA 3DGPB 1YJ9I 1R0AA 1D1UA 3A8EA 4ESJA 4TLQA 3CJ8A 4EK2A 1MMAA 2DRDA 2HQIA 5F0UA 3HFKA 5JR3A 1JLCA 5L3FA 4ZN3A 2ASJA 2JZYA 5L39A 2W84A 2EFOA 3CDEA 3NKYA 2D69A 3MM9B 5BPDA 3LP0B 4BU2A 4UUVA 1CJTA 2BBEA 1HBOB 2DR5A 2CQ0A 4XSZF 3IMQJ 1IJFB 4JOUA 1FKPB 4DX5A 4FQGA 4UY8I 1FTRA 2M0MA 3ZR8X 2ZB9A 2XY6A 1VQ9I 3MZ8A 1KQ8A 2DYAA 1V5EA 2NVTJ 3R27A 3OYAA 3GFZA 3D66A 1AHDP 1HW1A 4IZZA 5M3MJ 1TVRB 1HWLA 2W48A 2RH3A 4M73A 4C0OC 5KFBA 1V5FA 1FHTA 4NLXA 2ACYA 2NLWA 1RKJA 2WAFA 4A0ZA 3FF5A 1JT6A 1UA0A 1BA5A 4M63A 1MZBA 5KFKA 2FJVA 2JWTA 3W7BA 2UZKA 2WB4A 3RRKA 2B51A 2EFQA 1U7LA 3TW6A 1X3WB 4KH1B 5LRRA 2BV6A 3PM1A 4JI8F 2Y31A 1XMQJ 3IGVA 1NH3A 1H6KX 2KLOA 2FDNA 4KKOB 2FC9A 3K1MA 1Z9CA 5GADI 4AYBD 2RNGA 3MKLA 1MNDA 4F4ZA 5ILSA 3H0PA 3BSCA 3IXQA 4TY8B 2L08A 1EA3A 3TVYA 3F8FA 2QBYA 2MYFA 2IDEA 5LT5A 4RAZA 2HKOA 5CYVA 2JFDA 1S0MA 3DC2A 3SQOP 2G0EA 2F9DA 2DK8A 1N34F 3M30B 4F7ZA 3AH6A 4JI4J 1VK8A 1R0CB 4K50A 4ZTJA 3LAKA 2XAHA 1MDMB 4WWSA 4TVAB 5D8HB 1LNQA 3EJMA 2NS8A 3WC2A 3UD4P 1DJ0A 1UVKA 2MH9A 4HQEA 3TEDA 3K9TA 3OQ2A 5FROA 2Z30B 1WPKA 2EFVA 1BI2A 2DJIA 1SFEA 2DJNA 1VC0A 3OSNA 4DSEA 2AXTC 3I0SB 1F1BB 2BKNA 5GMDA 1W0UA 3REOA 4YELA 5E1WA 1Z7LA 2WVCA 3HZGA 4JX6A 5FLXU 3AAWB 2IVFB 1T11A 4GXOA 3HJEA 2J6UA 4XNFA 6AT1B 4NZ7A 2OCEA 3P4UB 4RUBA 3BDDA 3NEUA 2ZFWA 4CLLA 4WKRA 5CH7B 1WF2A 1NK6A 3F8MA 2IYGA 1NKEA 4CQ1A 3HJFA 3UPFA 3IAS2 1GMVA 3H3VK 3BGRA 2JLGA 1PP8F 1GX6A 3JAMU 5BOXA 2CAJA 1FFWB 4F4AA 2CQXA 2DCEA 2ZDOA 3OVAA 4DPTA 3W61A 4CYUB 2LLZA 3CCLI 3UDLA 3S93A 1U2CA 2K7LA 4KJIA 4NZ0A 2GIQA 4LSNA 2M3DA 1PP7U 2H1YA 4HACA 5KAKA 3MQ0A 1FXRA 1SFOJ 1AA7A 5B3SH 4F93B 5T7LA 3QO9B 5B09A 3BG7A 2R9LA 4XKCA 2JL9A 1JKHB 1RPWA 4GCVA 1X2MA 1S99A 4DR6J 3JRAA 2DOEA 4A3DJ 4EWTA 3BZKA 4IJAA 2HYJA 1T94A 2NUHA 5IYDJ 1DZ5A 4ILMA 3HUGA 3BBBA 1I94F 1TLHB 4JI2J 3HK2A 1P1LA 2CRGA 1TR0A 1XWLA 2PQ8A 4UV8A 4YIFA 3TOAA 2NXUA 3HD1A 2PFFB 4LK0F 3FSXA 4J9RA 2QL5B 4K2JA 1WWHA 2WAQN 1UZHA 2POKA 1MKMA 2VQHA 4YOEA 3W66A 1MLAA 1GX5A 1HARA 4JBCA 1Z67A 1C0UB 2VB6A 4NCAA 1H7XA 2HRYA 2BJ7A 2V6CA 5LLQA 3R9LA 4LG0B 2GJFA 2C2NA 2VBZA 2H51B 2IM0A 3C15A 2LECA 5KFRA 4KIAA 2V26A 3TANA 4FASD 4B02A 2C2KB 4LD5A 1WDDA 2L3DA 3ZTRA 3L7UA 2VBWA 1U2FA 1EQMA 4DPWA 1I3QJ 3P9IA 2EIJH 1FNMA 1Q5VA 3RKYA 2QQ8A 3VSLA 5A0YA 3ZCOA 1Z21A 4KGZB 1PJRA 4CCLA 1HQEB 2V2VA 4ANCA 1HBUB 2CQBA 5FLXZ 3PX6A 3F8NA 2EC0A 2HQAA 1EJ7L 2HW3A 2GXBA 4NX9A 3J80U 1PBUA 1TKXA 1EQ0A 1HIYA 2HOSA 1CVJA 1CS4B 3FHZA 2F8MA 3M2VB 4F25A 2XSJA 4XKWA 4LFBJ 4F67A 5HDGA 4A3KJ 2GVDB 2AGOA 3NMRA 1P7JA 2ZOGA 2ID3A 3NLCA 1Q5YA 1QDUB 2Z2SB 3JAMZ 3ZFVA 5J3LA 1PYTA 3BG3A 3K4CA 4DV4J 5JJBA 1TT5B 3P9CA 4G65A 4IHSA 1NZ8A 1VQMS 3B73A 2FD2A 5HODA 2BRLA 4OI6A 4WYWA 4P55A 4H4MB 4F50A 2H1KA 1APLC 4UB6C 3PO4A 3MWMA 3MR6A 2CPEA 3M8RA 1RADB 4O3MA 2DNZA 1VS3A 1YBTA 4IRIA 4A0XA 2L41A 3QT6A 3H92A 4ZIWA 3GWCA 5C25B 3UR0A 2LF7A 1RWMB 3MEDB 1JKRC 4DI6A 3CIMA 1FZPB 3C3LA 5HVGA 4CT9A 5KFUA 3J7AO 5DDPC 1B3TA 5HNFA 3OS2A 1RT6B 5BR8J 5BYRA 2N7YA 2W2QP 1K47A 3GTYX 4PXEA 4DL5A 3CJ2A 3QRPA 4JI0J 4OHYA 2MLZA 3Q8RB 4AT1B 1YOVB 4GO1A 5GTIC 2EFWA 3PL8A 2F5GA 2FJDB 3M8PB 3OFHA 1N5YB 5F0HA 2E5ZA 4HL9A 3JB9k 4B3SJ 2BJDA 3W9IA 4ECRA 2L9SA 3V8KA 4I0BA 1U0HA 4OYZA 3IHUA 3CJTA 3K5PA 4Y2AA 4YFKF 2K1RB 1UCNA 1YTYA 5IP7J 