1P9QC

Structure of a hypothetical protein af0491 from archaeoglobus fulgidus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
233
structure length
230
Chain Sequence
VSLDKAVIARLRKGGEEFEVLVDPYLARDLKEGKEVNFEDLLAAEEVFKDAKKGERASVDELRKIFGTDDVFEIARKIILEGEVQITAEQRREMLEAKRKQIINFISRNTIDPAPHPPSRIERALEEAKVHIDIFKSVEAQVKDIVKALKPILPLKFEEMEIAIKIPPEHTGRAISALYNFGGVTREEWQRDGSWICVMRIPSGMYGDLMDLLGKVAKGEALTKVLRRIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Shwachman-Bodian-Diamond syndrome protein family is involved in RNA metabolism.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein AF0491
total genus 58
structure length 230
sequence length 233
ec nomenclature
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01172 SBDS Shwachman-Bodian-Diamond syndrome (SBDS) protein
C PF09377 SBDS_C SBDS protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.900 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1p9qC02
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1p9qC03
3.30.1250.10 Alpha Beta 2-Layer Sandwich Hypothetical 12.0 Kda Protein In Nam8-gar1 Intergenic Region; Chain: A; Ribosome maturation protein SBDS, N-terminal domain 1p9qC01
2L9NA 3EXCX 2J7KA 4ES3A 4ZCMA 3UI3A 2I8EA 1N0UA 2BV3A 4MYTA 1FNMA 1N0VC 4TNOA 1U2RA 2KDOA 1ZM9A 3B82A 1DARA 3ZZTA 4ZCKA 4ZCIA 4QR0A 3E3XA 3ZZUA 3B78A 1T95A 2ZITA 4M1KA 4QR1A 1ZM4A 2BM1A 1ZPWX 2BM0A 2E1RA 2CVEA 1ELOA 3B8HA 4ES1A 2IVYA 4FN5A 1ZM2A 3OQ2A 4MYUA 2I0XA 5G4DA 3ZZ0A 2WBMA 1P9QC 2EFGA 2XEXA 1ZM3A 3LH2S 4MAKA 1VI7A 4QR2A 2NPFA 4ES2A 1NYNA 4ZCLA 1KTVA
chains in the Genus database with same CATH superfamily
3UD3P 4MO7A 4ZTFA 3NKYA 4DXLA 1FJEB 3NAUA 2IVMA 4J19A 5AXMA 4PYAA 4NC8A 3K1PA 2HZAA 4DCJB 5CAAA 1T05B 4KFBB 3L7UA 1EH6A 3W60A 3C6TA 4KY3A 4P9FA 5LBQA 4ECYA 3MECA 1HQ2A 3RQ4A 1FI4A 4ID8A 3TX8A 1Q95G 2FSWA 2EJRA 4RNMA 2NXCA 1CBKA 2ACYA 1K1QA 1VGYA 4Y52J 1Y6IA 2MJNA 2VG5A 4H4MA 1YJ9S 5L39A 5I42A 1D09B 3J81Z 4CO4A 2IGMA 4FYXB 4GC7A 1NTCA 2GIRA 4ESBA 2V94A 4LB5A 5LRSA 1KN6A 4BJ6C 3IA0A 