1P9QC

Structure of a hypothetical protein af0491 from archaeoglobus fulgidus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
233
structure length
230
Chain Sequence
b'VSLDKAVIARLRKGGEEFEVLVDPYLARDLKEGKEVNFEDLLAAEEVFKDAKKGERASVDELRKIFGTDDVFEIARKIILEGEVQITAEQRREMLEAKRKQIINFISRNTIDPAPHPPSRIERALEEAKVHIDIFKSVEAQVKDIVKALKPILPLKFEEMEIAIKIPPEHTGRAISALYNFGGVTREEWQRDGSWICVMRIPSGMYGDLMDLLGKVAKGEALTKVLRRIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AF0491
publication title The Shwachman-Bodian-Diamond syndrome protein family is involved in RNA metabolism.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 58
structure length 230
sequence length 233
ec nomenclature
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01172 SBDS Shwachman-Bodian-Diamond syndrome (SBDS) protein
C PF09377 SBDS_C SBDS protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.900 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1p9qC02
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1p9qC03
3.30.1250.10 Alpha Beta 2-Layer Sandwich Hypothetical 12.0 Kda Protein In Nam8-gar1 Intergenic Region; Chain: A; Ribosome maturation protein SBDS, N-terminal domain 1p9qC01
1T95A 1DARA 1FNMA 4FN5A 4ES1A 1N0VC 3B82A 1NYNA 1ELOA 4QR0A 1ZM9A 1VI7A 2BM1A 1ZM4A 1ZPWX 5G4DA 2WBMA 3E3XA 2E1RA 3B8HA 4ZCIA 1ZM3A 4M1KA 2J7KA 2BV3A 3ZZUA 1P9QC 2KDOA 3EXCX 1N0UA 2CVEA 3OQ2A 4ZCLA 4ZCMA 1ZM2A 2NPFA 2L9NA 2EFGA 3ZZTA 1KTVA 4MAKA 2IVYA 4QR2A 2BM0A 4TNOA 4MYUA 3LH2S 4MYTA 4QR1A 2ZITA 4ES3A 2XEXA 4ZCKA 3B78A 3UI3A 1U2RA 2I0XA 4ES2A 3ZZ0A 2I8EA
chains in the Genus database with same CATH superfamily
2ASJA 2KIMA 2JEGA 3GIMA 3VR1A 3Q8UA 5HDKA 2K7LA 2UUCF 3FRZA 2H6BA 2E2JJ 5CYQA 5C25B 3MWBA 4H54A 3CC4S 1AA7A 2GHVC 2NVUB 2K4JA 5L3GA 4Y13A 1ZPVA 2FUG9 2M8EA 4V19K 4F50A 4XLPF 5FLMJ 1NJIT 5A8KA 1U3EM 1RZ4A 3NWSA 1FWLA 3BR9A 1XMBA 4GKKF 3BR1A 1WSVA 1HR0J 4J9QA 4MQVA 3KYCB 2BHYA 1UPMB 3HX9A 4Q8EA 3HK2A 1FJEB 1WHXA 2UP1A 4EMDA 3KTQA 2OCCH 3VVTA 2K9MA 4G6DA 1LWCA 2MGQA 3OYDA 1X5SA 1WI3A 2O61A 1BGXT 1L3SA 2QSGX 2MZ1A 4J90A 3GTYX 3Q8YA 4FBTA 1QZZA 3G4SS 1KRPA 2FVCA 2QLBB 3S1NJ 1S6OA 3K89A 2F5VA 1HD0A 3W9IA 2DA5A 3M8EA 4C4WA 1UEKA 2V5HG 4XRSA 4BQQA 3OLBA 4A3CJ 1HWKA 3W9HA 1E2XA 3RRHA 4QPOA 4NLYA 3U1MA 4OYWA 1E6YA 1MZBA 2CVEA 1CULB 7FD1A 2CQIA 2V63A 4EK2A 1U9OA 1UEVA 2MZQA 3ZZYA 4KGXB 1OSDA 2ROGA 1Y3JA 2VLAA 3KJNB 2XTJP 1FT9A 3K2AA 4IFYA 2XF5A 3TA0A 3BG5A 5M5WJ 1FDBA 3MR7A 1DQUA 5B0AA 1IQZA 2W1OA 2M1BA 1Y0HA 1SD4A 3EPZA 3PFYA 5DLGA 5DS9A 4LSZB 2M7BA 4F36A 5BR8J 1SJ1A 1CSJA 3MMJA 1WF0A 2EK1A 1TP4A 3OOUA 2BQRA 1DUXC 2NREA 3NWGA 2IDLA 5E41A 4GGGA 3O44A 3TDZC 3BTJA 3ZCOA 2BY3A 5CHCB 1JTYA 2A5YB 3FXOA 3MFHA 4K50A 1RWNB 4OZ2A 3SCKE 4O4RA 4P7VA 3WIVA 4ON0A 5HATA 4YG2F 3ETOA 4KTQA 4F2SA 4OLOA 4OI2A 3CIZA 4JI5J 5DCMA 1IKXA 1RWXB 1VI7A 2VDIA 1SFEA 2FC8A 1B1BA 3A3OB 1HQ2A 2XAUA 3UCGA 2GM4A 4ELUA 3A0BC 2QSFA 1XJWB 4IH7A 3L7OA 2LLZA 1QNTA 1WFXA 2AQFA 1U5TB 3CCTA 2BVZA 2CUYA 3OTCA 1N5YA 5DZ6A 3FIWA 2F5CA 4IG3A 3TQ1A 3F72A 3V6JA 2YNIA 5KT2A 5K8MA 3CMQA 4UOCA 4NLTA 4GC6A 1LFBA 2B8PA 2D3OR 3KEQA 4Y34A 4O0IA 4QWEA 2P2CB 2VJVA 2A3JA 4FKXA 4CH7A 2RDPA 3D3BJ 2CDRB 4KKOA 2AGOA 2UUBJ 4JI8F 1KC8T 4IH6A 1WEZA 5J2PB 2KG1A 4FF3A 2NNNA 3S6EA 3FC9A 4DYQA 5B1AH 5J1EA 4YMEA 4PG8A 3DLEB 4FASD 4X84A 2COMA 2YNFB 2DA4A 2MDAA 3OHBA 5HVGA 3GIRA 1XCBA 3CEDA 5DQIA 3VAKA 1RDRA 3OUYA 2LSOA 1MNDA 1Z2ZA 2FGOA 1WC4A 4I0AA 2XAQA 3RZOJ 1BQNA 2F3JA 3ZQCA 2DK2A 1WI6A 5J1RA 1R0BG 2MLYA 1RTHA 3RG6A 3BDEA 3VGUA 2HZDA 3L2CA 1VS3A 4NLPA 5K8PA 3TAMA 1JKPC 4P52A 1Q8BA 1RA6A 3PKYA 3ZNUA 3OFGA 2BKPA 3R5AA 3IR5B 4A3KJ 4KO0A 3Q0UA 3VGTA 1MBJA 3ZTOA 2CNKB 1GNKA 1YYVA 2DJIA 3DPTA 3Q0WA 4MK7A 4B3SJ 2R4FA 2AV5A 2QMUB 3EZOA 2O8XA 2IXSA 4U7BA 1D09B 3HFZB 2KH9A 4EGZA 2W9BB 2EBEA 2ZJRQ 4BACA 1ZZFA 4K4TA 2P8TA 4NA3A 4E7LA 1RTJA 2F6CA 1HDDC 4JQFA 4GKJF 3AQPA 2ZH6A 1I6XA 2CG8A 4CCMA 2CNNB 5F8NA 1Y5NB 3ILLA 3HHLB 5BNGA 3PO2J 3D7SB 4AXJA 1ZZNA 2HWVA 2OEJA 3ABMH 2VFVA 1YS6A 1IKVA 2V1DA 3T9NA 3MM9B 2HNZA 3HG9A 3GVAA 5EYRA 4LIWA 2CRGA 2MSTA 3KYDB 4Q47A 2DXIA 2OUGA 3DWLE 3LSHA 3UN3A 5KT3A 1M5PC 4M5NA 2MEWA 2BJDA 3R5JB 1FLIA 1JLQB 4DUZF 1Y8RB 2BW3A 2LA6A 1ZLKA 3CJTB 4BCAA 1Q79A 3VYTB 3GLXA 4JOMA 4B47A 4UQTA 4J19A 1MBHA 3I0SB 1ZHFA 5IP7J 2VB6A 5CVIA 2FU4A 1J75A 3I9V2 2DH9A 3ZXWA 1KA8A 1RYSA 3RB3A 1SPBP 5BYQA 4S0HB 1L3KA 3C6TB 2G2YA 2Z1DA 4LGWA 4DSKA 1Z9CA 2VZ9A 3OT9A 2CPZA 4DPYA 3ZQFA 4HNTA 3W6KB 1S9FA 2QO3A 4BDZA 4QR1A 2DPDA 3ZO7A 2O1PA 1HNZJ 3FMBA 3HUGA 4PUSA 2QLZA 2V68A 1WJAA 1UHSA 5C42B 1RGVA 4G1IA 2HPIA 4IL6C 1S1WB 1XN9A 1UWBB 2E1RA 2CPJA 3QGPA 2PMZN 1RBLA 3VAGA 4L76A 1ZG3A 1I3QJ 1HMVB 4LRAA 2LQBA 3IBCB 1YHQI 3GFYA 3OYNA 1WSRA 2H1KA 4P10A 2Y0SA 3ILOA 2N3LA 4I7HA 4G1QA 4Y2IA 4ZP8A 1IZ1A 1T33A 1CF7A 3GLJA 4PRFA 3U2RA 2QKLB 2MKJA 2VH7A 2E5IA 3RAQA 5ETRA 1H89C 1KQ0A 1X1DA 2EH3A 3DLBA 2YY3A 2DCUB 4GMKA 2FQ3A 2ZXHA 4DR4J 5BYSA 1U45A 2C2RA 4Q0BA 2DU9A 1X1BA 1W25A 3OXLA 4RPFA 4DN9A 5EZGA 4HX4A 3RDIA 2F65A 2VV5A 3A13A 4EEFG 2IDEA 1FP2A 4WZMA 1S12A 4KHMA 3HYIA 2ZZTA 4YOEA 2DHXA 2XG8A 3MN2A 1RAFB 4GDFA 1PBUA 1JIHA 3M9MB 1U49A 1DFDA 5I3UA 