4LR7A 4IKAA 1KQSR 2B8QA 4U0VA 2MKJA 2UUWA 1ZHFA 3PNVA 4WKYA 2Q1LA 2VD3A 4XK4A 3I58A 1BBYA 2P8IA 1Z1DA 4M5LA 2XG8A 2GLOA 3CDUA 3KXDA 3OXGA 5JVGQ 4EGYA 1T95A 1JE8A 3E5XA 1RKIA 3CD7A 4LSLA 4N5SA 3OS1A 3IAM9 3T1AA 3X3UA 3B54A 3ZQLA 2IW5A 2BM0A 3O2PE 4FYWB 5CQEA 2OC6A 2HS4A 2FBHA 3QRRA 1RAAB 3D5MA 5DD4A 3VAGA 3JYTB 1F5AA 1UAAA 5D3GB 2ABYA 5D0HA 1YO5C 2NNNA 4U87A 2KT5A 4R8UA 2HMIA 2L9DA 3PCOB 4N76A 3NGKA 2BOAA 2JA7J 1D5YA 3GILA 1NK9A 1R5ID 1N88A 1WF1A 1YG2A 4KV8B 4M94A 5LSOA 1IRXA 4IEJA 1IKWB 2JN6A 4IHTA 3KLGB 4KISA 2G9WA 5KT5A 4N8NA 5IWAF 1P9YA 4TLRA 3IKTA 2QYGA 2R7UA 3KP7A 3NWTA 4WU3A 2QWWA 4ZYEA 2G13A 3D6MB 1V5GA 3CWJA 5DCFA 3VQSA 4ZDLA 1SL2A 4LREA 5K5OA 5B0DA 2UVUA 1LDKB 4PWDA 1ERDA 4RW6B 3TQNA 4XN0A 3D2WA 2ZJRQ 3GFLA 1W7PB 2UXDJ 1LW0B 1XTAA 3FRZA 1G4CA 1OSCA 1RAFB 1OS5A 1I5ZA 1QD1A 4HF0A 4CCKA 4LIWA 1S6UA 4V1Ak 1IR2A 2IFXA 4NXNF 3JTNA 3WX8A 3ENVA 5AXMA 4XN3A 2KXHA 1RZ4A 2DDBA 2V1UA 2CJKA 3ECHA 2V9VA 2MYSA 3HFZB 1UWAA 3HKZA 4IX7A 4ABZA 3F6VA 2BY0A 1NZAA 5C24A 4RS8A 1LQ9A 3Q89A 1MBKA 2IPOB 1EB0A 2DI3A 1BI3A 3VYTB 3HX9A 2P9CA 5LEKA 2DH8A 2DRAA 2B9XA 5AT1B 5A2QZ 1M1EB 3LP2B 1X0PA 2DFIA 1EF4A 4N77A 1VQOS 1YQHA 1FKOB 4D1QA 4HH0A 1T0TV 3BGFA 3ZTQA 3PW5A 3TQ1A 2R7WA 2L7MP 3BZ6A 2IS6A 2UP1A 4CXFA 1SC1B 2MQMA 2RMLA 1IC8A 1YG0A 2AIRB 4KT5C 2BDPA 2V9WA 4ZVHA 2PMZN 2EG1A 5E7OB 4LF7J 1V3ZA 4Y15A 2ADUA 2JT1A 3GLJA 1JLAB 1OQYA 1SV5B 2EV6A 2RQCA 2KZMA 1F5TA 4EJTA 4Q48A 1QM9A 2FLPA 4DSIA 3T1YJ 3Q83A 3W2VB 2UUCF 5IM0B 3ABMH 2R2RA 3PHTA 3CD6S 4KHRA 1DHMA 3S14J 1U6BA 1HBNB 2RVCA 2IYIA 1P2FA 1KEKA 2IJLA 3IO1A 4DYRA 4OI0A 4Y65A 2H4YB 2COMA 2RHQB 4KGVB 2ZM6F 2IBOA 1YITS 1XGOA 1KNZA 2K06A 1J5OA 4Y00A 2I5JA 3KK1B 1MWYA 1V5VA 2JH3A 2MGZB 4K4ZA 3ZMUA 3GYGA 4LLLA 4KR0B 3MCZA 4A3GJ 2W9CB 1NPPA 2QRRA 4MAKA 4OYIA 3EYIA 1S7IA 1HYSA 5E3MA 4NCBA 2ATCB 4JI1J 2DMPA 2I8EA 1U9OA 4DBRA 2DH9A 5DV5A 4MYUA 4B4CA 1YQAA 4Y0FA 2B8PA 3A3NB 2IJRA 2VXZA 1YJVA 3PTWA 3KNAA 3H1CA 1TQMA 3EXYA 3C18A 5HSPA 4YRVA 4M5MA 1J75A 3OYBA 1TUVA 4CT8A 1KD1T 4PPDA 4RNFA 1RKTA 2LD5A 3LFUA 4AL6A 5FD6A 1R8PA 3MM9A 3RYLA 1X5PA 4I0WA 1ZAVA 1RWWB 1NG7A 2HWIA 4P6QA 4IPAA 3TAQA 1OISA 2FVSA 3HBLA 1IKVB 1NK3P 2XC9A 2JVOA 2TDXA 1U5TB 1FKPA 3L9ZA 5DS7A 3MEEB 4GVLA 3P6YC 2MKCA 4KT6A 2XZDB 1JXSA 4KO0B 2PMUA 4I99C 2H8WA 2VJJA 3EGWB 2CJYB 2Z99A 3OHBA 1GXLA 1JI8A 4GVBB 3DDKA 2MKHA 4PUOB 3F9KA 2F48A 2ZD1A 1S4EA 1TZ0A 1NJYA 3SHFA 4FXVA 3CMES 1VQ7S 4TU7A 3PYEA 4DR7J 4C2MJ 2DJWA 2K3PA 4WXOA 7FD1A 4DV1J 3R6GB 2LYCA 4HEA2 2EZHA 2M30A 3AG4H 1F43A 1VI7A 4ZP8A 4KKOA 3CCEI 2YWWA 1GT0C 1RLDA 3LNQA 4MGRA 4Y13A 4RBVA 1KQKA 1ONVA 4D7NA 1R8BA 2VONA 2HIQA 2V4JB 3P7NA 3KP4A 4ED3A 4MLOA 4RB2C 3NS5A 2MKKA 5J2MA 3CNQP 4AUXA 5E3AA 5ETOA 4PEOA 2EKYA 2VV5A 2QKLB 2N3LA 3FISA 3ZMSA 3MHYA 4X1EA 1PSDA 3KYCB 1EV7A 4A3FJ 1BHNA 3DYAB 2KRRA 2AO9A 2FU4A 1MSEC 2HG4A 4WIIA 4ZZLA 2MG4A 2DYRH 3FXQA 2P6SA 4BHPA 3LAJA 1PYSB 1XN9A 3OJUA 2ID6A 3ESWB 4DUYF 5FLVA 3QWUA 2UWMA 2DT5A 2DIVA 3HOZJ 2W8LA 1AUSL 3H3UA 2Q6BA 1RTHB 3GG1A 3LQQA 4A48A 2M8EA 2FNPA 3E51A 2RC4A 4UV9A 1ZTWA 2XKPA 4P5OA 2DMUA 3TVZA 2M8HA 3T3FA 3HRMA 1Z2LA 3CMAI 4Y4RA 2GV1A 2P7VB 1DGWY 5GMEA 1E6YB 2G4BA 1Y00A 1DUXC 4CYCB 3DOKA 3L2QA 2OPPA 4NLSA 4UQTA 3FQKA 1F6TA 3HHLD 4ZDNA 1KQFB 5J2QA 3HTSB 5A8WB 3BJAA 