4K5SA 3WQPA 3RZDJ 3LAMA 2OPPB 1HBMB 2UXDF 2AJQA 4HEA2 2DLLA 2UVRA 4J9RA 1FVSA 2EA2A 3ZFVA 1RWKB 3BS9A 1ZA1B 3D5LA 2DPIA 1YBTA 2OZUA 2Y0SA 3HOYJ 1G1XA 4BS2A 4IR1A 1TL5A 3E5XA 5IC6B 5LMNF 3BV8A 1FZPB 1S1TB 5J2QB 1HBOA 3J7Z5 2DGUA 4ZJZA 2X6OA 4L9VA 4XLHA 3CCMI 3RTRA 1A31A 1YTYA 1R8PA 1B9NA 2E66A 4LFBF 3I32A 3HHHA 3DHXA 5A6PA 4RL1A 2KM8C 2UV8G 1ZG5A 1H6KX 4QWQA 1KHVA 3DRYA 1RU2A 2EQRA 4CO3A 3V42A 3QT8A 4CLZA 2FU4A 5EGOB 5BS6A 3BB5A 3MM9A 2W1BA 1K78A 1YSJA 1U0HA 3Q8SB 2CJJA 4U8VA 3AJ2A 3RAQA 4P73A 3S15J 2EZLA 3L00A 4ILMA 4E4HA 3OYKA 5D78A 4AD9A 2HTSA 3OYNA 3TO7A 1G2HA 4OLOA 5JUMA 2CUZA 4ZKAA 1WTFA 4OZ1A 3NGRA 3ZMVA 5HLFB 5KFOA 1BR4A 1STZA 2X6WA 2K4JA 1HNVB 4U7BA 3WDOA 4H4KC 3G8QA 2FVPA 3JTHA 1R43A 4L5JA 4PQAA 5LGUA 4JI5F 2UUCJ 1KWMA 3UVJA 4PJJA 5DUKA 1HI1A 2Q43A 5M2UA 5A8RA 4YY3J 3S2WA 4F3QA 2ZOMA 3UWTA 1XC5A 1BW6A 5CQEA 5B7WA 5C5JA 3BZCA 3HKZD 5J2MA 4LQ3A 1RBAA 1QTMA 1JGSA 4Y65A 2XF6A 1R7JA 4QTRA 1OPCA 4P9UA 3CE8A 1ZZFA 5F0CA 1TKZB 5GAGJ 4ZYEA 3I4NJ 2CQQA 1GEHA 1RWXB 3C66A 2OQRA 5DTDA 4GDFA 4YIIA 2PDAA 2XULA 3H7HB 2EG2A 3OV7A 2KJCA 5E41A 2VDIA 1RAOA 3J7ZT 1FJ7A 3RDIA 2JZYA 3AAWB 2JC1A 4DS5A 4M9SA 2ZVIA 5ETPA 5AJ3F 2Y48A 2QMUB 1WC4A 4X65J 4IQXA 5LFAA 3S32A 1KSPA 2LFBA 3CQZJ 2EWNA 2BW3A 5E79C 2BY0A 1UJ5A 1PGZA 2IIHA 1UB9A 2BE2A 3QAHA 4X62F 2ZSIB 3Q8YA 4JX5A 2Z3YA 2RN7A 3AH6A 2CAJA 2JVOA 3DF8A 1CJUB 1GHCA 4ILRA 1XD7A 5EGYA 4DSIA 4FXDA 3GJTB 2L9RA 4RAYA 2KRFA 5FO5A 4KJZA 3OTOF 2LTPA 1LFPA 1Y1VJ 5CVUA 3HSDA 2G2OA 3OVAA 1YZ6A 4CLTA 2WTEA 2NXNB 2OAUA 3D67A 4J9VA 2DPJA 1F9NA 2FDNA 2ZWOA 3F8NA 3ADAC 4DCPB 3OMYA 3F56A 2JFDA 4EMSA 3MPYA 4NMXA 3LP0A 5KT6A 1SL0A 4X4RA 1RU1A 4LF7J 4IHYA 1HWJA 1OMIA 1AB8A 3A8EA 4P7VA 1B7YB 2QZ8A 2KRBA 1YX5A 2F1FA 2VJUA 1XMOJ 2GIFA 4G6TB 4EV0A 2P4WA 3BBCA 1JQGA 2O01C 4M5IA 3SYZA 2NYXA 3GTJJ 3A3NB 2HNYA 4CICA 2DNQA 4OZ5A 4B3OB 3GVAA 1P4WA 3NCPA 4Z6YA 3KP6A 1S1WA 1MMSA 3MKWB 3C19A 3QPLA 3A1YG 1FOWA 4A3GJ 3ZMTA 4DX5A 3IG1A 1FMWA 2ALZA 3G6YA 4JI8J 3DU6A 5M5XJ 1G4DA 2QM3A 1UWBA 2K85A 2R5YB 4YEJA 2IFXA 4HF1A 3CC2I 2I9SA 