3JSMA 3AAWB 2LDUA 2QN6B 1G7CB 5DQGA 4MGRA 1UPPA 3QRPA 2HQRA 1EIYB 3E6CC 1V3FA 4IOCF 2UUAJ 1M5OC 5E3LA 5K5OA 4F02A 2DYRH 3L9FA 1Z1DA 2OZUA 2ZUAA 2LCWA 4RW6B 2AO9A 3CDEA 4I4BA 2V6AA 3G6VA 2CQ0A 1BBYA 3HULA 2RRNA 2EFOA 3WGHA 2D69A 4E7SA 1HHQA 2HGLA 4JX6A 4X64J 4KPYA 3CF2A 5KFMA 3DDNA 3CO6C 4ES2A 3I59B 2BY0A 4RB3C 5IXUA 1T7PA 4KE5A 1S97A 2ZBIA 2YWKA 1P4WA 5DTDA 3BWGA 4OI0A 1OY9A 1TKZB 4URQU 4WK1A 2B4PA 1PG5B 2OH2A 1NM2A 1JHFA 5LHIA 3JS9A 2CPDA 4BJ6C 1DY3A 4C98A 1PP7U 4YR2A 2KT3A 2ZC2A 3GB0A 2VU5A 5EDNA 1QAYA 3NLCA 1KN6A 3RR8A 3LUYA 4F4XA 5HJYA 2DLLA 2RGVA 2C2EA 2FZGB 4J9NA 3IAM9 2YKQA 4J9MA 3QO9A 3KIOA 4F7VA 4M73A 1UZHA 3QSIA 5F08A 2XSFA 2E5NA 4K4ZA 4YY3F 3LAPA 3TVKA 5DG9A 3K8VA 3CESA 1S0OA 2KZZA 4ESFA 4BUPA 2L9VA 1X4FA 3KLGA 1YOVB 2XAJA 2SXLA 3H59A 4F2RA 3X1LB 2EBIA 3D1NI 1QSSA 2HZVA 3VTIA 1IUFA 2QC3A 3KP5A 2WW8A 4OZ5A 4M72A 4A6EA 3TEHB 1JJ8C 1DJ0A 4ZYDA 1S1VA 2Q6CA 3LF0A 1MIJA 3A01B 3S8PA 5JXSA 3NCQA 4G1PA 4LF5J 2ZH1A 1XMAA 3KJVA 3VOEA 4OJHA 1WC0A 2DNGA 1DQ9A 1KWMA 3JRFA 2ZE2A 3WU2C 5C4XJ 3MZHA 2XVCA 3KCCA 3D1OA 3QAHA 3ZMZA 4BC9A 3RZAA 5F3ZA 3DI6A 1ETVA 3QYEA 3PX4A 5HROB 1FP1D 3K2YA 2B3TB 1VRQC 4Q5VA 5CYMA 2HXOA 2PBIA 5LSLA 5KFRA 5HP1A 4JV5J 2V1XA 4QLCU 3D68A 2IS1A 5JFRA 5HN0A 2UXBJ 2G7HA 2QGFB 4R25A 1WJFA 2XAGA 4HV6A 4B9MA 2WVBA 2AYBA 3KP4A 1V6HA 2PI4A 3GWCA 3WG7H 2HHTA 3U1DA 5A0YB 3CCSI 3D6MB 3US5A 3G87A 1LKZA 2ACJA 1U09A 1VQLS 4FXDA 1TWFJ 4ZLNA 3CMEI 3D66A 4C11B 1J09A 4IRCA 4QYZJ 3E5XA 1OCCH 3GYNA 2FZKB 1MDMA 4OZLA 4UUWA 2OEMA 1HQUA 1MN7A 4B09A 2J8SA 4KT5C 1HPZA 4MKVA 4L5EA 2L08A 5H2FC 1CQNA 1WHYA 1D0ZA 2ZHBA 1XN7A 1YZ7A 2C3UA 2BVMA 2W9CB 4IHVA 3PDNA 4ZPAA 3QGIA 2H9ZA 4BH9A 2DFEA 2MG4A 1TL1B 3I0RB 3LP2B 2KHDA 3MWMA 1U8RA 2MC3A 1DTTB 1OJLA 4KB7A 2BR0A 4K4VA 1KQ8A 1ELOA 2C2ZB 2LQ5A 2OD4A 4LG3A 2GIRA 2LDYA 2XDVA 4TY9A 2C2OB 2QLXA 1XMXA 1VRTB 3EUHC 1S1TA 2DNYA 3IKTA 2DNRA 4KJIA 3EM1A 3UKGA 1X2MA 4L5IA 2AWZA 2IBOA 3RZDJ 3P5JA 4XOPA 4YHHJ 4TY8B 4KN7X 3C15B 3HLUA 2XLIA 5J1PA 4C0OC 1P1TA 3POTA 3OIPA 1X4EA 2WB1A 4TYAA 3VSLA 3EMTA 4EZ6A 1HBXG 1VQ7I 4OIQF 1U2CA 4OYIA 1UW9A 4PUOA 2HIQA 1FD8A 2LFVA 5DEQA 1SH3A 2C2DA 2CZ9A 1MJAA 2V26A 3CD6I 2JRSA 4ZVGA 3D5RC 3PFOA 3CDAA 4J01A 4ENJA 4S05A 3CJRB 1XG1A 2EKYA 2BHZA 2NXNB 4HT7A 1NB7A 3WTXC 2CADA 4KMUX 2H48B 3NCPA 2VJ5A 5FKLA 3SCJE 2JJ7A 2DRDA 5I42B 3MDFA 3BBCA 1UFLA 4FNHA 3D0HE 1SQFA 3IP0A 4LITA 3QOPA 2Y1LB 4YDXA 1XC5A 3PW4A 2E2HJ 5C44J 4DCPB 1LDJA 1QLNA 3JTNA 3JR9A 2G13A 1OKRA 1XR6A 4MYUA 2KYXA 1FVSA 3GR0A 2HS5A 1S6UA 2FHOB 1YJRA 2CQ1A 5IQ6A 4OX9F 4XSZF 4CO4A 1OIAA 4YFNF 2JEFA 3BEGB 1TVRA 3DTIA 3CTAA 1S7IA 4PQAA 3Q8RB 3DLJA 3VEPA 1UCRA 5T7LB 2ZJQQ 1VQYA 1FKOA 3IXQA 1T9TA 4A3LJ 1L5UA 1WKMA 1K8AT 1IBMF 3TEDA 3L7UA 4AL5A 4DZDA 2PX9A 5C5JA 2HDDA 2I8EA 1I3OB 3HKZN 2D1VA 3DTEA 2GJIA 4OYAA 1SVMA 3RQ4A 3EUHA 4CLKA 5B3SH 1I51B 3W9JA 2V9PA 3RRGA 2Q2EA 2GFFA 3HSDA 4C3LA 3BR8A 4NRTA 3T8TA 3FWEA 3TEGA 4X66F 4I6ZA 3OS0A 4X4VA 2VONA 3Q89A 3IR7B 2FC9A 1T0FC 1IKYA 4L9VA 2IRFG 3K6GA 3EZ5A 5D3GA 1JLGA 2ADUA 5DCFA 3OMYA 4F4ZA 2FRHA 3HB9A 5EX0A 1E3PA 5KNLA 4PGHA 2H51B 2C28A 1N78A 4C7QA 5G0RB 2GHWA 1M1GA 5IWAJ 5LEJA 4USTA 2PEBA 4KGMA 1J5OA 2P5VA 3OSGA 5KG1A 1T9UA 1TKTA 3JTPA 3VVUA 3CC4I 4KPCA 2HYJA 1S4FA 2JL9A 3N4WA 2AYGA 1YZ6A 2GZOA 5KFSA 3VAIA 4DV2J 3M9OB 4M8LA 4ED3A 3B02A 1VBKA 1RUOA 3GJSB 5M3FJ 2QE5A 4PXDA 5AXKA 2YWEA 4L74A 3F6OA 2MJUA 4QYZK 3I5UA 3S7RA 1RT4B 5FLVA 3IGVA 3PW2A 3CJ0A 2QSHX 4DV5F 5RUBA 2P0WA 2DGWA 4DFMA 1UZCA 1IDYA 4YUDA 4B3OA 1TL8A 5JLWA 3KLIB 5B0DA 1ZA2B 2V6CA 1U6ZA 4X4NA 3Q2SC 2KYZA 5BOXA 3G4SI 4UW2A 2GVDA 4DR2J 5DDOC 3CD0A 4W92B 2PI0A 1QGPA 2M34A 5D8HB 4ZYEA 1T05B 1JXLA 1VQPI 1MJ9A 2VD3A 2CQ2A 3ASNH 2OA4A 3UDEA 1WACA 2FHKA 1S5LC 1XX5A 4O3RA 2ZC3A 2UUCJ 2ZH7A 1OJ4A 1PJ7A 3FNNA 2ZH2A 5ED4A 2OMLA 3IG1B 4YB7A 2PE8A 4ZC3A 4KHRA 4ZKAA 4P9UA 1K9MT 1N0VC 4OV6A 4E7ZA 4OJGA 4NDLA 3DEEA 3VZHA 4FQGA 2DY1A 4LF4F 1RT3A 2MLZA 1T0FA 1VMBA 4M5DA 2Z4PA 2E1MB 1HQEB 3K5NA 4CM0A 1ZGAA 1XB4A 5EN1A 2KN4A 1LV5A 3E6MA 1WVRA 3K58A 3DLHA 1F1ZA 1WORA 4JI7J 3DRYA 2C2KB 2FXAA 2CWKA 3LTOA 4HF1A 3FCVA 4KY3A 2NUHA 4L3KA 5AXMA 2FLNA 4LFBJ 3KK3B 2WBMA 1L3UA 4I02A 4HDVA 2VPWB 4B4CA 3QU6A 4OI1A 4KDPA 1RCXB 2IFXA 2B7BB 3VSKA 2KQRA 5FD1A 4F0MA 1AA1B 1F60B 1SVOA 2NS1B 2FVSA 4AVPA 3BPSP 3ICLA 2GVZB 5KFVA 1VIXA 4C2MA 2MH9A 2DXFA 5JHFA 1IV6A 1TT0A 4HKQA 1XNRF 4MFBA 1WKLA 1X5OA 2EZIA 3F41A 3BSAA 3GWZA 1FK9A 4K7QA 4OWRB 2YKMA 2HURA 3HVTB 3EX7B 3K10A 1RAEB 3W2WB 3ITHB 2YU9J 3KLEA 3PZPA 2STWA 3H9QA 1QSYA 1M1KT 1LOUA 4IOAQ 3GFJA 3TJAA 2XMWA 2UZKA 4LD5A 1IC8A 3HHKA 3HCXA 4HR2A 4EBEA 3SIPB 2VODA 3BG9A 4N56A 2AEMA 1FXLA 3GYGA 3G8QA 1L3LA 1CJVB 3T9ZA 3PSFA 1G3TA 2QYOA 4GXOA 2BRLA 5IV3A 1B70B 1XDUA 4Y2KA 3IRRA 3DOMB 4WCEQ 1D9FA 2DI3A 3QYBA 1HIYA 2FEZA 3V81A 4JX4A 1AFJA 3JB9k 2J5AA 1DLOA 2LG4A 3NEUA 4JP8A 2JUCA 1RWVB 1E3HA 4ZTJA 2AMCB 2HGMA 2HWHA 4RUCA 2DBBA 2AQEA 2DA1A 5FB2A 2HHWA 1F5BA 2DODA 3QT7A 2R7RA 4Q2LA 4DV3F 1R9TJ 3TR5A 4U6PA 3RCOA 5FD6A 2R5ZB 3WE2A 3BYRA 2NXEA 2ZJRF 5IYDJ 3F8CA 1WF2A 5D8KB 3PV8A 2X6OA 3G3ZA 4N5SA 3S1MJ 4LLNA 2LYCA 2FBIA 3AY0A 1B0VA 2BANA 3PX0A 1Y1WJ 1VK3A 4IHXA 3WG9A 3G96A 1Q8KA 4XRSG 4UVAA 