3N28A 5KVRA 3M8QB 2XRNA 1LFUP 1YLXA 3W65A 4HI2A 3QGHA 4DL0C 4CYUA 4HX4A 2FC8A 4M5DB 3BT9A 2X7IA 4JV5F 2HS5A 5M5YJ 1R7IA 2HNHA 4N47A 1Q8LA 1FOYA 1VZ0A 1FK9B 2R8JA 3WG9A 4AIJA 3RW7A 2W1OA 3RB4A 3S3NA 5JXSA 3RQ4A 2FJBB 1ZGWA 3QO9A 2QEXS 3TI0A 2FNAA 2OO4A 2VL1A 1SH2A 1OR7C 4M6YA 1FD8A 3C6UA 2F5CA 2KJBA 4JUZA 4WFYA 4P1WA 2MSSA 1H2VZ 2YNIB 3QAUA 1S72I 3M8SA 3M2UA 1Z6RA 1HBMB 1K1QA 2DNPA 4CO0A 3FXRA 3EPGA 1SC3B 4ZYHA 3G2XA 5BR8F 1IKXA 5HBMB 5HS7A 2WVFA 5FRMA 1Z2ZA 2OEJA 2ZE2A 2RRBA 4KFBA 3X1LB 4K0KJ 4C2TA 2JC1A 3K8VA 4LJMA 3QODA 1H9GA 4PSXA 1TL3A 2DPJA 3CSKA 1I27A 5E8GA 2G7UA 5CVUA 4JI6J 1NK8A 4BC7A 2DAOA 3DRSB 4AUKA 2CUEA 4ELVA 3MFKA 3N4WA 4AL5A 3C19A 5AJ3F 1S4FA 2LEPA 3G87A 1R5HA 4AC0A 3SCKE 2QMUB 5KFIA 2CPFA 2QSFX 2F7VA 4DPOA 2V8DA 1HBUA 2GXAA 2GA7A 2E7XA 2GZOA 2EZKA 3TRGA 2OSQA 3CIZA 2CPZA 3EVOA 3TO9A 2DOFA 3DNCA 1XPXA 1KLNA 1IDYA 2QENA 2FB0A 2GIVA 4ED2A 4DJBA 1HW2A 3E6BA 4DU7A 2CJAA 3L7OA 3C2BA 4I76A 4JB8B 4CWBA 2GVDA 3QPIA 2RIJA 3S01A 4WTOB 2E60A 2N4CA 2F5EA 1VQ5I 2A3JA 5K8NA 5EHHA 2I0XA 3D5SC 3HKWA 3SV3A 5FFXA 3LSPA 2FHOB 4JYKA 3WE3A 1TAUA 4J9VA 2UUZA 5IQQA 1RT2B 3M05A 4RBOA 2ZHBA 1GVJA 2VFUA 2VA2A 2I6WA 4L9JA 4XO0A 1KQ0A 4NLUA 2UXCJ 3K5LA 1U1MA 5LGTA 5HMXA 2RQQA 2C3OA 4AD6A 5D6FA 4RW9B 4ZN1A 5IY5H 5E3OA 4AQYJ 3JTGA 2AYEA 2QL7B 2BA9A 3GFHA 3MOZA 1ETKA 1P92A 2DA7A 4CH1A 5C25A 1N33F 5H2FC 2F5VA 4NLQA 5FLXK 3MEDA 2E5LF 1CG2A 1YW8A 3VSKA 3I5UA 4P2SA 3ZMZA 1Y6IA 2HU9A 3E3VA 5JHUA 2V34A 4WK8F 2R7RA 2FZGB 2FGOA 3SV4A 1EKRA 4G3IA 2VODA 1IN0A 4K4WA 2CQNA 3TYTA 5M2RA 4M3BA 3SFIA 1FMVA 4BDZA 2X3DA 4HSRA 5HVHA 2STTA 1S6LA 3JAMK 2CQ3A 4J01A 1ZR4A 2O9LA 3ZQCA 3T6BA 1IQZA 3N6MA 4OZ0A 5IOYA 5ITHA 4LF9J 5AIQA 2JK3A 1EH8A 1I39A 2EI5A 3QPHA 5ED4A 4R8HA 3DXSX 1IF1A 4XLPF 5HL7Q 3UN5A 4XAKA 4OJ3A 2G2YA 1TFYA 1UW9A 3BZCA 2HQGA 5IYCJ 3PDNA 5TISC 1RBOB 3OL4A 3L2VA 1DBDA 1NEEA 4U8VA 3GO5A 2C2ZB 3FFIB 2C3YA 1I3AA 5ETSA 2MLKA 5E1ZB 1L5UA 5LEJA 2LQ5A 1PUEE 2YNHB 4LF6J 2M34A 2OCCH 5HOOA 4OIQF 1YJ9S 5BJRA 1KFDA 2V1XA 1EKSA 2A2DA 3TZXA 2RQMA 4C2MA 1XR5A 2ACMA 2PIIA 3L2RA 3JYTA 4DZPA 4U96A 4OMFG 5D3GA 2RS2A 2YR2A 4QOTA 1K61A 1NDLA 2AJ1A 2A2CA 1MMLA 3Q8PB 1LFWA 4B43A 3PFOA 3C2GA 4BH9A 1WJAA 5LMNF 3OR2A 3TZWA 4BHBA 4IO1A 4GC7A 2W9AA 1XNRJ 2BE2B 3GYXB 5KFTA 3U1DA 1SKUB 5K14A 1FESA 2X0LA 1K73T 1T05A 2HFHA 3D3CJ 1BR2A 4Y2MA 2CPJA 3GE9A 4A8QA 3HTUA 3HZEA 5LM7E 2ZOMA 5DCMA 2XI3A 3WC0A 3QWPA 2K9SA 4YUDA 2C42A 3UWTA 1OYDA 1V4RA 1TL7A 1X9SA 2CWEA 4KIBA 1B1BA 5EGYA 4KIFA 2EC2A 2R5ZB 5J4YA 1YS7A 1W7PA 3J80K 1S49A 2CVEA 2Y0SN 1Y5IB 4F4XA 3E6CC 2HBRB 1X1DA 4HZFA 1FXLA 2UU9J 1C0TB 5EUHA 3SDGA 2IJFA 4DU8A 2ELKA 1U1NA 2VE8A 5HNHA 1FP2A 2M5WA 1T38A 5C4XJ 3MM6A 3JSYA 2ME0A 1OKRA 2VXDA 1SVMA 4IQXA 4DR3J 3W6KB 4QU7A 2MKIA 2QIFA 4RAYA 4FZVA 4EJOA 3T19A 3ABUA 3PO5A 2LQ9A 3VHQA 1E6VB 4OX9F 3VWSA 5A8RB 3GXOA 5H9EJ 2F1FA 1FOKA 2WAQD 2DW4A 3GJRB 3W3CA 3A01A 1UPMB 3K2YA 3OIOA 2FQQB 1QO0D 2HGMA 1S1VB 4NDLA 3G8SA 4FYVB 2H4WB 5K5MA 4WWCA 4E4HA 1U0SA 2AS5F 3I64A 1EARA 2IRXA 4C30A 1DARA 2Z57B 4CLUA 3J7A1 1KTQA 1YDLA 4XLEA 4S05A 2WWYA 2DCUB 2IHR1 2XMJA 2DNKA 2A6TA 3QOPA 2DT7B 3TKYA 5L9XA 4FBUA 4HVZA 1RE1B 3QMQA 3NBPA 3KLEA 1TQIA 2RNEA 3ZN0A 2LVSA 5ETQA 1T98A 5A6PA 1LB2A 1X4GA 2V2ZA 5MLCV 2J8AA 3R97A 1ZTRA 2HBQB 