4O3PA 4PUOA 4YOEA 3CP8A 4OHYA 3MM5A 3KUEA 4NYZA 1RWOB 1ZA2B 1QVTA 5HMZA 1S9GA 5E3CA 3EPIA 2W25A 2O1PA 4HW0A 2AJ1A 5BOXA 2GLOA 2NS0A 1NSKL 2Z5UA 1ITPA 2J6TA 2P81A 4XK8C 2FRHA 2FJDB 1W5TA 5DDOC 4P10A 1M90T 4F4YA 5DS7A 3ZZUA 1KQ9A 1PIEA 1RTDA 4A5MA 4B3RJ 3OYCA 4IFVB 3JAMZ 3FVYA 1QE1B 3G4SI 2OI2A 1VQ6I 3ETOA 3OR2A 5J3LA 3PJRA 1EA3A 1M5OC 5CYQA 3RAXA 2C6YA 1IXKA 1IKWA 3DXJF 2LYVA 3SZ2A 1BIBA 5KFPA 1W0TA 4I99C 3SCLE 5ICCA 1TL1B 3LA3A 4IRGA 2ZXIA 1R0CB 2IBOA 4JV0A 4LF1A 3GWCA 1RIOH 1VQOI 2RQCA 1T08B 2KT3A 2Z2LA 5KFCA 4A8KA 5FLVA 2BQUA 1JT0A 3RZAA 3I0RB 4F04B 3PO2J 4DUTA 4ECQA 1WKJA 2EFOA 2LREA 1S0VA 1SMYF 3M32B 3WTXC 2YQ1A 1TT0A 2VQGA 4B9SA 3CCSS 1W0UA 1QUVA 3IBFB 2H4WB 3CJ0A 1QD1A 3M8JA 1S7AA 4DFMA 4U95A 3NRBA 2OV7A 4HSTA 1PCAA 2YNGB 3KPHA 2VKEA 3AOCA 2F4VF 1FE0A 5U47A 4ECRA 4DU8A 5L1IA 2MZSA 2KJBA 1F9EB 3PIPQ 2E1PA 2YU9J 4HNVA 2R8IA 1TAUA 3I3LA 2AJ4A 1T39A 3H25A 4J5OA 1WFXA 4CWBA 5BJRA 1UETA 4KIAA 3E3VA 4IKFA 4I64A 2W4DA 3HOZJ 2DXDA 2CQXA 4J9MA 2NNNA 5GMEA 2FJAB 1FT9A 4DR3J 2YPRA 1TR0A 1T03B 2BE2B 2XCPA 3J81K 1S9HA 4DV3F 3VAFA 3TYTA 3ABLH 3MMBA 4B9LA 4OV1A 2M9KA 2VXDA 3EQLF 1S79A 3G82A 3QOEA 2COLA 1HQEB 4DR2J 3I5BA 5KT3A 2Q2EA 4AM3A 2HHVA 4XN3A 3GTQJ 2HVZA 3KK2A 2DEIA 4NZ7A 3IKVA 2MQOA 5K8NA 2F40A 5CHCB 3TEGA 3KHGA 1ZHFA 5CCLA 3D7SB 5EZGA 2LSOA 1B0VA 4C2MJ 3S1RJ 2CJQA 3KLIA 3K5OA 2KISA 2G9OA 1YJNI 1DQ8A 1B64A 3E6CC 1KEKA 3H9JA 2H8RA 2ZITA 3RKQA 3LGNA 3HSFA 1I50J 3BR8A 4JB8B 3K70C 1EQ0A 2R4GA 1PYTA 3D6FB 3GW2A 1OIAA 1N25A 2EV0A 2J5PA 2UZKA 2F9JA 1KC8T 4M8LA 3D6HB 1WI6A 1K0VA 1ODDA 1GFWB 2LLZA 2Q1ZB 4PAAA 2K3FA 3W5XA 2CV2A 2LQJA 3FXQA 1F3VA 5A8RB 3DOLA 3T1AA 4KIGA 3MFHA 2WVCA 5SZTA 3BQYA 3NS6A 4P2FA 1RT3B 4K4SA 4BQOA 4ANJA 3JTGA 1O7LA 4KMUX 1JXEA 3GMEA 2HHHJ 4LF8J 1Y3KA 2L9VA 3CCRS 3TL4X 1JNZB 2DD8S 3BO4A 3VAHA 2VODA 2B7EA 5FRMA 2W85A 2A6OA 2ECBA 1R7IA 4DCOB 1Q78A 4N8NA 1QSYA 1VQNS 2M0MA 2CZ9A 4AL7A 3IHUA 1N36F 3BGRB 3L95X 5FFXA 1B99A 2AX0A 3GMGA 3R5CA 5F0UA 1HI8A 3M1CA 2MGZB 5KFQA 2RQQA 1Z0XA 1D8JA 2R2UA 4IJAA 5LHHA 4NBQA 2XY5A 1DQAA 1ACMB 