5CA5A 2JQ7A 1YIJS 4CYUB 5LL6d 1HBUA 3AFGA 1RHRB 1TW2A 5IZHA 3LSKA 3LAJA 3BQ2A 5F41A 2OQGA 3MEEA 2V4QA 2AEFA 2I0XA 5KFKA 1E3OC 5D5VB 5HLTA 5AXLA 1TAQA 2GX8A 4USJC 4OMZA 1UJ4A 1KD1T 1A36A 5KFAA 2BKNA 1Q86T 5LOQA 2PMZD 4IFVA 4USKA 4DQQA 4E0DA 3M6VA 3TVZA 2E44A 3F21A 1K4TA 1FFSB 4OU0A 1VC6A 3QRFF 4DL0C 3F73A 2YWHA 4ZVOB 3CLOA 4X4SA 2DNPA 4BKXA 2KM8B 1AROP 4NE9C 1MNMC 2K4BA 5CZXA 2RILA 1N5QA 4NCGA 3JSPA 2PI5A 2DY9A 4RW9B 5CABA 2IGOA 3SV3A 2DTRA 1JGSA 2AX0A 2KJWA 1V54H 1WJCA 3RPQA 2XYPB 3GCMA 3PM1A 2DO7A 5FLXZ 1WOOA 3GTKJ 3M07A 2CW7A 4I76A 4IHYA 2VFSA 4HF0A 2OTJS 1QE1B 4LSNB 3B6BA 5T41A 5JHUA 1T94A 3H0PA 5FO5A 3TJ9A 4FPIA 1TMMA 1LFPA 3FF5A 2OI2A 2AXLA 4BQOA 2ZJ2A 3CULA 2LBFB 4OYPA 2MXYA 2GMJA 3G2XA 1ZTTA 3UI3A 2FA5A 4CO3A 2CKWA 1Z3XA 4BE0A 1X4PA 2C2MB 2EXUA 2VA2A 4J9OA 3SDEA 2W57A 2CJAA 1Y39A 1O51A 5ETQA 3H5SA 1RE1B 4GKJJ 1NDPA 5ETSA 3C3WA 3HM5A 1MSWD 5D15A 4LBPA 3CCJS 5U47A 4XAKA 1ZKGA 3K2ZA 1I1GA 2NSBA 1GT0C 2XGXA 3DLGB 5I3PA 2A6HF 1ODDA 2XUBA 4ECZA 3D0SA 2ID3A 5E1ZB 4I0BA 3CD7A 3MM7B 5KG5A 1HFEL 1D0EA 3HIFA 2CNOB 4YP3A 1DP7P 4LVNP 4QW8A 1F9FA 2ZC4A 3TA2A 2EFGA 3DQVC 3J7ZI 4B3TF 2B4UA 1AWCA 1Z6RA 5KFYA 4PKDB 5IOZA 3V8KA 1HNVA 2COBA 1VQ9I 1B8IA 3QPLA 2XI2A 3T1YF 2ZEJA 3HHGA 3VPRA 1VRUB 3VWBA 1AXQA 1YG0A 2Y30A 3ETMA 4HEA2 2XYGB 4RR5A 1I27A 1ROFA 4K4YA 1JNRB 5JVGQ 2DCLA 4QU7A 5F1JA 3BDPA 1DTQA 5ICGA 4RUHA 2XGQA 4D5FA 1B4AA 2RMLA 5IYBJ 1RBOB 2NLWA 1KFDA 4NC8A 2FZCB 3AT1B 4PXEA 1ZG5A 4B02A 3BBFA 4DV4F 5IT9U 4FX4A 5D6GA 5CLSA 3V4MA 4IQJA 2KXHA 3HEFA 2VQFF 1LVAA 2IHR1 1N33F 1Q0NA 4LFCJ 3D0IE 4DR6J 2VJIA 4HDGA 4KIAA 2TRTA 4OYXA 3NGDA 2ZOMA 2W8LA 1Q81T 3R5CA 2I5JB 4XQFA 1ZAXA 5GAEI 4CRJA 5DGBA 3TQEA 3G82A 1RAIB 3FXLA 2PEXA 2ZD1A 2LQ8A 2AYEA 1OQYA 1NG7A 1S6QA 4CUGA 4I09A 1OS5A 1Q82T 1RBAA 1W7PD 4KBIA 3OHAA 3KG0A 4WXHA 1JLBA 4OX8A 4MKBA 1JMTA 4PWDA 3OFFA 4HLBA 2D7SA 4EUVA 3CWJA 1QPMA 3KEOA 2ECBA 3AOAA 4R8UA 1MWZA 1H9TA 1T9XA 2CZ4A 2HKEA 3CCZA 2KVQE 1R8CA 2XKOA 1YBUA 3OQ2A 4ECTA 4Y4RA 4NZ6A 2IBDA 4A8XA 1Y56A 3FMSA 1KP6A 1N88A 4MNUA 3KEYA 2KO1A 1FJLA 1F3FA 3R7BB 1PBAA 3PYFA 1T11A 4TYBA 1B4SA 3KNAA 4M95A 1UEUA 3QQCD 3JTHA 1SIZA 2GA7A 2UUZA 4NLWA 3LL7A 1OLTA 4A0ZA 1E6YB 2XASA 3OTDA 1RT2B 2XWYA 1T6SA 4RGXA 3ZMUA 2IGNA 3OL8A 2VKEA 4IFYB 3KLFA 2HAIA 3H7HB 1OCOH 2Z2YB 3K0JA 3MZ8A 2HHXA 4X62F 1V3ZA 4IRGA 2ROPA 2MKYA 2G4BA 3JQKA 1FTCA 2AGQA 1V5VA 2HOTA 4N4OB 4O6JA 4DU7A 2OELA 2QIFA 4AXIA 3T1BA 3NNCA 1W5SA 2K8GA 1KKHA 1HLVA 4GRSA 2RT3A 3HVWA 3M3YJ 4CLWA 2Y8WA 3E51A 1BOBA 1AKHA 2CWXA 4KMFA 2VOOA 2XCAA 3PVXA 3L9ZA 5E20A 3KK1A 3VAMA 3FSIA 2A5WA 1VLOA 2ZO4A 2B5JA 2MLKA 2DW4A 4A0YA 4YS2A 2Q1LA 2DDAA 5FIIA 1TK0A 4DV1J 5DCMB 1IKXB 1NHAA 5CJ9A 3O6QA 2VFRA 1QM9A 3ZZZA 1UTAA 5JJBA 4ILRA 2QM3A 3HSFA 2OBPA 2PT0A 1NZAA 3J80U 1H2VZ 4RJVA 1N5YB 1NRKA 3D3CJ 4IG3B 4UHTA 1QQIA 4C48A 5GPCA 1JKHA 1TWGJ 1YQAA 3T1HF 3IM9A 4PXBA 4F25A 2M8HA 3FFIB 2ZWOA 4LFUA 2HIYA 1JXVA 1OPZA 3M1VA 2FX0A 2BA9A 4B17A 3V4GA 1U1NA 4U0VA 4I68A 4KKOB 2MYSA 4NXNF 3IFEA 3DRRA 3GP9A 2KXFA 4OL8A 3CCMS 1SH2A 5J1EB 4XN3A 4RB1A 4RUAA 3A0HC 2AW0A 2XWXA 3NOGA 2PSZA 2V4JC 3DOKB 1K79A 1G3YA 5GAEU 5C2CA 3OUYB 2GMHA 2EIKH 3M8QB 1GLNA 4BHPA 2K9SA 2QWWA 1F6TA 2LQ9A 1HKAA 2EFWA 4HW0A 1BQNB 3QQAA 5H20A 2J7KA 2R8GA 3DYAA 3BGFA 1S57A 1EQ0A 2L9SA 1VLYA 1HCRA 3W8GA 4NRUA 2IRXA 5L3FA 2ACMA 3D6TB 4NLDA 4WIIA 2LU1A 5D4OA 3EXYA 2ZXIA 2N7CA 4DR3J 2PFDA 1CBKA 3S1TA 3GILA 3ZR8X 3K70D 1MNEA 2ZCWA 4PFPA 3L09A 5HQLA 2WY7Q 2W01A 3R4KA 3I4MJ 3NMAA 4DFPA 1IKVB 1SD5A 2BX6A 5LT5A 2QX0A 2HNZB 1WI9A 4JI6J 4NCAA 1U1QA 1UA1A 1WTFA 2OPRB 4PYAA 4ZHRA 1IVZA 1IUYA 1XIQA 5GAEJ 3BJ6A 4A69C 3G8SA 3OYCA 3N0VA 1RAGB 4K2XA 1YS7A 1ZPWX 2DAOA 2HPMA 1Q5VA 3W2VB 1UG2A 4NC7A 3IWLA 4RLQA 3MM8A 3DV8A 2BW3B 5IT9K 4LIUA 2CJYB 3HDSA 3WHCA 4N77A 1JJCB 4IO9Q 2QT7A 1J2VA 3HZEA 2F48A 1OPCA 2FGCA 4L0YB 5KFUA 3RBZA 4RWXA 1X31C 5FLXY 4OV1A 2V4JA 2EFVA 2A2CA 1P9YA 4JV2A 3FZ2A 2ZJQF 1EH6A 1TUWA 5E3AA 1ZA1B 1K7AA 4CYCA 2N4DA 4C8YA 2EILH 3HTUA 3HGYA 3BTCA 1TQIA 3HUGB 3I55S 3CDLA 3OTEA 5FFXA 2YU3A 2K7JA 2LR8A 1K6YA 2H4WB 3A4TA 1BWEA 1TKDA 3QU3A 2HVHA 5KFEA 4NLSA 2J5OA 4FYYB 2ZOFA 4KYZA 3EPGA 1IRZA 3F8NA 1U8WA 1CF7B 1FXDA 2DH7A 2ZXJA 4I01A 2F2EA 1HWUA 5KTQA 4DDFA 2KIQA 4P2MA 1QHGA 5CYJA 4OIRF 3C46A 1MMNA 4DZPA 4NX9A 4K4XA 4Q0BB 4AU7A 3IM8A 5EWGA 4ZLLA 1KU7A 4PJLA 4F4AA 2EV6A 2BY2A 5GMKa 5KVRA 2RAEA 5KFDA 3H4BA 5L1KA 1B7YB 1FE4A 5F8MA 4PYDA 1S6PA 1HKTA 4BDPA 1HBOB 4I7FA 1XGSA 5E3OA 2UV8A 4ECQA 4IHSA 5FDLB 3H20A 4RL1A 2HMIA 4ZPCA 3SQGA 5I3UB 1TWCJ 3PX6A 3JSMB 3MURP 4CNZA 2F5DA 2ZNZA 2DISA 4OX9J 2HGCA 5BXIA 2NYHA 2LDIA 4LQ9A 4M6VA 3QIPA 1YBTA 4FF2A 1G3WA 2N8GA 2B8QA 4ILMA 2VL1A 4A8WA 2B4VA 2NSCA 3VGVA 4DGWB 2BE7D 3F3XA 2MQLA 3VCDA 3M6XA 1JJ4A 4DI6A 5TISC 2ATCB 1G59A 3SFGA 4DV6F 4OI3A 4NNJA 5KFLA 2OP5A 4D7NA 4MO7A 4X66J 1C1CA 4XDCA 4BS9A 2X1EA 1T9YA 1D5VA 3J80K 2XF7A 2AKWB 2IA2A 2MKSA 1IN5A 1EH8A 2AEJA 5DRKA 2RS2A 1WZ2A 2DTZA 4I98B 2PC6A 2E71A 1ZH5A 1EF4A 1HNIA 1D8KA 4YRVA 1JLEA 3P5BP 3I58A 3CB4A 3FVYA 1YRTA 1UFKA 2H09A 3VFZA 1RU1A 2KJBA 2MFZA 4B43A 2DT6A 1BW6A 3AB4B 4Y17A 3FJ2A 3ZOBA 2O6GE 1GMWD 1TFWA 2D2WA 1ETWA 3FZVA 5J2QA 1N5VA 4RDUA 2N4CA 