2EA4A 1Z05A 1T9XA 4CLZA 4OINF 1PYOB 1RUNA 1NK4A 1BC7C 4N8OA 2O6GE 1RXOB 3EUHA 3QJJA 2MLYA 3W2VA 1O3QA 3JRFA 1QUPA 1OCOH 4MEXF 4URQU 2ZDPA 4QWDA 4XDDA 2N4DA 3SZ2A 4KYWA 4DR7F 2L9RA 4CGZA 2XC7A 2IEKA 1LWXA 5E33A 1YIJI 3GV5B 3F0CA 1B70B 1RABB 3HHKA 3CCLS 3THVA 1NJIT 4YEAA 1WJFA 2NQPA 5IT4A 1PGZA 2KIFA 3DEWA 1K9MT 1RR8C 2WB1A 5C7PA 3A12A 1VQ6S 2AMCB 4ECQA 3MCSA 3W6VA 2Q43A 2BW2A 4QWCA 2RRNA 4E98A 2CS3A 2P8TA 1FMWA 1QAYA 1A36A 3SXYA 1Z7UA 4JBAA 4TYAA 4O3OA 2ZJQQ 2JSPA 1QAJA 1R27B 4OZ2A 1MJ9A 3ZPLA 1C1CB 2DMQA 1HNVB 2KG0A 5DTDA 1HMVB 1NHKL 2ZH7A 2EA2A 2PJRB 1U78A 2Q6CA 4LT6A 4ZHRA 2KM8C 4A3MJ 4PFOA 2KYZA 2OJED 3VF0B 1R23A 1RTDB 2ZMEB 1K6OA 4BQQA 1TMJA 4IO9Q 3ZXSA 3OLAA 1S1TA 2FJXA 4X4PA 1SQFA 4A6DA 4BC9A 4PKDB 5DDGA 5IP6A 3L2CA 1NHAA 3RIRA 1BQMA 1CJVB 5ADZA 3WODF 1HQUA 2G0CA 3JSRA 4ZPVR 4IKFA 2NOJB 3V6HA 2HHPA 3IH2A 3A2KA 2WHOA 1WHVA 1VIXA 1WVRA 1CJKB 3QU6A 4YY3F 1GLNA 1N32F 4ZDOA 3MM7B 3KLFA 3EUAA 2K5CA 1A7GE 1OY6A 1IWGA 4NI2B 1LXJA 4USVA 3KK2A 1FERA 3MPYA 2UUBJ 4M9ZA 2J8SA 2Y8WA 3UVJB 5KG3A 4OZNA 2FZCB 3OY9A 1WOPA 1TW2A 3OTCA 2UUAF 3BTLA 3DRRB 2HPMA 3MM8B 1VQ8I 4KICA 2HKXA 3PW4A 2YY3A 4K7QA 3MMCB 2AT1B 2DD8S 2R92J 1RTZA 1VRTA 2CDQA 4BE1A 2UVRA 4S04A 1L3TA 1Y1WJ 5KG2A 3I5AA 3KDOA 1SJ1A 1QVTA 3J7Z5 3KP6A 2VUMJ 5B0BA 3UCZP 1CC8A 3QJLA 1NK0A 4CCOA 1R0BG 3PYDA 5B1AH 4RNMA 3WTSC 1RHUB 1JLQA 2CFXA 2BJ8A 5JUMA 2QGUA 3OTOJ 3ZTOA 3LSMA 1TTYA 4B3OB 1FWKA 2JVRA 1HI0P 1WTBA 3IR5B 4UOCA 5GADJ 4B3RF 3FKJA 2DOAA 3FM5A 1JJHA 3EPIA 1JLFA 5B0GA 3OIPA 2YH0A 3TZYA 5IZHA 3TP3A 3FXLA 3CO7C 1TP7A 1QE1B 1WKLA 3G8QA 2FMYA 1U1PA 4WXHA 2JFKA 2V8HA 1LE8B 2R2SA 1OPCA 1WG1A 2PT0A 1RTIB 4LFCJ 2MD5A 5DETA 3TO8A 3LGMA 1CEZA 4JX4A 2JNJA 1UA1A 3HHDA 3HHLB 5IFMA 1OQ3A 2VH7A 2IM2A 4CTAB 5CYMA 1QVGR 1RT5A 3QWLA 1S9EB 4XLNF 5LOQA 2NYXA 1RJJA 3DQVC 4NMLA 2XLIA 1S7OA 3WTWC 1UHWA 1HNWJ 1DTQA 4OYAA 2EIMH 3M8ZA 4UVCA 2VJVA 2EWNA 2L5QA 3V4IA 1ICEB 4WCEQ 5E0OA 2AHOB 3IC7A 5HMYA 2HVHA 3VB2A 4DFPA 3CC4I 4RAFA 2NXJA 3TUZC 1GDTA 4HRIA 3QP5A 2EZIA 1R49A 4I4BA 3MFHA 2E2HJ 2H8RA 1FPQA 4U8YA 5FDLB 3M8QA 2F4VF 3RDIA 2DA1A 1AU7A 1Q95G 5F08A 4DPXA 1H2TZ 1SH0A 4W90B 4I98B 4UW2A 2UV1A 3D3BJ 2XVCA 3K17A 1RDRA 3PUBA 3BV8A 2C3MA 5GAEU 3IP0A 3G8TA 1YRTA 3CDAA 2JJ7A 2X85A 5KT3A 3CLOA 3HVTB 2K3KA 3OVSA 3ABKH 4I7HA 3ZQ7A 4J9SA 1KR4A 4L73A 1IN6A 3V81B 5C4JJ 3CUQC 3HXLA 1SD7A 3UNGC 1EKEA 1YW9A 1KKHA 3A3PB 5JHFA 1VGYA 1UG2A 3G71I 5JMNA 3HO1A 3D54A 4Q2LA 1ZR2A 3SEQA 3M07A 3W62A 2ZXWH 3AAFA 1ZG5A 2LMDA 1JHFA 2Y9ZA 3D5RC 3FX3A 3BS9A 1VFCA 2N7CA 3GZ5A 2GFFA 5K5RA 1QSSA 4URSA 3C46A 2B0LA 1T03B 2JHEA 4HV6A 1WH7A 1D0EA 1REPC 2O0YA 2WRMA 1FRHA 2CUZA 5KFOA 2WSEC 3CJQA 2EFPA 1ZG3A 4CO5A 1FP1D 2VE9A 2M0GB 3GIRA 3SDBA 3EICA 4PABA 1FKAF 1NJXA 3R7SB 3V7CA 1OO0B 3GCXP 5HAOA 4YIRX 3BG5A 2QFIA 2R4GA 2M45A 2D3O1 2KIQA 3PG9A 3UR3C 4RO0A 1NO8A 2LMIA 3GR0A 4EJWA 5EWGA 1B99A 2NPFA 3HT3A 5KG7A 6PAXA 1MH3A 2HZCA 1S1UB 3HSZA 1MU2B 1NLKL 2EKNA 1HR0J 1UL3A 2H65B 1PO6A 4M3EA 2ZH4A 4HNTA 3HP6A 5F6FA 5IS2A 3I0RA 4NC7A 2G0IA 4GYIA 5I3UB 1XNQJ 4M9SA 1SANA 2XEXA 1C1BA 3HL2A 2VBYA 1RWVB 1FYKA 1KDNA 2CQCA 3AB4B 2V79A 2E34A 4JYAF 1NKBA 4OMZA 1XDSA 2VKVA 4M5KA 4OHWA 3NP5A 4K59A 1ZREA 3N0VA 2YX7A 2M7AA 2ZH2A 5HP1B 2YU3A 4JQFA 4RGRA 1IR0A 1FX2A 1APSA 4XOTA 4WP8A 