1FNOA 1BQMB 1FO1A 3C18A 3QPSA 1X4EA 2MXYA 3K5LA 2FVSA 1A5JA 3N79A 4R8HA 1RT6A 2RS2A 3KK2B 6FDRA 1TNSA 4U0YA 3LSKA 1SV5A 3F9KA 4IOBA 4JOUA 3BYPA 2L08A 3ZZRA 3E5UA 3Q2SC 3BWGA 3S3NA 4I2PB 4L72B 3RRHA 4M5MA 3IRRA 4WP8A 1U1RA 1DTQA 1RWPB 4G1QA 3GTMJ 4BXFA 5A8WA 4E7SA 3JR9A 1X4OA 1C1CB 2WAQD 2JJ7A 4BH9A 1S1VB 2DA7A 3D0IE 4ZC3A 2MYFA 1FBUA 4Y2KA 2LEAA 3WBZA 1A0OB 1K83J 2H5IB 5L38A 5K5OA 1ETKA 4LBHA 4EJUA 3SDBA 3C14B 3HOVJ 4HL9A 1JLGA 2LQ9A 4CLUA 4IOCF 3RBXA 3JRAA 4DR4F 4LSNB 4WE1B 1W2BR 2BE7D 1HA8A 4C30A 2OTLS 2W1OA 3RJMB 4LF6J 5GADU 2Q3PA 5EG0A 1SVMA 4KFBA 3JAMU 3HUGA 2A68F 2LF8A 3AG3H 2D3UA 4RLEA 2Z2MA 4XORA 3BT9A 4GVBB 2D45A 2EIMH 4DPUA 2GIZA 2HOTA 2JRTA 2QEXI 5DDPC 2XSDC 4GYGA 1ZYRF 1HPZA 2JLEA 3WIUA 2IT0A 1T38A 4E7HA 3BO3A 4YN3B 4J9QA 4DFKA 4LF5J 1HNWJ 3WTSC 4PXBA 1DY3A 2VFVA 4TQSA 1MBJA 3ASNH 1HBNB 1HNIA 2YNGA 2DGWA 2DT5A 2LYCA 5JXSA 2QLXA 4WF9Q 2X1AA 2N4DA 3GJRB 1NDKA 1MNMC 1JJ8C 4CLKA 2QVOA 2DR8A 4A3CJ 3G9CA 1V3SA 2QA4S 1JKPC 4NX9A 3M32A 3K0LA 4C3IJ 2ZM6F 1U49A 3N4MA 2YWEA 1VIXA 1XGSA 1XIQA 3N6MA 1NDCA 4X84A 3CF5F 1U6FA 2FGCA 3WU0A 4D0PA 2LF7A 1NCLA 2CJBA 1T8IA 4HF2A 2RVJA 5IP6A 3NEUA 2CQIA 2FUG9 4Y17A 3OXFA 2ZWPA 3DN9A 1T9UA 3TZZA 3BP8A 4UVCA 1O3SA 4NLRA 4QWDA 4U6PA 3D3BJ 1CF7B 2FZKB 1T98A 3QATA 4AYBA 4J7CA 2GXGA 9ATCB 1QE1A 2X1DA 3DI6B 2G13A 4ZZDA 5D4PA 2V5HG 3LAJA 2QQ9A 3F41A 2IM2A 3KLEA 2UV1A 2V50A 3FIWA 2AT1B 1MSWD 3AL0B 3ZN1A 4KBIA 2DY9A 1FNNA 1OJ4A 1SFXA 5B0FA 3DYAB 2KXHA 4DQ2A 3UCUP 4E98A 3K6GA 4MHGA 3TZXA 3UN5A 4QYZJ 3FKIJ 2IRXA 5IOLA 3HFVA 2FQQB 4XOPA 2I38A 2V2VA 2X4HA 2OAZA 4Z2YA 3QGIA 4E0DA 1N5VA 3OL7A 1S5LC 2TDXA 4RNHA 2QSHX 1RWNB 1A9NB 4F92B 1RE1B 2BW7A 5CZVA 5HATA 5K8MA 2XMJA 1Y1WJ 4HPQA 3TJ9A 4NCAA 4KICA 2DNYA 4LR7A 2IEKA 3V81A 1C0UA 2ZD1A 3CUQB 3TP3A 1SL2A 3TANA 1JKHA 4DG1B 4IHTA 4QU6A 4BE0A 3OV8A 4PJMA 2M2EA 5GPCA 5J2PA 2AZ1A 1HW1A 4IG0A 2PEBA 3HX9A 2R7XA 1Z7UA 1VISA 1ETOA 5J8CA 4CO1A 2L5QA 4WKYA 3OSFA 5E1WA 2YKMA 4PJ0C 4MTEA 1PC5A 4RW7A 1P92A 2QSWA 2V63A 2XZTB 5J2NA 3KEOA 5K1YA 2J6UA 2RILA 2LEPA 4DEZA 5FKKA 