2KPMA 2XMVA 3SYZA 3UE2A 2J6SA 3QO9B 4USHA 1HNWF 3ABKH 4UQGA 2G9WA 4YN3B 1VOMA 4CDIA 2E7XA 2LKSA 1NK8A 4X65J 3OV7A 4PAAA 5HMYA 1OO0B 3H5AA 3FEYB 4AUXA 5ILUA 2EZKA 3MEXA 3GTOJ 4DV5J 1PYOB 2QBYA 3MAQA 2R5YB 2XGPA 3KP3A 5K1YA 1U1RA 4A3JJ 1XGMA 1QPIA 2PJRA 2KFZA 3KLGB 5KFCA 3MECB 2MW8A 4IOAF 1RT6A 2DEJA 5L1LA 1RESA 1XERA 3DN9A 1YE9A 3M30A 2WSEC 5ETNA 3ZRGA 2VJUA 3S01A 2ZM6F 3MM6A 1QAIA 2DOFA 2QA4G 4RW4A 4ZP7A 1AYEA 1OCPA 2L7FP 4NA1A 3OL4A 3GX4X 3FISA 1BHNA 4F0KA 1SMYF 1ULRA 3KJVB 2IC3A 2KT0A 4U88A 3KLHA 1GHCA 3DOLA 2ZE2B 2HHUA 2MPUA 2BY1A 2ECCA 3JCUC 5IM0A 4ANCA 5EGYA 5HLFA 1FWPA 3DM2A 4EFAC 2E19A 3V7SA 2RQKA 1PYSB 3G2BA 2BOPA 3HOWJ 1B64A 3BBBA 5CYMB 5HP1B 2XMAA 1D8JA 2XMUA 2WSCC 2F4FA 2MY7A 1CJUA 3I71A 3CCVS 1Y4ZB 3A8KA 2R0QC 3BN7A 4Y2AA 2CRLA 1T56A 2XY7A 4HYEA 3EDRB 3GG1A 2A1BA 4ITSA 3UPFA 3I32A 4M5GA 5EGOA 5H1SV 2RB7A 5IV4A 3M2UB 2FNPA 4UUTA 2QV6A 3QRQA 1BI2A 1SC1B 2OD5A 4AYBA 4YFUA 3VV2B 1FFGB 3NS5A 1BJZA 4H4KA 2M9HA 2XC7A 3GV5B 3LSTA 1R31A 2OIHA 4LT6A 1MDMB 2WVCA 3OVSA 4RNFA 1C0WA 4LG0A 1HQUB 2FY1A 1XNRJ 4UZBA 1I6HJ 1IBKJ 1WUUA 1HPZB 4ZJLA 4HYKA 5LMNJ 1PC5A 2J6UA 4NMLA 3NQOA 2KIFA 2H5JB 4KYWA 2Q0OA 3BV8A 1C2PA 2P5LC 3OIOA 3EXCX 2HYIB 1A5JA 3CJKA 3BT9A 5KFGA 2WWYA 3QPIA 4RAFA 3GZNB 4JI5F 4HI2A 5KT4A 2OCEA 3MZIA 2ILYA 4PZVA 3MD1A 4EBCA 3JXOA 4ED2A 3IC1A 1SQEA 1MH3A 2DR7A 4GO5X 2OPPA 1PKUA 2J7UA 1TL5A 1OCZH 4RMNA 4YR0A 1S1TB 5B0CA 5KFXA 1ETXA 1TQMA 3H2LA 1XGNA 1MU2B 1MMLA 4BE1A 2X7IA 2ZNYA 3IWFA 2PMZA 3JSYA 2Z56B 4P75A 2J7WA 3KUHA 4X4UA 1RHJB 2UUBF 4BBYA 1KS2A 2HQGA 4C97A 4QIEA 1W5TA 3EETA 3HOZJ 2HZCA 2NVQJ 1T0TV 4PUOB 3CZ6A 4ZPVR 5HMZA 2C3OA 4LLGF 4LF9J 1O3RA 2FVRA 3RJMB 3WU1B 2V69A 3MR5A 1AW0A 2A6MA 5CCMA 1X1CA 3S14J 4HNVA 2DNLA 3PYGA 3R6GB 4C8KA 4IRDA 2IS4A 2PDAA 3IH3A 2ZKTA 3FKIJ 4TLQA 1FBQA 2WRMA 3M9AA 3VF0B 3PJXA 2XI3A 3M4OJ 1HF0A 1HBNA 5JLXA 1U1KA 2JSXA 2VT3A 2XB2D 3L2QA 3A02A 4JB8B 1G3SA 3K1MA 3NWTA 1GMUA 4UOGA 1I39A 4K4WA 2WAQN 3CUOA 3R2CJ 2VPZB 3LGHA 4OX7A 1D0XA 1M5KC 2CXEA 1PYVA 4B3SF 3CCJI 3ZQHA 3H1CA 2HQAA 3AA8A 1C4AA 3HVRA 1SQGA 3HT0A 2NCKL 1VC5A 1O57A 1IWAA 1MH4A 1UVKA 2DNNA 1FRJA 1TVRB 2MTLA 3RKYA 3MD2A 2D1HA 4B1RA 2MA3A 5JVGF 5J2MB 3TW7A 3R8YA 1J9IA 2K06A 1E6VB 4CM2A 4UUXA 3HOYJ 2XS7A 3LP1B 4JI0F 1S1UA 3CCRI 5F6FA 4GCVA 1LE8A 1WRJA 3BCBA 1LXJA 4MEYF 1WJ5A 3JRHA 2EW9A 4U7UD 1VHIA 1XTZA 2GC8A 4HEA9 3H98A 2CPYA 3MCNA 3WHBA 4DR1J 4LBHA 1XMOJ 2UXDJ 5LSRA 4WBFA 5D3GB 3ZTQA 4IF4A 4F4YA 4G94A 2LLKA 2J76E 2DNQA 5JVHQ 1TMJA 2BV3A 2L02A 4DIQA 1S29A 2HAFA 4EJOA 4QOTA 5K9FA 3TARA 3MMYB 1R00A 3OW2R 3HRUA 2HFSA 1UELB 1EJ7L 1TKTB 2Z8QA 3IWXA 1KOOA 3B4DA 5L46A 2JN6A 6FD1A 7FDRA 2JVGA 3I4HX 3H5NA 3AH6A 3HXMA 3MPDA 3NS6A 4U7CA 2KG0A 2RVJA 2WVDA 3H8YA 1FY7A 1YSJA 3G1OA 1FYKA 2W4CA 3E6BA 3PJRA 4P73A 1VBYA 3C14A 5KFPA 3B4MA 1BI1A 4PFOA 2JJ4D 1V5IB 4WFBQ 4B3TJ 3CSKA 4CO5A 2DRAA 3ISZA 3O1LA 2HQIA 1W7PA 4K0KJ 4DQIA 4K4SA 2F8HA 2WAEA 1VGYA 2HGNA 1OR7C 2GVDB 1ZYQA 3D2WA 5IY5H 3W5YA 3L2RA 4DR4F 4DCOB 5AJ3J 3WZ0A 1K0TA 2ZSIB 1B9NA 1R5HA 2CPHA 2Q1ZB 2FMYA 2KHMA 3PCOB 2G0EA 1HL6A 1XSDA 2WB4A 2VQFJ 3R60A 2DK8A 2JC1A 5DM7F 1S99A 2JEIA 2VJJA 5A8WA 4EATA 3IRWP 1TQPA 3V42A 3R6LB 3JAMY 2KKHA 5AE1A 1S9EA 4M5DB 1P7IA 4URGA 2OSRA 2XGEA 2VQHA 3F8FA 3V6DA 2ELKA 4PZJA 1RKTA 4LSLA 3OL9A 3N4MA 1OY6A 2KZGA 2WOMB 5EWEA 5KOXA 1TBXA 3WGIA 4JI1J 3C8YA 2LRDA 4EV0A 1H73A 4OAYA 2W7PA 3QFWA 5A2QZ 4LF2A 3OL6A 1RAOA 5LXRA 3TUIC 3NMRA 1XMQF 4DFKA 2P9GA 2QUFA 2H4YB 3AB2B 1JK9B 2J8AA 3GPAA 3I54A 3K5OA 2HFZA 4X64F 5LFAA 3EDPA 1S4EA 4HHJA 4NI2A 1TL7B 3D67A 2OMOA 2IY5B 1IXKA 4NLXA 2R8IA 4MFBB 1NJYA 3M8JA 2HEKA 5D78A 1IO2A 1N6QA 3H2UB 5DG7A 1Q5YA 1D5YA 1FK9B 1TNSA 2KJVA 4HH1A 1QVGR 2CPIA 2JSCA 1G4DA 3BG7A 2V0NA 1IXSB 2AJ0A 1QUVA 3MUTP 4FS2A 3PSIA 2UXCF 3FXMA 2F5EA 2LXFA 3I87A 1OR7A 5J6XA 4B9VA 1CJTA 2LKXA 5D6EA 3WTZA 3JRDA 2PMHA 4TU7A 5IOYA 1FD2A 1SB6A 1YRXA 4A48A 1SL0A 5KG4A 3V8LA 1SIWB 3DRXA 4HQEA 1MROA 1S9GA 5GP9A 4QYRA 3P45B 1DDNA 4QCLA 4ES3A 1D8ZA 4MKAA 2CQQA 4LFAJ 3GO5A 4LK0F 2NXUA 3ZN0A 3VGSA 2QCOA 4L9NA 3L7PA 2W1BA 2HHSA 2CA9A 2HG4A 2D3UA 3JSRA 1F43A 2ZZNA 2IJNA 2VFTA 3V81B 1UVLA 2QSFX 2RHQB 3RAMA 2DQRA 4DQSA 2VPXB 5C24B 4IKFA 1DLOB 4ECYA 3KKFA 4HACA 2IJRA 1G6BA 3RYLA 1Y0NA 4BEHA 3BROA 3W6JB 4U8VA 2APOA 5LBQA 2RREA 3M32B 3HL2A 2FJ1A 4UZCA 2Q8KA 2K86A 3B6AA 3IP4B 4HA8A 2E29A 2IYGA 3DNCA 3QNWB 4IDKB 4NEYA 4IZZA 3MPYA 1SMTA 1KU9A 1U24A 2BANB 1R49A 3WX8A 4Y33A 1RRJA 2Z9OA 3G6YA 5LGUA 3QOEA 2Y31A 2PMWA 4Y52J 3KDNA 1HBUB 4F7ZA 4HZFA 3AG2H 2CJ9A 4DPOA 4QSHA 3GTJJ 4B3AA 1ZM9A 1N8RT 3GZ6A 1ETKA 3MR6A 2QFIA 2VT2A 2WY8Q 1BD6A 1AZSB 1TNTA 2D3O1 5DDGA 4CA0A 3DBHB 1R23A 2BBYA 4IO9F 2H1YA 4NXMJ 2MABA 1VNDA 3HMJG 5HQMA 4ZYHA 2UXBF 3K7AJ 2KHCA 3G6XA 2FE3A 1U26A 1V5FA 3ZMVA 4BQAA 1FDNA 4F91B 1O8BA 2K2PA 1UB9A 4CCJA 2R92J 4NCGB 5H9FK 2QL9B 3LQQA 2W4PA 4OYMA 4RBOA 1UCNA 2NXJA 1S0NA 4DX5A 2R7SA 5L9NA 3GTMJ 4Z7YA 1T03A 3PTWA 5HVQC 3ECOA 2NAZA 1MMGA 1OQ6A 3MAAA 1HI8A 2AZ1A 4RGSA 3KZYA 3KHLA 1LUJB 4AQYJ 3T6JA 2EBGA 4IYQA 1Y11A 1VQMI 2P6SA 3K5LA 4N8OA 1IM6A 1NK3P 1TELA 3S3NA 1RT1A 2WZ1A 5GADJ 1RWOB 1G1XA 3SDEB 3BO2A 4E70A 2DIVA 2HZTA 5L9XA 4NCBA 3HHEA 4M5MA 3MEDA 