4DR4F 3HSFA 2DXFA 5CABA 1HNIA 3FDYA 1CF7B 2BUNA 2W4CA 2W4SA 3G1MA 1B8IB 3CJRB 5EYRA 4Q44A 3K0JA 5CYJA 2M5YA 5CLSA 3K8WA 2BQUA 2B9YA 2H5EA 2GMHA 3HM9A 2FJ1A 1V54H 5C44J 3PRVA 3NCRA 5BYQA 3CCJI 3OR1C 1FFSB 1IKYA 2ROGA 3GTJJ 4IRKA 3J7YU 2BVLA 3OL6A 4CM2A 4BJ5C 5FJ8J 2IS1A 4UZBA 3QIPA 4X4UA 4KA4A 1YRNB 1K4TA 4PYAA 4HHUA 1ITYA 1R1TA 3V4GA 1KYZA 1IRZA 1HQCA 3R8YA 4DX6A 1U45A 4WFXA 2O3FA 4IHYA 2MHNA 4OHZA 4UZCA 1RB0A 3A8KA 4PFPA 2ATLA 2B56A 4U7UD 3EX7B 4A4JA 3TAPA 3ILLA 4LBPA 2BW3A 2DNQA 2XAQA 3D0IE 3GIIA 1T33A 2CXEA 3UD3P 1JNZB 4JP0A 4HTJA 1KTVA 1TL4A 4KSEB 2NNYA 4ILLA 4XOPA 4A8WA 4CZCA 3LAMA 2A61A 1UMQA 2HDWA 5E3CA 2AGPA 1DPRA 4C11B 2L48A 2Z1DA 2CJ9A 3DM2A 4USTA 4XRMA 2COBA 4Q8FA 4ZPTR 3QZ7A 1FEXA 4XLHA 3TO7A 3MR2A 5EG0A 1IBMF 1GT8A 3W8GA 4U7UK 2JRTA 3G6VA 2ZBPA 3ABTA 1RKWA 2XPVA 2XS2A 4BWMA 2APOA 4IOAF 1B0VA 3HOTA 3RI4A 4ELTA 3DTEA 2FHJA 1REVA 4ED0A 1RT1A 2LFVA 2PEXA 1R7JA 1JTXA 3SFZA 4BL0B 3SMZA 2ZKUA 4RW8B 2XAGA 4L0ZB 2J0WA 4AYBN 3JCUC 2E44A 5E2QA 2CQ7A 4G7OF 5CD4H 3T5LA 2Q8KA 1PVEA 2ZXIA 4QIWD 1VR6A 1EZZB 1LWFA 1FWZA 2J9DE 3VQTA 4B09A 2CMPA 1VRUB 2X6OA 2DHAA 3RBEA 2KHMA 5IOZA 3MMYB 4C3IJ 3CCES 2VG5A 2MH2A 3AKZA 4I02A 1GEHA 1S59A 2CZ9A 2EV0A 4R25A 3A03A 1OYIA 4Q5VA 1U6FA 5D15A 5F04A 2MJUA 4HYEA 3D6TB 1D8ZA 4EV0A 2M88A 4JI3J 4F91B 4DGWB 1HBXG 2LBFA 2OD4A 4U7CA 2XO7A 1E17A 4JI5F 2NZCA 4TXSA 3OYLA 2G1DA 3U1MA 1IBCB 4ED4A 1XCVA 5LJ3Y 3KMSA 3PR4A 1M5PC 3ERED 1WG4A 4YR2A 3HXMA 1RC9A 2FVPA 3M8JA 2HNZA 3IR6B 4XPCA 1RT4B 2B4UA 1RAGB 2W7AA 2RILA 5A8KA 2C22A 3I55I 1TU0B 3OFEA 3TX0A 4IYQA 1G8XA 3RZOJ 2KG1A 3I53A 3TQEA 1Q8BA 4MTPA 4HEA9 3SYZA 4HBLA 1VQLI 5D6GA 3DXJF 2YKNA 2V6AA 1MD0A 1SMTA 2Q1ZB 4ZYDA 2R4FA 2D74B 4LF5F 1D0YA 3OYFA 3OYHA 2K7JA 3OL8A 4E7HA 2R7ZJ 1IBLJ 1OJ4A 3E6DA 4G6QA 3F8CA 2ASYA 3ZOBA 2QZ8A 3S16J 4E8UA 2DFFA 4ES3A 3L09A 3G82A 1OCZH 3FK6A 5EEGA 3CDHA 3PKMA 4ZVOB 4EYIB 4M5HA 2DU9A 5CJ9A 2XZTB 4FE7A 3PJRA 4RW7B 3KTQA 2KHCA 4WXDA 3ZQHA 3KHRA 3NWRA 2Z56B 2R7SA 2OPRB 3M4OJ 4OU0A 4RUCA 5CZVA 4JV1A 4NLTA 3AL0C 1E3PA 1D5VA 4DEZA 2XS5A 4I7FA 1URNA 3QLHB 3MCNA 3A1YA 2P6TA 2BVMA 3E5UA 3FBIB 4P74A 4ECUA 5FO5A 1TL8A 1W36C 3TEHB 2WVBA 2IM1A 4CH0S 1N5QA 4DG1A 4DFKA 2ZFHA 4U95A 2YKAA 2CW8A 3IR7B 4CO4A 2WZ1A 3JTOA 5AXNA 4NCGA 3A3OB 3JRHA 3H5RA 4O6JA 1ZOTA 3TJAA 3D67A 1ZTTA 2AYGA 3H90A 4MKYA 1HHQA 2RD5C 4ZJQA 2COLA 5ETNA 1S72S 2G0JA 1HNXF 2ZO4A 2J0QD 2VASA 1DQ8A 1XSXA 1GV5A 2PJRA 4BQAA 5DZ6A 2WA0A 2X9DA 4ZP9A 4YB1P 3ZXWA 3O6BB 4ER8A 2QLWA 1U3EM 7AT1B 2MSYA 3BB5A 2CH0A 2DXDA 2LKPA 2L0KA 1N25A 2J5OA 4GKJF 1N36F 2BYCA 4X4TA 2Z2YB 2VG7A 1B4SA 1IRGA 2BANB 1L3SA 4FYYB 1Y8QB 1Q1HA 1QPIA 1RT7B 2FOKA 3AOBA 4MTEA 4GKKJ 4CICA 3T1BA 4HAMA 1IUFA 2LKZA 1F60B 1DURA 2HVEA 5LD2C 5J1EB 1Z6TA 3JRBA 1RUOA 4I6YA 2ZVSA 2LYVA 2GBYA 4DPUA 3CCUI 4WX9A 5G0RB 4EMDA 1ZAWA 3CXCR 2OV7A 3H2LA 2B5JB 2H1LA 1FJGF 4C8LA 3RR8A 2ZWPA 1JLGB 2GO8A 1JXEA 2M2EA 3M8WA 2MD0A 4M5NA 2QFJA 5DUKA 3IRWP 3DCFA 1KC8T 4WFZA 2X1DA 2GZWA 3S1RJ 4DN0A 2CQ4A 3FBEA 4JK1X 2D45A 2E5HA 3MMCA 4ZVEA 1VQ5S 4Q47A 3PJ9A 4WP3A 3KLIB 2VC1A 2HKEA 5ERIA 2CGPA 3NG8A 1GXUA 2CZ4A 4CO1A 4QWEA 1TUWA 3BJ6A 2HHQA 4RU2A 2ZCWA 4DMZA 1ZPVA 2W2MP 4RW4A 3E3XA 2ZHAA 4UUSB 4ANJA 3RSNA 4ZA1A 1TBXA 1HI8A 3OHAA 2GAHC 3GV7B 2DA6A 2XY7A 3J7YI 5JLXA 