4CLYA 3JQKA 5JR3A 3RBEA 1MN7A 1RETA 4L3KA 1NPKA 2E5GA 1FP1D 1NB7A 3CGIA 3G4SS 2YX7A 3AL0C 1Q5VA 3PV8A 2DO4A 1VHIA 1W2IA 2QO3A 1RUNA 4CRJA 5H9FJ 1WWHA 4EK2A 1SIWB 2OFGX 5GAEI 2MEWA 4PPZA 2C22A 2QE5A 2CPYA 3S8PA 4UUVA 4IOAQ 4L0ZB 3MEKA 1B8IA 4USHA 1NPRA 4CQ1A 1FTZA 1VQOS 1N5YA 2VUGA 4ZPAA 1ZQ3P 1LNQA 5JHUA 3I55I 1LDJA 1FDNA 3GZNB 4DUZJ 2KB2A 2XMKA 3RBDA 1P7JA 2X0LA 3TUIC 2EB7A 5A8WB 3DPLC 3M9NB 3OW2R 2ASJA 1FKAF 2ME0A 3ILIA 4FPRA 1SV5B 3RSNA 1KQSR 2ZXHA 3S14J 4BBRJ 2GMHA 3I87A 2MY7A 4EJVA 5IYDJ 2BACA 3DPUA 2ZBIA 3EUAA 1FRLA 2E5JA 4RW4B 4A69C 3CULA 5L3FA 1JX4A 1AOYA 4HVZA 1U2FA 2RH3A 1IF1A 1NH7A 1VLOA 4CYCA 1GNKA 4MFDA 3TAQA 2QGFB 3CJ5A 1FYLA 3TP2A 5K5QA 1WOOA 2KHCA 1XSXA 3HHLD 3KG4A 2J0XA 3MAQA 5LMUF 4OOIA 2MD0A 2Y0BB 2XYGB 3H42A 3LGHA 3O5TB 1AA7A 4JOMA 2YNFA 5CD4H 3MKLA 1H2UX 2CADA 3NNAA 4PSWA 3T9ZA 4QPXA 2N3OA 4DV2F 4HR2A 5DJBA 4GC6A 1HI0P 4LSNA 4WE1A 2QEXS 4PQUA 3DLHA 3IGVA 2VD3A 3F73A 3AG4H 2HYFA 3C15A 4KIBA 3FXLA 4WIIA 1GK8A 1TUVA 1U78A 1MN9A 3HCXA 5LGTA 2OH2A 2CZVC 1F5TA 2ZE2A 4BAYA 3FHNA 3W6JB 3ABUA 3OS1A 2X1EA 2GGPA 5DG7A 3EXYA 1JLEB 1C1CA 3MAHA 3UDEA 3BH6B 4BXXJ 5IT9Y 1ZG3A 2OC6A 5CQGA 4PXCA 3TOAA 1OQYA 3UD4P 3GYXB 2BJ7A 5D8HB 2DOEA 3MURP 4ED0A 2JEGA 4M5NA 3VGTA 5K7HA 4R1HA 3KJNB 5A76A 2RQPA 1D0YA 3BN7A 5L8RC 2IHR1 4ZYAA 1KQFB 3GTKJ 4OMFG 4R8UB 3PVXA 2OIHA 4KPCA 2KKOA 3MMCA 4WWSA 3G1OA 1KBRA 2ZJPF 3ZTPA 1UZHA 4DPXA 3JYTB 2HU9A 1FY7A 4Z37A 2X1BA 1KQ8A 3VZIA 1HHTP 1REVB 3O8WA 2MLYA 3JRCA 3AG1H 1Z67A 2V8GA 4FTHA 4YUDA 1SFUA 3KYDB 1NJXA 2BOPA 2YXLA 1M1GA 2AJFE 3AQOA 4HACA 3A3OB 2RDPA 3ZXSA 2DYRH 2YKPA 4E7ZA 3A01B 2PMHA 3V4GA 5H2FC 1Q86T 2HEKA 4E7KA 2WC2A 3HFZB 4KE5A 4LFAJ 2NZCA 4FISA 4BC7A 4K0KF 2CPIA 1JUMA 1ETXA 4FCYA 4HQMA 3DCFA 3BLYA 4ZLJA 5GAGI 3CC7S 3KDOA 4M3EA 3E3XA 4C4WA 2ZKUA 1VNDA 2RT3A 3IMQJ 4YELA 1RESA 1IKYA 2IGOA 2LH9A 3KLFB 4Q8EA 1T2KA 1UFMA 2NPFA 5DQIA 2ME6A 2F48A 3IO1A 2NS1B 2B9EA 4GO1A 1R36A 1OY9A 5GAHU 2EH3A 2GCFA 4ZVRB 1FOYA 3H2VE 4V2GA 4XNFA 1QHHD 3DFEA 3RGIA 1KRPA 3DLGA 1U47A 4WPAA 4LGWA 4I09A 2LKXA 1JXSA 