5J1YA 4C3IJ 1FE0A 5T14A 4CYDA 2EV5A 1BR4A 2NVYJ 1GXQA 2RF2A 4M3BA 3MPUB 4Z2YA 4I1TA 3QT5A 3CCLI 1UA0A 2HFNA 1SUQA 3KK2A 4XORA 5E17F 5J4VA 5M2PA 1VI0A 1IBLJ 4AE5A 3HZJA 2XIGA 3HXLA 4RKUC 2EIJH 3UN5A 4ZVRB 4Y0FA 2OUMA 1ZRDA 4RS8A 2MHEA 2DXDA 1HI0P 3Q9SA 1CG2A 2DNMA 2FHJA 1B8IB 1FEXA 3B73A 5G4DA 1AU7A 2IA1A 1TZLA 3LNQA 4ESJA 1N5TA 1GXPA 1PJ5A 3PW7A 3J7AN 2DD8S 2L9NA 3H90A 2EVZA 1T02A 1YW7A 1IN7A 1R22A 5CAAA 3VALA 2W8KA 2YSRA 2VKDA 1DTQB 1WG1A 4ANJA 5B0FA 3SBMA 1DURA 4IJAA 4TN2A 2CWEA 1QHHD 1BWVA 4R1HA 3FRYA 1REVA 3DEUA 1XPXA 3LA3A 4L6V3 4WTOB 2HVEA 4B3MJ 4B9TA 3A8EA 3RI4A 3ZZPA 4EBDA 9ANTA 1V5GA 1XR7A 1SAUA 4DQRA 2Z16A 3G82B 2DPJA 1B0PA 4E6KG 2CQNA 4LK1F 1GMVA 2HS3A 3DRSA 5LRSA 2PD1A 3BN4A 2FJDB 2YKOA 3FMQA 3GJRB 1ETYA 1IJFB 5GAHJ 1JLBB 2DGUA 2IEKA 1HKSA 2EQRA 2DHAA 4PWDB 1IR2A 2VJ4A 5A2QU 3M8ZA 3NOCA 5KT5A 2YWWA 2EIMH 3CF5Q 4D5CA 4R8UB 3K4CA 4YEJA 4A8YA 3HSEA 5LXYA 3WE3A 3CCUI 1ZYRF 3SEQA 1CULA 4HSTA 1RTIA 1S79A 1J0RA 1VFCA 2MKHA 1FTTA 2RNEA 1Q16B 3DFEA 3MMBB 1W0UA 5HBMB 1WD6A 3CD6S 1T95A 2WHOA 2M30A 2PN6A 3BZCA 1MBGA 4M5LA 2BZ2A 1SFKA 3ZGKA 3SFZA 2E1PA 1RHKB 2RE1A 4RZRA 2OFGX 3BG3A 1RAJA 4EI2A 3BPDA 1IW7F 3F0CA 2ZKZA 1JNZB 4WYWA 4Y6IA 5IWAF 3MUVP 5KAFC 2JFKA 2XROA 2NXCA 4DV7F 1LB2A 2CV0A 2V9WA 1Z91A 1MG7A 5JI6A 4NC6A 4O3SA 1SC3B 1JQGA 4KJZA 1FBUA 1IN6A 2Y1RI 3GIIA 4DV2F 5L8RC 1D0YA 4Q2MA 3MXHP 2GS8A 1RUNA 4A6DA 1VQNS 3QWPA 3EUAA 3V4IA 5K7ZA 2XHWA 4I99C 4ECUA 2M2EA 1IXRC 5J1NA 2DIUA 2Z99A 1TLHB 1Z21A 3SXYA 2DGSA 2RDDA 3P3DA 2VQCA 2L9WA 2DOEA 2PJPA 1K6OA 4HG2A 3OYKA 1IRFA 2JHEA 2QTWA 3K4MA 3KK1B 5D4NA 3OTOJ 3U27A 2GW8A 4ECSA 3TOAA 3ABLH 3C6UB 4LIRA 4N7TA 1MJBA 3GTLJ 2E1OA 1V4RA 1REGX 1ZM2A 4FDFA 1RYRA 5CQGA 3W61A 2DTJA 1GXLA 3BS9A 5HS8A 4QWCA 2OF7A 4WXDA 4XM3A 4J9RA 1MKMA 5BMZA 3ECHA 4EJVA 1Q1KA 2UV8G 4UB6C 3ZFVA 2M45A 1UHMA 2HQCA 4HHUA 2VKRA 4ZK7M 1HNWJ 4RWWA 5J2PA 5KT6A 2KKOA 2QL7B 3B6CA 2O7OA 2F4IA 3DDKA 1JKHB 4XOTA 3TUZC 1S0MA 1HLWA 2LOOA 1FMVA 4TNOA 3CCVI 2IM3A 2OSQA 1REPC 3BZ6A 2XEXA 3M1VB 1D9DA 3RUBL 1M90T 3U1KA 5L3DA 2V1UA 1FTZA 4JYAJ 3DRRB 2HHQA 1SI9A 5AIPA 1NHVA 3R2DJ 3P9CA 1X0FA 4JI7F 2HXIA 1WC5A 4BHQA 2B63J 4DSLA 1UVIA 3A4CA 1JUMA 4XKVA 2V67A 3CVKA 4D7MA 2ZM6J 2QYGA 2VBZA 3TX8A 3G6ES 4LFBF 4DOZA 1XGOA 1H2UX 2ALYB 1USTA 2J0QD 2M4MA 4LR9A 4LMYA 4UUSA 1HWLA 2GZWA 3L7WA 2W9BA 3DYAB 2E66A 3J7ZT 2V94A 1VCTA 1RISA 5LHHA 3MI7X 3V6KA 5HMWA 1VQPS 1ZELA 1OYDA 4Q45A 2FTRA 2W7AA 1ZR2A 1LDDA 1NDKA 2LF8A 5FKOA 2DMTA 3GE9A 4O3OA 1Z7UA 1NK6A 3OYHA 2G2ZA 1KU3A 2EKNA 4MAKA 2WAQD 2XNQA 4DNCA 1O0PA 2DOAA 2RRBA 4NZ7A 5FJ4A 1X4OA 4BE2A 2X6YA 2BM1A 3N6MA 4LBIA 4YIFA 1JLQA 3MR2A 1BQXA 4K2EA 1FZPB 3IRXA 1R6RA 3L00A 2L41A 3N6NA 1WWHA 2DITA 5F8GA 2VE8A 2RKIA 2HNYB 3S8SA 1Y10A 2M0CA 4ZHRB 5C3EJ 3H2VE 2W2PP 3V7RA 1JUPA 4XN0A 3GYXB 4RNMA 2QJ3A 1WCMJ 1BY9A 4DJBA 2R7DA 3DP7A 1LFUP 3MM8B 3FBNB 3ZXSA 1IXCA 4NYPA 5KFTA 2ADCA 3L4BC 2CFOA 2H6CA 3CJ8A 3EJMA 2Y0BB 3G1MA 3E01A 2G0IA 3G86A 5C42A 3OS1A 1YRNA 1X60A 3EDQB 2F5FA 1UWBA 3HVAA 2M88A 1XC9A 3I64A 3EYZA 2V4JB 5KCMA 2QVOA 2UU9F 3K4NA 4KIBA 4YB1P 1NKBA 1KZHA 1UMJA 2IMOA 1DPRA 2DFHA 1BN5A 2DMNA 1NKCA 3MKLA 2P81A 5HAOA 4M6YA 2ZKUA 5CVVA 4Z6YA 1TU0B 3QSYB 3ZNJ1 2AJFE 4CYCB 4C0BA 3TW6A 3QATA 2KJCA 4RAGA 3RAXA 3HJFA 5GMEA 2GNKA 1FEEA 1FSHA 5A2QK 3KHGA 3KP6A 4DFJA 2HQ5A 3JSOA 2A6TA 4UY8T 3P7NA 1OPIA 1RA7A 3BYPA 6FDRA 3C3LA 5HS9A 4ZYAA 2UUWA 2BW2A 2KRHA 1Q7YT 1R1TA 2JTVA 1KBRA 4OYBA 4DLEA 3GFIA 1PSDA 4BS2A 3PRDA 1JLAB 4P55A 1WG4A 4C9YA 4V2FA 4DYCA 4FE7A 5B09A 1JUSA 4PQUA 4C3HJ 4RGRA 3KLNA 2M4KA 1V5EA 2FLOA 4PPZA 3GONA 2HZAA 3H3ZA 2XMMA 3TW0A 4PGGA 4LF8J 5GMDA 2XRNA 3CO7C 5KG0A 1G2HA 1S6PB 1H38A 1NK5A 4H4MA 4Q8FA 2H54B 4AIKA 4MK8A 2FUG2 2HWTA 4K2JA 1K0VA 3P4UB 5DJBA 2HMIB 1Z77A 3SQGB 1Q95G 1WKJA 2W2MP 3Q86A 4KFBB 1H2TZ 4LF1A 1JLCB 4WFAQ 3MFIA 1GT8A 2O3DA 2HBYB 5KFHA 3BGRB 3LSRA 4NL5A 2WV0A 4NLOA 1BI0A 5TJJA 3F23A 4JP0A 3BM7A 3QIPB 4HV5A 3AD7C 4IXAA 3SSQA 2C3YA 4ABZA 3IWZA 3DRPB 3QYYA 2YS9A 1CJKB 4XK8C 4XPCA 2XB0X 2ZBRA 1ZM4A 2CU7A 4AYBN 1NH3A 4HF2A 3T0YA 1TKZA 4CCLA 4JI0J 2UVUA 1B7FA 4HNUA 4DSIA 2DPUA 1ORKA 3K4BA 3MKWB 3JSBA 2D45A 1LWEA 3H5UA 3FM5A 2AXTC 1APLC 2OJ3A 1C1CB 4AL6A 2GAHC 1KSPA 1LQ9A 4MIWA 2MD5A 2VC0A 4AIDA 4XLAA 3DXSX 3LAMA 3LOCA 8RUCA 4FCYA 4L18B 4LOCA 1HNIB 4DPTA 1DRZA 1XNQJ 2KT5A 1UW4A 1RABB 1JLEB 3EGZA 3W3CA 1VIOA 1R4MB 3VZIA 5K14B 1ZAOA 3HSJA 2XSJC 4M71A 2WADA 2M7AA 3H92A 4UNOA 3Q22A 2GOXB 3HJVA 3TP2A 1F3VA 2QZ8A 2VG6A 4JI3F 2YBVA 4UTGA 5A6PA 2XPUA 2RV8A 4BGDA 1OISA 4XL9A 2I8DA 3NXZA 1MGTA 4GO1A 1QUPA 3EWGA 3R5DA 4H4OA 2B6AA 4LFCF 4DR6F 2GXGA 2M0MA 3H4DA 2IBKA 2QBYB 5K5MA 2ZFHA 3CNQP 3JTGA 4DF8A 3MCOA 4ECRA 2B4OA 2PJRB 1SJFA 3TP3A 1Q1HA 3BR6A 3TMOA 5B0EA 2GJFA 2MMYA 2KRBA 1QVFR 3Q23A 4U67Q 4IO1A 1RT6B 4NLVA 3VYRB 4PR6A 1POGA 3TP0A 3GXOA 5ERIA 3SQOP 5DS7A 4RO0A 1S7EA 3OWTA 2JPBA 4RW4B 1VQ9S 4N9IA 3CP8A 5HROA 2AT1B 2OC6A 3BQZA 3O2IA 2IC3B 3CCWA 4G3IA 4I6YA 3KLHB 1N25A 5HLIA 3DOLB 2W2NP 3QLHA 4WFNQ 2O0YA 3S32A 3GTPJ 2Q66A 2AJQA 4I0WA 2WK4A 1X0PA 3RJPA 1R6VA 1N34J 1YIOA 2VE9A 2AS5F 2JLFA 2R2TA 3EGWB 2GAGC 3C1DA 2JNJA 1U2RA 1A31A 4ECXA 4A8OA 5A0YA 3FDYA 1XBWA 2O67A 3CT9A 