4Q0BA 2VKEA 1SJ4P 3T8RA 2A5WA 2Y0SD 1A6IA 1R8AA 4L76A 4KHPF 2GW8A 2KYXA 2DNGA 3KWMA 4ZMMA 3QFHA 3BROA 3TR5A 3QPTA 4L74A 3E7LA 1RTIA 3LL7A 3TA0A 3I5BA 4AM3A 1JX4A 1UHSA 4DX8H 3ISZA 2KZVA 2DY1A 1B72A 2A6OA 2VG6B 5L46A 1H8AC 1S9EA 3HSDA 3OL3A 3V4MA 2JOQA 2YNFB 3FKIJ 4FPIA 4X66F 2J5AA 3DHXA 1IR1A 4U7BA 5BPIA 2IRYA 4CLPA 4FS2A 4V19K 1YJWI 2DMTA 1S76D 3J7AN 3H40A 3ILOA 3BTCA 5L3CA 2M1BA 1OY9A 1HPZB 3HHEA 2UVWA 4HKQA 4JP8A 4KHMA 2RAEA 1OR7A 3MAAB 5DRKA 2F8HA 4HT7A 4P9FA 4OIXA 1W2IA 3G86A 4HHJA 3MKWB 1H9TA 1XB4A 5LHGA 5D0RA 3JS9A 2XTJP 1NB2A 1FYLA 3WTYC 2XNQA 2ZH1A 4G8XA 1J5YA 2CSOA 2A5YB 3MPVA 1K79A 2WOMB 1SL1A 3OW2R 1XNQF 3BH6B 1RU2A 2PBIA 3C16B 5IC6B 1J0RA 3ITHA 3EWGA 3KPHA 2ZZTA 3IBWA 4DV6J 1NH8A 3GONA 4USWA 5T14A 2VFSA 2IDLA 4MYTA 4RNOA 1QSLA 2E36A 1K78A 3H5AA 1UFWA 3HOYJ 4IHXA 2CG4A 2ZWOA 1HDDC 4JI8J 3K70D 4C3HJ 4B9MA 2KIMA 3PQJA 4OYBA 3K70C 5F8MA 1BIAA 3FXJA 4Y2IA 2OMLA 3SDEA 1BXNA 2X1BA 2GGPB 4V2GA 5EWEA 3B4MA 3MFIA 1LWEB 3DDNA 5HI7A 3MPDA 3IV5A 1X60A 3L4BC 5KFZA 1O6XA 5K7ZA 3ZTSA 3C3WA 4C48A 5KFSA 3L3CA 3IS9A 2DMNA 2R7QA 3RBXA 2E29A 1X19A 4C8MA 1N34J 3UE2A 2PI4A 2K9MA 2KFYA 1WJEA 4P7VA 4ES1A 3A0BC 2C2OB 3KJVB 4FHTA 1AXQA 2AF6A 3MPUB 1URRA 1L3VA 2O03A 4KB7A 5K1YA 1SUQB 3R7BB 4FYXB 1SJRA 1KONA 4MHGA 2G7HA 4DWIA 3OV7A 1BD6A 2MLXA 1WGXA 3TOQA 4QWAA 1J2XA 2XNRA 2C3UA 2XQCA 1T6SA 5D4NA 1N6QB 3H0DA 3K57A 2VQGA 2IS4A 3VGSA 2HNYB 1XG1A 4DPYA 2CQ1A 4F55A 1BE4A 4UT4A 4G1QA 1WWXA 3M1VA 5J8FA 2B9EA 2L7KA 1OIAA 3C7JA 4I64A 5E5NA 4B1RA 1VQ7I 5L1KA 3GTLJ 2BJ9A 4O44A 2HQ3A 3PXGa 2LDUA 2XMTA 4Y6IA 2QE5A 2OBPA 5HP1A 4U88A 1X5SA 4B48A 5F0CA 5F3TA 3SJMA 4ON0A 1ZG1A 1QLNA 5LHIA 1XC9A 2E9TA 2BOLA 2RKIA 4P2MA 3UCGA 3RB6A 1L3KA 3BPDA 3R7NB 4ESBA 2R7OA 1W4MA 3EUNA 5J8CA 4IFYB 2KFDA 2V9PA 3JTHA 2XHCA 2EG2A 4KH0B 3L9FA 1OPZA 2MY7A 1QA6A 5BS6A 1QVFR 2OP5A 1JHHA 2LDYA 4OX8A 1YIJS 4D9JA 1YS6A 3BR2A 3LUYA 1O7LA 5J6XA 2CNKB 1UJ6A 2A69F 3PV8A 3DWLE 1I94J 4Y3OA 4Y2KA 3JSOA 5KT2A 1S5LC 3MEGB 4DUTA 2KJWA 2X6YA 5HJXA 2YH1A 2AJQA 3G6XA 2I10A 2L9WA 2G2ZA 2R3VA 3WE2A 1IW7F 3ET6B 3KLHB 1EHWA 4MK7A 3BR0A 2XHWA 5F8LA 3PX0A 1S6PB 3ZRGA 1W25A 2AXLA 2Y9YA 1LK7A 3JR9A 4UUWA 3UN3A 3OV8A 2AU0A 2ZH9A 4O3QA 4WFAQ 2WONB 2RGVA 1TNTA 2XF5A 5HROB 2P81A 3QT7A 4ECVA 4ECXA 4TU9A 2I38A 3WHIA 4C8NA 3VTIA 2BVZA 5CVVA 1Y0UA 3S2DJ 3N9UC 2O67A 4B9LA 4MKAA 4A3JJ 3B6AA 1YBUA 2AQFA 2JLEA 1YZ6A 4R5PB 4C11A 3RR7A 1NBEB 4U0YA 4HNVA 3BC8A 4ZIVA 1C0WA 4RGSA 2B3TB 3KOAA 5CCMA 1RWNB 3H2VE 3ELKA 2DNMA 1M5SA 1ZGAA 4U9RA 4LF4F 4PG4A 1F3FA 2IS2A 3MAQA 3I56S 2KI2A 4HX7A 3P9KA 3K0LA 3NGRA 1Q1VA 4IQMA 4I2OA 3CDIA 4ID5B 2AYBA 4KT0C 3KEOA 1LWCB 2GOXB 2JEIA 1YJNI 1VYAA 2HXOA 4KITB 3FMWA 1SL0A 1RT3B 3LA0A 2QEXI 3FBBA 2XWYA 3S2HJ 3KUHA 3J81U 3EGZA 4LF2A 4GGGA 1Y0NA 3DOMA 2HRUA 5D6EA 2VUGA 2NOGA 3PX4A 2LH9A 4CCJA 1VIOA 4IDKB 4ZVGA 5IT9U 4EM2A 2RU9A 3FCWA 2WAQA 1HA1A 1GMUA 2E1MB 4EU0A 3Q23A 2HS0A 1GTEA 2ZKTA 3PSIA 4O4GB 1T3NA 3AXMA 5DGBA 3LPYA 2M4GA 1TC3C 4YP3A 1SJQA 4P71A 3LFKA 1KLMA 1WKKA 1A04A 4I2QB 4NQWA 3C1DA 4BWJA 4ETZA 1DY3A 3LGNA 1K7AA 2OPSA 1MROB 4DV2F 1R43A 2QYCA 5J1PA 3VYRB 3LP1A 2M3AA 2RQPA 4DQQA 2NREA 4OLOA 1WJ5A 1RA6A 2CV1A 5B66C 1YX2A 4QPXA 2BY2A 3S7RA 5D0GA 4ZVRB 4OI2A 4BKXA 4ENNA 3H20A 4ESFA 3CE8A 1J27A 1D9FA 2G9OA 