3TO9A 1R22A 1VFCA 3I71A 3QO9A 2CJXB 1ZAOA 1YYVA 2DH7A 3P45B 4J9LA 2E1RA 4F93B 1LDKB 3CLQA 3UR0A 2GA1A 5M2RA 1MBEA 4UVBA 1VJQA 1UW9A 3CD0A 2HS0A 4PPDA 1EARA 4LVOP 1N0UA 1GVJA 1IKWB 2UUCF 4DBRA 4LRAA 2Q8KA 2O3FA 1QAJA 2APOA 1F1BB 5IQQA 1P2FA 1HOMA 4X62J 3DLKA 2HI3A 4FE4A 1OLTA 1KTQA 5IY5H 3ZO7A 4IXAA 1K44A 1WC6A 2C3PA 2KG0A 2ZKZA 2XI3A 4UF4A 4NZ6A 4CLLA 2X3DA 1IN0A 4PFOA 4CCMA 3SFGA 2OCCH 3QWPA 2K3KA 2E1AA 1M5VC 1NSPA 4YIFA 3AJDA 3L09A 2R5ZB 3FQKA 4WK1A 4DF4A 3V4IB 2NR0A 1RR8C 4NLTA 2IMOA 2YX1A 3RB6A 4PXEA 1S9FA 2KIFA 3VYUB 3A0HC 1U5TB 5C3EJ 4QOTA 1FFGB 4ZLLA 2CMPA 4FX4A 3EGWB 3C2PA 3D1HA 1D5YA 1HYSB 3HJFA 2NRAC 4QWEA 1HF0A 2QKLB 4KB7A 5JMNA 4P72A 4DW6A 4CZZA 1CS4B 3PSFA 1TL3B 3HHLC 1ZGWA 2HQIA 2E7WA 2KHDA 5B09A 1KTVA 3IFEA 4NXNF 1FF2A 4B3MJ 5D5XB 1IDYA 4B9MA 4HLXA 5E18F 4BHBA 1H8AC 4OX8A 5HVHA 4KV8B 1VC0A 3MD2A 1BOBA 4C8ZA 2ZJQQ 4HACB 3AFGA 4A46A 1M1HA 2BBEA 2JL9A 1F36A 3KK3A 1R1UA 4U9RA 2Y30A 1IZ1A 1LPQA 3FJ2A 3IRWP 5DM6Q 4WU3A 2ICWG 1R71A 4G6QA 3LTOA 2D3O1 1VJWA 4O44A 3QOPA 5FB2A 3GYNA 2KMUA 3HT0A 4RU9A 2U2FA 1TL8A 3KHHA 3KNGA 1REVA 3E51A 1Z2ZA 1PILA 5CKTA 3G1MA 5DDRC 3BQ2A 1XTZA 3CMAS 5ETVA 5HAOA 4C8MA 1IQZA 3NLCA 1KOHA 1NK7A 2NXJA 2IGKA 2VU5A 2HGCA 1H0MA 4HAMA 1EAYC 2G9WA 2LD5A 1FWZA 2GVDA 2JK3A 1IBMJ 4PGHA 1RXOB 3VF0B 4M5JA 5CYMA 1A6QA 4QIWN 3LOUA 4XKWA 2QYGA 4FF4A 5GP9A 2DO7A 2BZTA 2DMPA 1PJ7A 4IQMA 3FXJA 4WCEQ 1S76D 2IRUA 4Q2MA 3JSMB 4KJIA 2R0QC 3HSJA 1BM9A 1T8EA 4C11A 2R7RA 2RV8A 4DR3F 2FVRA 1IBCB 3Q0UA 3DRSB 2QBYA 4JI4F 3QJLA 3HRMA 2ZJQF 4HG2A 1NMEB 2M52A 2D3ZA 2FVCA 4WXHA 4RDUA 5K5MA 4BHPA 3RPQA 3M8YA 3Q8UA 2CNNB 2XGDA 1RNLA 3TO6A 2M4MA 1QJHA 1ULRA 3BSOA 3NOGA 2OUMA 4IVNA 2WADA 2DMUA 2IJNA 2GZOA 3QJPA 1NNDA 1YGYA 2MJUA 1TFYA 2M5WA 3OYLA 1IJEB 2UVVA 2XAHA 3G3ZA 1GMUA 3KJVA 3LSTA 1VQNI 3TW7A 3FSYA 4E70A 1VRQC 2A05A 1R5HA 4A47A 3J7AN 1OCZH 4C48A 1KS2A 2ZCWA 4KAIA 4P9SA 4K2EA 3H5NA 1HDDC 1JK9B 4OI6A 2HZDA 4Y34A 2NXNA 2PJPA 1CJTA 4TY9A 3K1MA 2Y1IA 1MDMB 4XRFA 2QSFX 1YQHA 2DT9A 5KG7A 3FXMA 1D0ZA 4R5PB 2CFXA 4RW4A 2E1CA 2LQBA 