2DKOB 1D9AA 4ALZA 2JRMA 4C11A 3O3KA 4PWUA 4TVAB 3I96A 3LP0A 3PEHA 2OO4A 1MBFA 2O01C 1YQHA 4A46A 4LF6J 4MEXF 4OZ3A 2ZH9A 2XSJA 4QR2A 1H9GA 3GIKA 1JI8A 2X4HA 5EGOB 4X2BA 1I94J 2HNHA 1J2XA 2ZOGA 1VQ8S 2RDJA 4C3JJ 1XMQJ 1RU2A 1NMEB 4CCHA 2CSOA 2JX2A 2L9RA 4QIWN 1ONVA 2IVMA 3HOVJ 5A76A 3N79A 2CYYA 5E3MA 1TKXB 3PKMA 5F64A 2AD9A 1FT8A 2FOKA 2RH3A 1DTTA 2ZBKA 1HD1A 5F3TA 2BKOA 4R0JA 4IQMA 5F0CA 2LVWA 1IG7A 4EM1A 1R89A 2CJBA 2M2BA 1SCJB 4WCGA 3KUGA 3PNIA 2UXCJ 3TZYA 3CJKB 4DBQA 3Q2TC 4ZPBA 2DH8A 4DV1F 1U1OA 1F1BB 3CCES 3E97A 2HKXA 2LC2A 2JVRA 1FPQA 2GXAA 4DX6A 2XY5A 2B0GA 4A4JA 2H94A 2B43A 1M1EB 3D0GE 3FXQA 4TY8A 5KFFA 3KG1A 4G7HF 2BE5F 1IM4A 2MZTA 1CEZA 1KQGB 2XS5A 3W66A 2W4DA 3I5CA 2WW4A 2YKNA 3BPVA 3QT8A 2W2OP 2DR5A 2JLGA 2HQNA 4FYXB 1UAWA 1U1MA 4BNCA 1QTMA 3A8IA 1FESA 3THTA 4EO8A 4DR7J 1BW5A 3GV8B 1IJEB 3GV7B 4DQPA 4FYVB 3UD3P 3NEKA 5L1JA 1VQSA 4NPOA 4NA2A 5BPDA 1QA6A 5DYMA 4BQNA 3PW5A 3GJTB 5EJCA 3S16J 5DUIA 2OQRA 4PJMA 1E0EA 2LY9A 4WFYA 5KT7A 2Z57B 1JT0A 3D5LA 4WXOA 4M9ZA 1X5TA 1ZK8A 2CW8A 3HO1A 5M5XJ 3HRSA 4I2QA 2X1CA 1IN0A 1RTDA 1R0CB 4WU3A 3I6PA 4RM2A 1P4XA 2UVRA 2V2QA 1HBNB 2MZRA 5IC6B 2DGTA 5KOWA 3MAJA 3M8PA 2DVIA 3FUYA 4CLTA 2VI6A 3ENVA 1X4CA 4QZVB 1B9MA 2L0KA 5T7LA 2B56A 5LM7E 2BEFA 5CVUA 4QW9A 1U0SA 1U2WA 2WV1A 5F04A 3HPHA 1ICEB 4ED5A 1MWQA 2JT1A 4X1EA 1H88C 1HDPA 3M2RA 4DR3F 1YLFA 2GXBA 1AT1B 2DGOA 4PSWA 4OHYA 5M2UA 3H42A 2FJEB 4BXXJ 2R7TA 3WIUA 2ASYA 2B9YA 4R0EA 2F63A 2POKA 4P5OA 4BJ5C 3GFXA 2K9NA 1DAXA 2J6TA 2X51A 4HX8A 4ED8A 1WOSA 4B08A 2OPSA 3HD1A 4V2GA 1S1UB 4HDUA 4USWA 4OOIA 5DO2A 2GQQA 4GO7X 1LE8B 4ZVEA 4JI6F 4NUBA 1U6BA 2QF7A 3BDDA 1W0TA 1FNNA 3NBPA 3LSJA 1D3YA 4ZDNA 3K4JA 3RPUA 4RBUA 3BQYA 1XEZA 3UO0A 3DKXA 2Y48A 4XLEA 4WE1A 2B9WA 2O8KA 5HS7A 1HBMB 4ZYGA 1JT6A 4PWWA 2E1CA 1P6RA 2OPQA 3ZZTA 1GX5A 3EGNA 3Q8SB 4ELVA 4GFBA 7AT1B 4JUZA 4HBLA 1AFIA 3CF5F 3UDVA 4DG1B 2KMUA 1UZDA 2QL5B 3KLIA 3I4PA 1JLFA 3J7A1 3HD2A 2ZDPA 4F3MA 4Y3OA 4BXFA 2LEAA 3J81U 1EQMA 2L3MA 1NJWA 4PJNA 3C14B 2RQMA 1Z67A 1RT5A 2V7FA 3Q8VA 4L9JA 4M3GA 2B0LA 4DPWA 2BRKA 1Z3YA 2Y1IA 4ZZDA 3QPTA 4ASNA 3BLYA 1S1XA 2NZCA 2RQPA 3PQKA 1LEOA 4HLXA 3AOBA 1RACB 3C2PA 5BQTA 3AG3H 1W7PB 3PL8A 3SYTA 4YFKF 1PUFA 3OBIA 4GRIA 3MKYB 2CGPA 2X3GA 3NG8A 1NSKL 1N5SA 2EK5A 3ENAA 3IG1A 4NLQA 3V7CA 4A3DJ 2MBFA 1FYMA 5ETTA 2X1FA 3NGRA 3TQNA 1IQTA 3FK4A 1FRMA 1YJ9S 5GTHC 3IAM2 5CXTA 5IFMA 1KYWA 1TAUA 3AAFA 1DGWY 1PJRA 4IRIA 1ENHA 2I1RA 4EZ9A 1DBDA 2ZDOA 3KLVA 1J5EJ 1TTHB 3IBFB 4U0WA 4O44A 3VHQA 4DPXA 2HW3A 1H7WA 4OJ3A 4LF7J 3KK3A 2R7WA 5A8WB 1S7AA 3W64A 5ILVA 5J1UA 2UZAA 2LP4A 3L2WA 2KI2A 4MIBA 3QP6A 1YFHA 1Q53A 2CW0F 4EYIB 4E8UA 3HPGA 4MFDA 5AIQA 5HO4A 1A04A 2RAQA 4ELTA 4Y15A 2YVSA 4LSLB 4AVZA 2D3ZA 5C7PA 5I4MA 3P9IA 1VQNI 3R1HA 1PCAA 2XMJA 1ETQA 1X8DA 5IP9J 5EEAA 2EEYA 3OFHA 4WXWA 4RU9A 3R61A 2V9KA 2LNBA 1JXEA 3NRVA 1IRXA 3W2WA 3W5ZA 1MW7A 4A3EJ 5E33A 2CQ7A 4RNHA 2X0LA 3OS2A 2G0CA 1J7KA 2MH2A 4KC5A 1LQ1A 1WOPA 2N3OA 2NPIA 4I56A 1NSPA 2K02A 4JBAA 2GO9A 4DX7A 4ICLA 2IJLA 3VODA 2R2RA 5DDQC 4F93B 2AZ3A 1N6QB 4ED1A 4IH5A 3DLKA 2EV0A 2ZBQA 2MQMA 2QA4S 1VQ6S 1ZTWA 3GLLA 3COAC 1FNXH 1KHVA 4N4NB 3QFHA 3E5UA 1CJTB 3IS9A 2VQGA 1U1PA 2KRRA 2J9DE 1YX3A 4DV7J 3WTTC 2XAFA 3BKTA 4LQ3A 2HEOA 3N01A 4WP3A 1MROB 1S9GB 2M3AA 2KB2A 2CVIA 2F8EX 1Q1VA 2UVWA 3JRIA 1C4CA 1XTAA 5KFOA 1EA3A 4DBRA 2RQQA 3PXGa 2FJXA 4QU6A 2JSPA 4KRWA 2RKHA 1WH7A 2E60A 1PIEA 2GGPA 3LOUA 1B3TA 4LB5A 1EHWA 1SKUB 4NQWA 4HACB 4X65F 2ADBA 3OR1C 1EX8A 1RETA 4CIOA 1RT7B 2QLJB 4WK8F 3G6EI 4BEHB 2HFHA 3ZQ7A 4RW7A 3UNYA 2BXZA 3R5BA 1TL4A 1HHSA 1J59A 4KITB 2CMPA 1Z05A 3O2PE 5LJ5Y 4ZMMA 4K8RA 4ZS6A 1PC4A 3LMMA 1NK2P 4Q7AA 2IYIA 3OSFA 2FQQB 2GIQA 4KIGA 3F22A 3SI8A 2Y9ZA 4ID8A 3DLAA 2XZTB 4USUA 1WSUA 5JVTA 1ZRFA 3GTQJ 3S3OA 3F44A 2FF4A 2Q6BA 4CTAA 4WZQA 2CG4A 3EUKL 2KP6A 1T2KA 5D5UB 5IT9Z 3PHEA 5DG8A 2W82A 1Z7LA 1T38A 5FKKA 2X85A 4RAZA 2DA2A 4UV8A 3BH7B 1U0JA 3MOJB 4ZDLA 4RW9A 4TU9A 3KMQA 4OHWA 2WAQA 3LFUA 4V1Ak 5J8CA 4F55A 3CQZJ 4CCOA 4DL6A 4USIA 4E7HA 2OLWA 5A8RA 4TQRA 2KXNB 2ETHA 3FSXA 3NGUA 1TK5A 1MN9A 1QE1A 4LSNA 3BJYA 2OAUA 4DS4A 2Z5UA 1X1AA 3ZQLA 4R79A 4M6XA 3OSPA 2I10A 3KX2A 1SL1A 4E7IA 2XYHB 3K1PA 4RM3A 2KFYA 1V9OA 3AXMA 1FRXA 1DHMA 3BZQA 2BM0A 3RR7A 1B0TA 1C0TA 1NJXA 1T03B 1X3UA 4WP9A 4EGYA 3KE2A 4JV0A 3OVBA 1Y7PA 3HHNB 5KG2A 2AIRB 3HHDA 3ADAC 4ZPDA 4K5SA 1C0UB 1IBKF 3OR1A 5LMNF 3PY8A 3WHIA 1WDTA 2DXEA 4XNFA 3UWTA 4ENNA 3J81K 1E17A 4D3GA 2LEPA 3PR5B 3CJ3A 2YNHA 4FYDA 3SZGA 1BQMA 3G71S 4JV1A 4ZN3A 3CXCR 1FFWB 3AOCA 4KQZA 2FPHX 1CPZA 1QO0D 4HH0A 3DKYA 4MYTA 1R36A 3MEDB 3FKBA 1U02A 2QQBA 3D5MA 2HI3A 1DARA 2VUMJ 1EV7A 2C3MA 2A3SA 2RF2B 3HP6A 2E2IJ 2LK2A 1FHTA 2DMUA 2KVIA 2HNDB 1PO6A 4CLSA 4TLRA 2HU9A 1R8PA 1HA1A 1QVUA 2RSQA 1S3JA 1IF1A 3GUDA 4CGZA 4AYBD 1W7WA 3A03A 1SUQB 3KK2B 4UV9A 1WELA 4XKBA 2LKZA 1PGZA 4A8QA 1X4DA 2CQDA 4IOBA 3GEZA 4F8RA 3IH4A 2DGQA 3AL0C 1HW1A 3BC8A 1X7VA 3TO7A 2NRAC 4J00A 1ZARA 2IS2A 4AL7A 3QWLA 1U25A 4Z37A 4DZ6A 3S2HJ 1MLAA 4LF9F 4DV0J 4RBTA 2UU9J 4RGUA 2WONA 3AJDA 3I5AA 2I5JA 2W7NA 3UVJA 2AJ1A 1UHWA 2KTQA 2DFIA 3FCHA 3U02A 2OEKA 1X9SA 1RWPB 3LWMA 3VAFA 1REVB 3J80Z 1V55H 1YITS 4ID5B 