1FYMA 2VIHA 1FFGB 2RUSA 4M5IA 3AJDA 4A8KA 3NCPA 2ZJ2A 2E1NA 3H9GA 4Y33A 1RAIB 3MKZA 2PDAA 1Z77A 5D4LA 1AYEA 3MZYA 1AKHB 4GO7X 1MSWD 1Z1ZA 3KHGA 3DLGA 1CULA 4AU7A 3TNVA 2DPDA 2JMWA 3UN2A 4BJTA 3KHLA 3AXKA 1QAIA 4DQPA 3JRCA 3T9ZA 3IWNC 1Y5NB 2WVEA 3SXLA 2VDIA 4GFBA 2BE5F 3Q8YA 2GA1A 2HDCA 1B9NA 2HNDB 4BXUA 3LWLA 3TP2A 2MKYA 2FMLA 5DM6Q 1NB7A 1ZLJA 2IMWP 3TBIA 2FBKA 2DR7A 3PNYA 4EFAC 5IOLA 4MFBA 5F1JA 3QRQA 4IG0A 3EETA 1N5TA 3MR5A 1ETXA 2HPUA 2HDDA 2MB0B 2OPRA 3Q86A 5IWAJ 3K1PA 1DP3A 5IT9Z 4IOCQ 4N4OB 3CCVI 2FF4A 3MMJA 4EGZA 5KFQA 4A8XA 4RGXA 4HI1A 2E71A 2MZQA 3GIMA 1KYWA 3CT9A 4ITSA 2MA3A 4ENMA 4BBRJ 3VR1A 2I1RA 5ETMA 5T41A 2XCPA 1SFUA 2GVZB 2FYXA 2HEKA 2LNBA 1DTTA 4IOBA 3WGIA 4CNZA 3GWZA 2O66A 3K4KA 2ZBKA 4M3FA 3W9HA 3A02A 1JJ4A 4DR5F 3T5XA 3ZNJ1 1YHQI 4NWBA 4UXNA 3G71S 4NXNJ 1I6JA 3EZ5A 3GTOJ 4O0IA 3BSNA 1DGRM 2LKXA 5IV3A 4CH7A 2OZUA 1IGNA 5DG9A 2LY9A 2KFNA 2QKMB 1XMBA 3I32A 1O5JA 2QLBB 3OSGA 1NPRA 1S6QB 2B0GA 2MC4A 5DO2A 3LSIA 4GO5X 3HPGA 1X1AA 5HQLA 4NYOA 5J2PA 2EK6A 3SCLE 4ECWA 2DT6A 1V5IB 4RZRA 4F02A 4RMNA 3E8OA 2L9NA 3C14B 1RWPB 4I6ZA 5DGAA 4LR9A 1LFBA 1SEUA 1RESA 4OIOF 3I82A 3RTVA 2QC3A 1MBHA 2ALYB 1PKUA 5J4VA 1X4HA 1IXRC 1X4EA 3BPVA 5KFHA 5KFEA 1H7WA 2GJIA 2J9DA 1OMSA 1ZK8A 1PG5B 3AJ2A 3RJMB 5B0CA 3SEOA 3HFVA 5FLXY 3OYGA 2YU9J 1WC6A 3TW7A 2IA6A 2J7UA 1N78A 3Q5FA 3M9NB 5KFWA 2RDPA 4LIUA 2HFZA 3IG1A 1UVLA 3GV8B 3FXUA 4ZITA 4LLNA 9ATCB 1TL1B 3GEZA 2CJQA 4Q2MA 2OD5A 5J40A 1U0JA 2DR9A 4GRIA 4FXDA 2P9EA 3SFGA 4K4TA 1YRXA 1HKSA 1HD0A 2A6EF 1AB8A 3KLIA 1I1GA 4DV6F 3B6BA 2KRCA 1EX8A 2UUCJ 2DCLA 2RKHA 1VQPI 3K5OA 1QZZA 1WHWA 2EPIA 3L7WA 2ZEJA 2QL9B 1Q7YT 4K2XA 2ZNZA 2YKOA 3SCIE 4DF8A 4WZMA 1U5TC 4LR8A 4PWWA 1OYWA 4A3LJ 4C9YA 4AIKA 3THPA 3VALA 2CPHA 2ZM6J 2RAQA 1DAXA 1PC5A 2OPQB 3MUVP 2DVIA 4LVOP 4ETSA 1JLBA 1BQNA 4I1TA 3J81j 2UZAA 1UEVA 3Q9VA 1K4SA 2W2NP 3D0SA 2YKMB 1XGMA 4ECYA 3ENWA 2YKPA 4IF4A 3J7ZT 3C6TB 5RUBA 4DV5F 1RWUA 3DRPA 4EM0B 4KMFA 2HEOA 5CVIA 5FIIA 3CCJS 1HSTA 4MJKA 2Z3YA 3CJ4A 1W26A 2OI2A 2ADCA 1RWXB 4HV5A 1FE4A 3L2UA 2GIZA 2L3MA 2VL8A 5FKOA 3GVAA 2J76E 3NEKA 2BKPA 3IN5A 3PNIA 2HIYA 2OEKA 5F41A 2V69A 2V4JC 3CF5Q 3FXMA 5L3BA 3WU2C 3M1EA 2MY8A 3DOLA 2MZRA 4C3LA 1CQNA 3KE2A 1SH3A 2PMZA 2KZZA 2KFZA 2CIMA 2JX2A 3MAAA 3K5NA 1P4AA 4K2EA 5KFCA 3HULA 1A9NB 3IWZA 5K7FA 3CJ0A 4YFUA 3QT8A 2E1AA 1CJUB 3I4NJ 2MDAA 3CUQA 1TKZB 1M0SA 3J80Y 4YB7A 1R5GA 3R6SA 1SXLA 1VLOA 4DR1F 3N6LA 2WOMA 2OUGA 3O5TB 5H1SV 1JKQC 4A5MA 2C3PA 4XKBA 4ZLLA 1SKWA 4QCLA 3C16A 2FOWA 1AZSB 1H0HB 2HVRA 3FIWA 1NPKA 2OELA 4B9UA 3MVPA 3DTIA 2DNHA 3JSPA 3S17J 2XGXA 1RQ0A 1K0VA 5CYQA 2X4HA 1FI4A 3QZ8A 4WXCA 5FB2A 2H9ZA 4II3A 1WC0A 1Z3YA 4BXXJ 4BLGA 2Y1JA 1PCAA 3H5YA 3K4MA 1JJCB 2W8KA 2KQRA 4DW6A 1VQ6I 5BXIA 4NE9C 4QIVA 4OZLA 3KEYA 1JJ8C 1S77D 4B47A 5I42B 3GIJA 3QP6A 3PR5B 2ZZMA 2CYYA 1X7VA 1Z0XA 3DGVA 3EZUA 5EZGA 1DLOB 2DGUA 3FEYB 1O7FA 3ELHA 1XCBA 2Z2LA 2W9BB 1UVMA 1OPIA 4NA2A 5D0EA 5D78A 5BYSA 1BM9A 3UDVA 4QTRA 4OQJA 2NS1B 4I6WA 5F8GA 1FJLA 2CW0F 1NNDA 1RAEB 1JLEB 1MG7A 3ZO7A 3PNTA 1HHSA 2ME6A 2MQNA 3V5RA 2AX0A 4UTGA 2DGQA 5H9FK 4QWBA 3W5XA 2FVQA 3WU1B 4ZZDA 3ULHA 2MJNA 3MMBA 4FNHA 2XLJA 2CFOA 4DUYJ 2V1DA 1ETQA 4J9MA 1Y3KA 2MQLA 2VKZG 2JPBA 5K8MA 5F1RA 2YKQA 1RZMA 2F8EX 4WF9Q 3R5JB 2V5HG 