5FGMA 1JLGB 4LD5A 2HQGA 4CYUB 3DGPB 5BXIA 4ZCIA 4HH0A 2YWGA 3S7RA 1OMSA 3LFKA 4M6XA 2HMIB 1ETQA 1VBYA 3F8MA 4F25A 2Z58B 4F67A 3T0YA 3HSGA 1X60A 1DPUA 3D4JA 3OR1B 1XR7A 4RM2A 3NOCA 1XDSA 2CJ9A 1L3TA 2R7QA 2L7ZA 1VMBA 1ON1A 4F2SA 3T9NA 2GO9A 3TAMB 2ZH1A 5J1YA 5HOOA 4A8FA 1G3TA 2JA2A 4GKKJ 2M45A 2HHPA 1E6YB 2V2KA 4F7VA 2VG6A 3GIKA 2A18A 4ENMA 3QBCA 1TV6B 1IKVA 2OP5A 2AS5F 3IRQA 4TLQA 3DNCA 4X4TA 3RTVA 4I4BA 2DJNA 5HDGA 4NRTA 3Q9SA 3DEUA 3DKXA 4NEYA 3H4DA 3KLEB 3JS9A 4IQJA 2RKIA 2V1UA 3O1LA 4DV5J 1N78A 4OIPF 2V4JC 3KYLA 4ZDLA 5LSRA 2LA4A 4IL6C 4YS2A 3KK3B 4P6QA 3AD7C 4TU8A 1NRKA 3J80K 3WC0A 2HR3A 1H72C 3BKFA 3GFYA 2LA6A 3N01A 1N75A 5BYSA 1QNTA 2FYXA 4NASA 3SFZA 3EM1A 2E60A 2E9RX 4DR6F 4J9SA 2UUAF 2D1CA 2AW0A 2OELA 4J00A 1YIJI 2CH0A 1U2RA 3GTYX 3EUNA 2FHOB 2ZD1B 2R7OA 2ACMA 1V3ZA 3OVBA 4KHPJ 2WTFA 2DK5A 1KA8A 2CQGA 3R60A 4KPYA 3HI9A 3RRGA 4PG4A 5I3PA 5ETRA 1EF4A 4DV6F 3M9MB 3L2RA 3CUOA 3R5DA 2CKWA 8ATCB 2ZH3A 3SQNA 3VGVA 1WDTA 4I69A 4HX7A 4NA2A 3V4IA 3UDVA 3HHNB 3TEDA 1WC3A 2FE3A 1WHWA 4A3EJ 1QVFR 4DV7F 2FLNA 4U96A 1KGSA 3J81Y 5KFIA 2FHMA 1WEYA 2MA3A 3NBPB 4LJZF 2XB0X 2NNYA 1BD6A 4Q44A 1QBJA 3FMBA 2VJJA 3UNGC 4AUXA 2JRMA 2DRBA 3HEFA 2ROGA 1KQKA 7FDRA 4LF5F 2OEJA 4QIFA 3OUYA 2K3IA 5EG0B 1IBKJ 3FXUA 2V9PA 2K3PA 2VL1A 3W8GA 2JJ4D 5D0EA 1HBXG 2HNZA 4X4PA 3AOBA 2DFIA 2XSJB 2AGOA 4C3HJ 2QV6A 3PNIA 2KU7A 5E2QA 1YFHA 5B66C 3R27A 3I59B 1HKSA 4YY3F 4G7ZF 2GQ2A 1LKZA 4QYZK 3BR1A 5C4JJ 5KFDA 1FTTA 3M8QA 2BW3B 3WU2C 4NQWA 2B8QA 2DNGA 2O67A 4UXNA 3W5ZA 7AT1B 3OYIA 3I0TA 3H8YA 4JQFA 3KZZA 2DHSA 1ZR4A 4X64J 3RBZA 3G71S 4DR5F 2W2NP 4QIVA 1IXCA 2LQ5A 1UEUA 3RKYA 3ZQIA 2P9GA 4NLXA 4NYPA 1UWAA 1YLFA 1Y8QB 1V54H 1BUXA 3PG9A 2M8DB 1ZM9A 2PD1A 1DARA 4M94A 4B3MF 3GLJA 1ETWA 3W9JA 3FBIB 2EXUA 1N36J 4K59A 4KN7X 2OMOA 1PUEE 5C25A 4CO8A 2FGOA 1KP6A 5DCMA 2JPBA 2Y8YA 1R1VA 1XB4A 5J1UA 1LK7A 4O4GA 1UPMB 4L9NA 5KAIC 1VI7A 4JI1J 3FISA 2HQDA 3BM7A 1X9SA 3EICA 1YS7A 2YBVA 3PHTA 5KFXA 1SAUA 5KCMA 1I27A 3FHZA 3E8OA 1EKEA 1HWLA 3VR1A 2P7VB 5D3GB 2Q0OA 4RB3C 2YPZA 1TL1A 