4A2UA 4N0BA 3O8HA 4F52A 3LSMA 4G7OF 4GVBA 2HHHJ 2HRYA 3A3PB 3V5RA 5DV5A 1NPKA 2Z2ZA 3PRBA 3WC2A 2ESNA 1ZN2A 1A7GE 3ZTRA 2CJXB 3TO6A 2EG2A 3DRSB 5FROA 3SQNA 3OYJA 5DLFA 1IGNA 3OL3A 1EKRA 1QZYA 3CMYA 1S76D 1ON2A 3X3UA 3E7LA 2XC9A 1LDKB 1FCAA 1QDUB 2QKMB 1IUJA 2KL4A 3MTKA 5D5WB 4PJ0C 1A35A 5ICFA 3U21A 3UFCX 3QJPA 1D3WA 4ENMA 5JR3A 1RT2A 3WU0A 1RTIB 1HW8A 4WF2A 1GFWB 3H3VK 3HBLA 1IR0A 5HK4A 2PA8D 3RKQA 1H0MA 2IM1A 2V6EA 3I9V9 2JA6J 1X2NA 3AG4H 4ILLA 1LW2A 2KL8A 3HFVA 1OWXA 1FTRA 2MSSA 3G73A 4RB0A 1A6IA 3QYFA 1S9HA 3DPUA 4DR1F 2B7EA 1XMOF 2UXDF 1LPQA 3KDOA 4ZA1A 2MQQA 2JA2A 3K7RA 2BE9B 4C3MA 1XCVA 4G6TB 2R8HA 3M9NB 4DUYJ 4CCKA 1FERA 2Z2MA 1R6YA 1OYWA 4BWJA 2FIUA 3OY9A 2GV1A 4YELA 2MZJA 3O3LA 3PFEA 1C1BA 4ZVTB 5A6WA 2K27A 3TA1A 3RKWA 1XQIA 5FKMA 4LR8A 2CDQA 1HKQA 2ZBPA 4IRHA 3B78A 2EA2A 2EK6A 3V4IB 1FKAF 2R3SA 2A69F 5CVJA 2EA4A 2HOSA 1WDDA 2O5RA 2W7OA 2ZHAA 1Y3KA 1X58A 3TGNA 5BYRA 2R7VA 1M5SA 1F36A 4TQSA 2K9QA 4QIWD 4LIVA 2QRRA 2QGUA 3UR0A 3CCRS 4PSXA 3RBXA 1N54B 3CJ4A 2QSWA 3ZMTA 3ASOH 4K59A 4K0KF 1HNXJ 1P92A 5E8GA 2BQ3A 2IP2A 2AJ2A 3TO9A 3K0LA 4YR3A 1HARA 3BF4A 3T5XA 4FXVA 4EVIA 1DQAA 4JK1X 3H5YA 3FFIA 1FX7A 3WTVC 4OI4A 2ICWG 5AJ3F 3DGPA 2Z3YA 2RVCA 2DNOA 3NL0A 3BO4A 2DPIA 2FVPA 1X9WA 2M3DA 4JI3J 2HYFA 3HZGA 4F04B 3K5PA 1RI7A 3GF2A 3ZZOA 2YNGA 5KFNA 2P7CB 1RC9A 1D1BA 1TL3A 3N9UC 3E6DA 2CNLB 2MYFA 5F9NA 2XLJA 4MKYA 5CYQB 3G9CA 3FBIB 3KNGA 3D5SC 4UF4A 3DOKA 5DM6Q 9ATCB 2BUNA 5BJRA 3VAHA 2K9LA 3M8QA 3PIOF 4M5KA 4WKRA 2L3DA 3EICA 5A8KB 2JOQA 1NDCA 3CUNA 1VQ8I 4Q44A 3MD3A 4FVMA 5J40A 4L73A 5E8IA 5L38A 2NS7A 1HW5A 2QQ8A 1Y9OA 3GMGA 3JW4A 2K40A 3LW5C 4WXCA 1QJHA 3M8FA 4JI1F 1LWCB 2V8DA 1YJNI 3TWZA 4ECWA 3PYEA 2JLEA 4UVBA 1FC3A 2VOPA 4P2XA 4UUSB 1UKUA 5ICEA 2I6WA 3DGVA 1BUXA 3HDDA 3MEKA 3HSZA 5D6FA 4DN0A 5DGAA 3OYIA 1W1WE 2JVOA 4FS1A 5M3MJ 1UFWA 3TYTA 3TUJC 2JUGA 3CCEI 5HNHA 4E7JA 4RW8A 4URSA 3Q0AA 4ETZA 1XK8A 3VWSA 2CJQA 4KV8A 1BLUA 2CAJA 1CLFA 3RSNA 4QPXA 2XAHA 4UY8I 3C16A 3S2WA 4B9UA 3R0JA 4PK4A 2BMBA 1TWAJ 1HYSA 3IMQJ 5F1RA 1T8IA 2OPRA 2DR8A 1NKEA 1SANA 1LK7A 2HSEB 1FRLA 5IT9Y 1VBXA 2RC4A 3IV5A 2ME0A 1I1SA 3W2VA 3IO1A 4LFAF 2KIUA 2R8KA 1FX2A 1H8AC 1ETOA 3IRXB 4ER8A 1N77A 4NLUA 3N05A 3NGSA 2IRYA 2FD5A 5EDWA 5L1IA 3PFIA 4I6AA 4JOUA 2K3FA 1NHUA 2WSFC 2RKIB 4BXUA 2A07F 1SEUA 4QWAA 5DM7Q 4DSFA 1YVFA 1F2GA 2WA0A 1ZGWA 2E5LJ 3SZPA 3ZQQA 1PJ6A 2WTEA 4MTDA 2QA2A 5H6QA 4KH0B 2G7UA 2F4VJ 2GQCA 3UQSA 2CO5A 1R5GA 5GVQA 5E3NA 4YIRX 3AQOA 1R58A 1WG5A 3CJNA 2HVDA 4ZIWA 3DKDA 2JWTA 3FHZA 3W8PA 3E01B 2A68F 3T5JA 2YTCA 4JBCA 1YRNB 2LU2A 3DU6A 1QTNB 1SBRA 5IPAA 3BR3A 1YJUA 4OIOF 3RW6A 1YX5A 5J8FA 1KHWA 1KVIA 2DEIA 1BA5A 4O4GA 2BQUA 3W65A 1A9NB 2XB5A 3FK7A 3ZN1A 2HRUA 4OLPA 4YQWA 2YQ1A 1TFYA 2K3IA 3SJMA 3C7JA 2CQCA 5H6RA 3Q8PB 2M9KA 2YNIB 1QBJA 1Q78A 1VF9A 2HTJA 3IWNC 2HQ3A 5F9LA 2Q43A 1JWWA 2DO4A 2DMQA 1EARA 2IMWP 3CO0P 4IR1A 4JI2J 4I6WA 3EUNA 4DL7A 2V2KA 4N8NA 4EEYA 1H72C 2DYSH 3HFKA 5DUKA 2HVQA 3M7GA 4EMSA 2MY8A 3MCSA 3BREA 4NXMF 3RYPA 1RCOB 4UVCA 2C6YA 4ZP6A 1NJZA 4MJKA 1WGXA 3M6WA 2UWMA 1HBOA 4A8MP 2IVFB 1DP3A 1RWKB 3D54A 4M5HA 1FJ7A 4PQUB 5FDLA 4QPTA 2J0XA 5SZTA 3PO3J 1RHQB 3K59A 1RZMA 1WTBA 1VFJA 2YX1A 3BH6B 1RTHB 1VQOI 2CV1A 2J9DA 3OYLA 5CVRA 4KSEB 3PNYA 1PVEA 3TAMB 1I50J 3VQTA 1VTNC 2BGCA 4H4MB 2WCXA 3Q3SA 5GAGI 2XMTA 4AQYF 3A3NB 4DU8A 4KO0B 1K83J 2R7UA 1YI2I 1RR7A 2V9VA 4AUKA 3M8RA 3ZPLA 5GTIC 2HBQB 3J7AY 3MM5A 3ZQIA 3S2DJ 4XTTA 1PAUB 3DFGA 1CC8A 5CH7B 4I2OA 1KOHA 4XSXF 2HVSA 1K44A 1BE4A 2C2NA 3J80Y 1SJ3P 1RTJB 3W60A 1R8HA 5CPRB 3KP2A 1NXIA 1B59A 4P9FA 1I5ZA 2JMWA 5L3EA 4KISA 2JEJA 5EEHA 4U87A 1D8YA 5EZHA 1LKXA 1F9NA 3KHHA 3NAHA 3PUFA 4ETSA 1W36C 4ED0A 2BV6A 1LWEB 4C8OA 1IBLF 4U95A 2OJED 2OFHX 3IN5A 1UJ8A 2F40A 3OSNA 2HR3A 1P9QC 1N48A 2KDOA 3HGGA 1IKWA 2M7SA 1YJ9I 2ELHA 2PMUA 1UG0A 4M94A 1H7XA 3EVOA 5KAKA 5F8LA 1WQ2A 4DWIA 2DK5A 1GDTA 4DS5A 4A3BJ 3B82A 3DLLF 1ACMB 3EVMA 1H6KX 1ZG1A 1VQMS 1FSEA 3S17J 2G1DA 5HLGA 2R5YA 4U7UK 4KUMA 2VG6B 1RTZA 3JRGA 1ZGJA 3CE8A 3NS7B 3MECA 4RAYA 1FRIA 1F9EB 1FWKA 4LR7A 5AE2A 1X3WB 4H4OB 2B6AB 1MWYA 4B3MF 4P9SA 2W84A 3OXFA 2Q3PA 2U1AA 2CFXA 5KFWA 4FP9A 4RBVA 4KIFA 2XLKA 1WKKA 4CO1A 3R3TA 3FBEA 1S77D 5E0OA 4G1QB 2EPFA 4DL4A 4ES1A 2DQLA 3CJ2A 3CCLS 3E2EA 1K78A 2A61A 1R5ID 2ZHOA 3WTYC 3FQLA 3H9GA 2FHJD 3H35A 3L3CA 3WTWC 2Y9HA 3I53A 4UXNA 2IAJA 2VA3A 2HOEA 3NCRA 4OQJA 1ZETA 2ZH8A 1U8SA 2L48A 3WX4A 2X1AA 2IAIA 2ASDA 5L39A 1B6AA 1YRUA 4Q48A 4DR5J 3U1LA 2FHMA 1KQKA 4GYGA 1N75A 1P2FA 3ROUA 3QLHB 4CXFA 3FK6A 1OMIA 2QA4I 1VQ6I 3CUQC 2ATLA 4FHTA 2LVSA 5CYVA 2MLXA 1RP5A 2NYXA 2JDJA 1JX4A 3ET6A 5DQHA 1NDLA 1K1SA 3LAKA 1SJQA 1WHWA 2CQBA 3M2UA 5HLHA 4KHPF 2H5IB 4CHUA 1LWFA 4AD6A 2WBRA 2K1RA 4Y00A 4HHHA 1F4KA 4NLRA 3LP0B 3ONQA 4A8FA 4MQ9F 1RLCL 3M7VA 4TXSA 3MUMP 1FIPA 2CUJA 2XCPA 2XSJB 5GAGU 1LXNA 2G0JA 2BACA 1UMQA 3FGVA 1V3SA 2O3FA 1H3DA 3U1NA 2H1LA 4XICA 2LEBA 2RUGA 4QWBA 3RB4A 2W4SA 1SKRA 2X1DA 3OR2C 3RKXA 3IAS2 4BHBA 2JWNA 5CZVA 3K57A 2DNHA 2O03A 5K7FA 4FN5A 1N52B 1WEYA 1N36J 2HFOA 3ZMDA 4AT1B 2VG5A 1NK4A 3CCUS 2MQPA 1Z1ZA 2DHSA 3CP2A 5LJ3Y 3GG0A 1GX6A 2HK3A 3OTOF 1LNQA 3BJAA 1XWLA 4PDKA 2BJ8A 4WF9Q 