2OD6A 6FDRA 2DA3A 1IXCA 4ECZA 1JGGA 1N6QA 4QW8A 1YSJA 2OFHX 4NLGA 3D1QA 1TNSA 1MBEA 3JRDA 4YIIA 2KKOA 3I55S 3HGYA 4EZ6A 3PVXA 1BR4A 2C2RA 2E2JJ 1OCPA 2BEOA 2QQBA 4EBDA 4CO8A 4A5NA 4LLGF 1VQLS 3ISND 3GCMA 4IRCA 3A4TA 2VA3A 4IH7A 5KG5A 2J0XA 2PD1A 3NAUA 4DV7F 2FHMA 1ZYQA 1A31A 2NSBA 3OR1A 2Q2EA 1T2KA 4I2PB 4KYZA 3DEEA 2DFEA 1D1CA 4E7LA 4FN5A 3I59A 3BKFA 1U8RA 2E35A 4A8SA 1N48A 3LW5C 2KT0A 3UI3A 3A8JA 3MPWA 4W98A 4C3MA 4JV5J 2DQLA 4F7VA 4E70A 4WTYA 5KTQA 3QATA 4O3NA 4KY3A 2DFHA 1F36A 2BHYA 2M4MA 4X0GA 1N4LA 3FDSA 1PC4A 4IFYA 1WORA 3VZIA 4ZC3A 2IC3A 4LFAF 3AG1H 5E41A 1FDAA 2FLOA 1D8KA 3ASNH 3D28A 3U1KA 4CSWA 1MMDA 5DQIA 2GCFA 4RM2A 2ZUGA 3Q8QB 4EEYA 3AG3H 3WTZA 5HLHA 3TAMB 4LITA 1SD6A 2MZ1A 4MKVA 2DGOA 1YIOA 4V19J 4I09A 3GZNB 3MEGA 3GR1A 4P96A 1Z91A 1ACMB 3S1MJ 3H3ZA 3CB4A 1IZ1A 3GFJA 7FDRA 1NKCA 3MMAA 1QGPA 1TKTA 4XMYA 3IBFB 2WV1A 2KB2A 1ON2A 1P7IA 4NC6A 3GYHX 5HLIA 3SIPB 1IUYA 1Y1VJ 3OYEA 5HO4A 2XB0X 4Y28C 3HIFA 4I68A 4MO7A 1J5EF 3VGUA 3K58A 1BIBA 1R0AB 4P2XA 2O3DA 3V6DA 4EJUA 1LXNA 4G6VB 5AJ3J 2BHZA 4UQGA 3U9GA 3MF5A 5KOWA 1JLCB 2XI2A 4X4SA 2BM1A 1ZELA 1ZBTA 4NA3A 4QU6A 1Q81T 1EH7A 2CU7A 1YJTA 5A2QU 1Q16B 1CJTB 4OAZA 3KUEA 2ZJPF 3K2AA 1S6OA 1S1XA 3POTA 4LQ3A 3ZMTA 3OYMA 1H73A 4EO8A 3KJFB 1FE0A 5ICEA 3VFZA 4NLRA 4LG3A 3L2WA 4ID5A 1UVJA 3WHCA 3CF2A 4FETA 4ED1A 2CDRB 2OF7A 3T9NA 3EDPA 1RT3A 1WC5A 2IMOA 3CCUS 4P52A 4XRSA 3M4XA 1KVJA 3CCQI 1Y5LB 3FSYA 3CJNA 4OI3A 2JUCA 2AKWB 1TWHJ 1NK5A 4H4OA 2M9HA 4FKXA 3NNCA 2H27A 3DLKB 4DYCA 3PO3J 1X5TA 2UXBF 1V6HA 4ZCMA 1TWGJ 1ZA1B 2XHKA 2DB1A 3QPSA 1C2PA 4O4GA 2JSXA 4USHA 4P2FA 2BMBA 1N33J 1KWMA 2VF3A 3VOEA 1UPPA 2NXEA 4I2QA 5HMWA 2E5LJ 3H0GJ 3SSSA 3IUOA 3ZZPA 2M8DB 4O3SA 3THTA 2CRLA 2OTJS 2QBYB 1ROFA 5DLGA 3IKVA 3DRXA 4PXBA 4ATNA 1LV5A 4ENJA 4OL8A 3R2DJ 4WZQA 3KLNA 1Y39A 4J19A 2MW8A 1AUDA 3TJ9A 2ETHA 3VV2B 2VQEF 2VJUA 2H6BA 3BG9A 4RM3A 1YK9A 3KFWX 2YWHA 4XLFA 1F9NA 4XORA 1BUXA 1HSJA 4KJZA 1IO2A 4ZLNA 1JT0A 5EDNA 3W6JB 4HF2A 3QFWA 1NU4A 1NUEA 2KN4A 1G3OA 3VAKA 2NZ4A 1WD6A 2GIFA 3WQPA 4RDUA 3BO3A 2DGSA 2X1CA 4CUGA 3R61A 3DKWA 2BE9B 5B08A 3FCVA 2GIRA 2FIUA 3PYGA 2GX8A 4HDUA 4MQ9F 2DHGA 3I9V9 4ZJOA 5EZHA 1ZRCA 5JVHQ 2HAIA 4BS9A 3M2RA 4FVCA 1RHJB 3ZZYA 2DT9A 3CMMA 2XMVA 1YJWS 1JQGA 1RUSA 4RU9A 3QAEA 1IG7A 4CLYA 4MFDA 1A6QA 1YYVA 5LMNJ 3DFEA 1DFDA 1JMTA 2I9SA 1RISA 4P72A 4KGXB 1Q79A 2NCKL 2W85A 3MZIA 1UKUA 2CZVC 3BGRB 2KXNB 2HOTA 5U47A 1R8CA 3DF8A 3W2AA 3HLUA 1HKAA 1JKOC 1FIPA 2BE7D 5CVRA 1FRIA 4ERDA 3OL7A 4AXIA 3H5SA 4Q8EA 5GMKa 2KIUA 5EEAA 2X48A 4HACB 5GAEJ 2IY5B 2ISZA 2EW9A 3F0NA 1X2NA 2EH3A 2OAZA 1K1SA 1ZGJA 1XERA 4OMYA 3C66A 5T7LB 3QRFF 2X51A 1U8WA 4FYDA 3MCMA 3V7RA 1XR6A 2BX6A 2HHHF 3CDBA 2CW7A 1YFHA 1R71A 1D9DA 4ZVPB 3G6YA 5F3ZA 1A35A 1MWQA 2VN2A 1F2GA 1HNZF 3ZQQA 3MM5A 3ZQFA 3NWSA 5IPAA 1ZZNA 1TK5A 2V9KA 1SC6A 2CG8A 4F2RA 1I1SA 3J81K 3LOCA 4LIVA 4HDVA 3T0YA 3L1PA 1SKSA 2RNJA 3LPEA 4OX9J 5CVJA 2ZBCA 3SQGA 2DODA 5KFJA 3T6JA 5IT9K 2VLAA 3DGPA 3P5JA 3DLHA 4QSHA 4PR6A 3BLYA 1EJ9A 2NAZA 2PN6A 4YB6A 5A0YB 1T56A 4RBTA 5L8RC 4B08A 1R31A 2HZVA 4WCGA 3I0TA 3R0JA 1NCLA 3LP0A 3VAJA 4Q5SF 4NYPA 2R8KA 2LXIA 3ETMA 4CLKA 3ADAC 4CCNA 1HBOA 3R1LA 2RE1A 3IH4A 4IHVA 2GWRA 3TEGA 3D1OA 3M1CA 4O3PA 4B3MF 2XSJB 3P8BB 1Q0NA 1LUJB 4KNYA