1X3ZB 2YPRA 4UT4A 4JI4F 4WKYA 1RHMB 3ISPA 3HRMA 3MVPA 2GHPA 5HSPA 1F2HA 1MU2A 2EWHA 1FNMA 4QJVA 2JA5J 4OZ0A 2MQNA 1OCRH 1S7OA 4LMZA 3BZKA 3CLQA 1R0AA 2HHVA 4R8HA 1RUSA 2Y0MA 1K47A 4OX6A 3HF5A 2W9AA 1CC7A 1FJGF 3C18A 3PNVA 4L5JA 2XMKA 3PJWA 5GAGJ 4H4KC 1HW9A 3PIPQ 2YKNB 3UDCA 3CUQA 4F67A 3DKWA 2L7MP 3MZYA 5EF6A 2ZVSA 3ILIA 5EHHA 1HW2A 1XMKA 1YJVA 1XS9A 3TZZA 4A93J 1WEXA 4X6AJ 3CGIA 4E98A 2UVVA 4JYAF 2OTLS 2HWIA 1U9NA 4AFFA 2WVFA 3CW2C 3BKFA 2LMDA 2XGDA 4OZ1A 1EB0A 2GIVA 3F9KA 2I9SA 4WIQA 4OYZA 1S1VB 1KEKA 3OYAA 3FEZA 2KU7A 2NPFA 2HRTA 4I2QB 2BJ7A 1RTDB 1KFSA 1YBAA 2LF7A 3CIMA 4ZOSA 1LNWA 3OR2A 4OZJA 3TVYA 3M8PB 3NNAA 4ENOA 1YDLA 3G71I 4V19X 2ESHA 3DHXA 5J2MA 2M4GA 4ZJZA 3DI6B 4NWBA 4RUBA 1E6VA 3C19A 1NZ8A 3LP1A 5LLQA 4CO2A 5E3QA 2R9LA 2YWFA 3JTOA 3M2RB 4I2PA 5E7OB 1RB0A 2AJ4A 4F4KA 2EC0A 1VQKS 2X3DA 2ISYA 4CT9A 4DCJB 1GK8A 2ZITA 3TZXA 1BM9A 4AIHA 2L2OA 3UCZP 2OPSB 3MTJA 4A3MJ 2DHGA 3R9LA 2LFBA 4BYYA 2FJAB 2CUEA 1DU0A 4F26A 1IRGA 3PYDA 2RNJA 2A2DA 3BSCA 3NBPB 4GC7A 1O7FA 2VIXA 1EKSA 5HL7Q 4E2FB 4JX5A 4ANEA 1YKWA 3F8BA 2HQDA 2KRFA 1KLMA 3EQLF 2ZH5A 3MMCA 5HDNA 2CUZA 2ZFWA 2RQ4A 1OSCA 1YWXA 4WFXA 4WE1B 4FF1A 3D6HB 2HFVA 2P7VB 3B8HA 2EZLA 1KTQA 1QAJA 3HHLD 2COLA 5L3BA 1VK8A 2CIMA 5BS6A 4YB6A 2OPQB 2IVYA 3AFHA 3T8RA 3N6LA 1BIAA 1B99A 1EP4A 2AHQA 3FXJA 1YITI 1SKWA 4OHXA 1IN4A 1VQ4S 1NBEB 2HYGD 2DRBA 2MZSA 4HT5A 3ZZRA 1R7JA 2JA7J 4XONA 4N41A 1SL2A 1TC3C 1JLFB 2HVRA 2VQEJ 3S1RJ 1ZRCA 2FSWA 4KNYA 2P6TA 2N82B 3PG9A 4ZLJA 4B3RJ 3ML6A 2DYAA 4P2SA 1RT5B 2IM2A 1XDSA 2HOAA 2RDIA 1EETA 2BJ9A 2C22A 1KONA 3WBZA 4A12A 1S1XB 1EKEA 1JE8A 3M8YA 3TAPA 4L3NA 3POTB 4DW6A 1N0UA 1CS4A 4QPQA 1Q8LA 1PUFB 4C30A 3J7YI 2Z0GA 2AU0A 2YKAA 3L2UA 5KG6A 2IGMA 1OY8A 2VG7A 1U48A 4ECVA 2GIFA 1TK8A 2GQ2A 1RAHB 3KLOA 2DB1A 3IRQA 2IM0A 4B48A 3SFUA 4ED6A 2FNAA 1TW3A 5FRMA 5FJ8J 3T41A 1P8GA 5HVHA 4S0MA 1LW0A 2XNRA 2VKHA 4IRKA 4HQMA 4GKKJ 4NZ0A 2ID6A 3NY0A 1JHHA 4KT0C 4LF8F 5HVFA 4X4RA 3A2KA 3DC2A 4MT1A 4O44B 1D1AA 3WDOA 3SSRA 2WOMA 4IVNA 1RNLA 2XGCA 5FFZA 3TANA 4D3HA 4XLCA 1WWXA 3LWFA 5E79C 3OJUA 1FX4A 2BVLA 3TOBA 1IJWC 3AODA 1QD1A 1ITPA 2V8HA 4G6QA 2FB0A 4ZVSB 3Q0VA 2C1EB 3PJ9A 3OYGA 3NGKA 4CO0A 3PO5A 1BXNA 3E3XA 1B72A 2LYVA 3H5XA 4A0XA 5E3CA 2CQXA 1TL7A 2L9DA 4J9UE 4MTPA 2O9LA 1FXRA 1PILA 4OHZA 1FKOB 2H8WA 2BE2A 3GMEA 1SV5A 2I5UA 2BYCA 2NUUG 5K5RA 2LECA 3V2UC 3R7SB 2BEOA 3WTSC 2D41A 1APSA 4WFZA 2RNGA 2V8PA 2PA3A 2Q2EB 2QEXS 1VR6A 4LB6B 4P72A 2FYXA 2VKZG 2CQ4A 5DM6F 3HSGA 4ICLB 4TU8A 2EB7A 2OGUA 2VPYB 3OXGA 4NOHA 1YJ7A 3H25A 1O3SA 4FBUA 3W7BA 1IKYB 1NEEA 1D1UA 4RLEA 2VBWA 3DLKB 3QGGA 3SEOA 4ZITA 1JLGB 1S59A 1NTCA 4KGVB 3E1SA 3U7JA 2ALZA 4EJTA 1BMQB 1S10A 5C24A 2K85A 3K1NA 2XSDC 1AOYA 2ZMEC 1XNQF 1TV6A 2NYIA 3IS9B 4D1QA 3SXLA 3ISND 5M2RA 5AXNA 3N97A 1UVJA 3GR1A 2DDBA 4C2UA 3A1YA 4E4HA 4KFCA 1J5OB 2R7QA 1MMSA 1CQMA 1ON1A 4K4UA 1RWUA 4BY1J 3QJJA 3TJ8A 3PQJA 1VJQA 4C2MJ 4BY7J 2H3EB 4DYRA 4YIIA 3GJQB 4W4MA 4KR0B 2M8DB 2BYVE 5K8NA 3M32A 2ZXWH 2GGPB 4NYOA 5FKNA 4W98A 1YG2A 1KGSA 2UXNA 4NQWB 4IDKA 3IHUA 3QZ7A 2E5ZA 2IW5A 3W63A 2MB0B 4WPAA 2XV4S 4B3OB 4RW7B 3RBEA 5B0BA 2KRCA 2QQAA 2KT2A 5EX3A 4AIJA 3G1LA 3R97A 5KFJA 1BI3A 4WWCA 3FMWA 3W5XA 3CMAS 2D9OA 4Y28C 1K73T 2W25A 3NARA 3FXRA 5GADI 3K17A 2QMXA 2K5CA 1FA0A 2EFQA 5EUHA 1FOKA 1AZSA 4X4PA 3KYLA 4IEJA 4G7ZF 4JI8J 2Y3YA 3CJQA 1R1UA 3K9TA 3J7YU 3P9KA 3CC7S 3OYEA 1RK8A 4CTAB 5ICCA 3UCUP 4ZTFA 4ZCKA 1A0OB 1IWGA 5ETKA 4OIPF 4DQ2A 1R3NA 4M63A 1N34F 3RW7A 4G12A 3OOPA 4CT8A 5GPAA 1RT3B 5AT1B 5CD4A 2BXYA 2DJWA 1ZBTA 4PG6A 4ZVPB 2Q79A 5A8RB 5D0HA 2DA6A 2ZMEA 2LA4A 2V34A 1U2FA 1SC4B 3QMQA 1KYZA 4LF6F 2OHDA 1URNA 3D1QA 3MQ0A 4X4TA 3GSIA 3FXUA 4LJMA 3CPWR 1WJBA 3M8WA 2XRLA 1I94F 2V1NA 4Z2XA 3PO4A 2E9ZA 5HODA 3KG4A 5E1WA 2OD6A 4UOHA 4MK9A 1Z4UA 3MPWA 1AUDA 4F0HA 4J9LA 5F0UA 1BC6A 2STTA 1C0TB 3BB5A 3FEXB 3D4JA 1O5JA 4P2FA 1GUUA 4ZN1A 1O6XA 5J2NA 3WC0A 2ME6A 5IQQA 3OR1B 2EWNA 4M5IA 4CLFA 3J7YJ 2B51A 4OMYA 2YKMB 2QG9B 1WI8A 1HI1A 1NAQA 3OL7A 3QRRA 3IA0A 4Y65A 1FKPA 3KLEB 2ELJA 2DNKA 5DD8A 2YNHB 3GFHA 1BQMB 3IL2A 3UD5A 5D0GA 4UB8C 3LSGA 2D74B 1SFXA 3JRCA 2ACYA 4CCNA 3SDGA 1IR1A 1AUSL 4DUZJ 5GAHI 1X4BA 2Z2SB 1IN8A 2V8GA 2VASA 3QT6A 1HOMA 3LPYA 4FTHA 3GCWP 4M3EA 3T5KA 2VICA 3ZC4A 2R42A 4LRFA 1O3QA 4DJAA 1ZTRA 2L7ZA 2M0GB 3GBGA 1DU6A 1JJ2R 3D6FB 1BOAA 4DR7F 3O6BB 4R5PA 3H5RA 2RJZA 4CLLA 2H27A 1EAYC 2MGZA 2PQ8A 1KR4A 3DMJA 1FDDA 2VDHA 3B54A 4CZCA 1RXOB 3L1PA 3GFLA 2E35A 2M5WA 4KGZB 3MMAA 2ZFUA 2L54A 3SFIA 4KICA 2K3PA 3JYTA 1O4XA 3HOTA 3DDIA 2DR9A 4LJZF 5CKTA 5K20B 2WONB 3ZMSA 1H98A 3UVJB 2X48A 4M9SA 2M70A 5DETA 2D1CA 5F27A 4MHGA 2KZVA 1JKQC 1HA8A 4RX6A 4J9PA 2F8MA 4A47A 1FVQA 4BWMA 1JJ6C 1FRKA 3S3MA 1R8AA 3GZ7A 3SMZA 1PUEE 3MEEB 2WC2A 1H0HB 2NOGA 3G8TA 2K3KA 1QY7A 4GVBB 5GADU 2Z30B 3V6HA 3T19A 5F0HA 1U0HA 2DCEA 1WF1A 3A8JA 2IJFA 4LVOP 3P5TL 3PW0A 1FOYA 4EO6A 5TGTA 4C8NA 4LRDA 1WPKA 4IFVB 1AB8A 4PJJA 2FOWA 2ZZMA 1J5YA 4FKYA 3ELHA 4AWXB 3MMBA 3T6BA 4K5RA 5HBMA 2W24A 2ISZA 3CDUA 3M2VA 3RTRA 3ESWB 1YJWS 3FX3A 4I67A 4YDDB 2J0SD 1NUEA 1NPPA 4ESBA 3KP7A 2FJWA 1GVDA 3DBLB 3EVWA 1JGGA 1U47A 3RYRA 4O3MA 5D0RA 3F56A 1OYIA 4OYOA 5I3QA