2R7SA 2AWZA 4ED5A 5F04A 4NWBA 5HANA 3LSPA 3DTIA 1WHVA 4JI0F 3HOXJ 1EJ9A 2BZ2A 2KG1A 2VA2A 4HNUA 1SXLA 2B0LA 2CPHA 4XKCA 1I3OB 2XUBA 1MKMA 2OPSA 1SJ4P 4MNUA 3OOUA 4HSRA 4I0AA 4DIQA 4DL7A 2VG7A 2VHGA 4OZLA 1S8NA 1S5ZA 2DO0A 5F41A 4M5KA 4FX0A 3PXGa 2DGOA 2PMWA 4AT1B 4UOGA 2FUG2 4C6AA 5ICGA 1E3HA 4WKRA 4OYAA 3TJ8A 1K78B 4U7UK 5D4RA 4O3MA 4NEZA 2RE1A 4Q4ZF 5CXTA 2E71A 4O0IA 4FBUA 2QL7B 5CD4A 4B47A 4HYEA 1A7GE 4JV5F 1F9FA 5HLTA 1Y0NA 3T19A 1MH4A 1DHMA 4FBTA 2K2PA 2GGPB 1T9YA 2HVDA 1D3YA 2ZOFA 2CIMA 1U9OA 1JJ6C 2GC8A 4ZN1A 3QRFF 3PW2A 3RR8A 2LEBA 2V8DA 5KG3A 3BGRA 1S97A 1H2TZ 1LXNA 4IHVA 3I4MJ 1WF1A 3RKWA 1NJZA 1LWXA 3ZZOA 1N54B 2HHTA 4K4VA 4IG3A 1S0MA 4Q0BB 1PKUA 4XLPF 3HHEA 4ZH4F 2OKQA 4XBFA 1XS9A 3HXLA 3ERED 2FMLA 3HVRA 4A8SA 4Z7YA 4DR7F 4QLCU 2V0NA 4IX7A 2KDOA 1NDPA 1X4GA 2BXZA 4H4KA 5F1JA 5KG4A 2HS4A 3SFIA 2AD9A 2KHMA 2OD4A 1VQPS 3MECB 4MKAA 3CO0P 5J40A 3E6MA 3OFFA 1NJIT 1BR1A 2QA1A 4CUGA 4RB1A 3V5RA 1JNRB 4ATNA 3I9V2 2O61A 2FNAA 3FFIA 3U9GA 1D1AA 2M8HA 4DUYF 3T3FA 5DLGA 3HG9A 4PZVA 3VALA 1K47A 3I53A 2JT1A 4ICLA 3GO5A 3WU1B 2CS3A 1HQCA 3GTGJ 1SJ1A 3AXMA 2K9QA 2ZB9A 5DZ6A 3DLAA 3W6VA 2WHOA 5KFFA 3CO6C 4M5DA 4IYQA 2UUBJ 1RZMA 3CJQA 1PVEA 1WF2A 3ZNJ1 3M6UA 1X4BA 1Y3JA 1RUSA 3G2XA 1VQLS 4IZZA 2FHJD 1Q7YT 1CULA 2Y1JA 3I56I 3NMRA 4LFCF 2DTRA 3FC9A 5HDNA 1VBZA 3DGVA 1AT1B 2V9WA 1QSLA 1L3KA 4PWUA 2W57A 4FXWA 2LQ8A 2CJAA 4PXDA 2LP4A 2LOOA 1TKZA 4LLNA 3V7CA 5M3MJ 1VRTB 4L5IA 4EGYA 3UFCX 3KE2A 5EWGA 1Q79A 5J1EB 2X7IA 5HP1B 1RT4A 1V5IB 1HBUB 2R8JA 2LVSA 3BGLA 3DMJB 3VDXA 4HH1A 1FRMA 1E2XA 1EH8A 4LR8A 4WTOB 1DDNA 1HARA 1LNWA 1HLWA 5BR8J 2DIUA 5H20A 2CQ3A 4A8XA 4RB0A 3SCIE 3F3XA 1YW9A 1Y5IB 4DL0C 1JHFA 4USVA 1U1OA 2VJ5A 2XM3A 4USTA 3MMJA 2EFVA 3CUQA 3BGFA 3WTYC 5JLXA 4LMZA 4OQJA 2LBFA 1B9MA 1B0PA 2EFPA 2VPYB 4AYBD 3GZ6A 3KP5A 4KV8A 4IG0B 4ZVPB 3QT6A 3W3SA 5E17F 3HM9A 1Z77A 3CMEI 1XEZA 3VAMA 3KMSA 1TW2A 4IPAA 2BJ3A 3BR0A 3EUHA 2IJFA 4L76A 1R49A 4KGKA 3BG9A 3WTWC 2KRHA 3GUDA 2JUCA 2O7OA 4DHVA 4EATA 2K1RA 4L6V3 1GX6A 1K9MT 4QQBA 3DYAA 2CA9A 1FK9B 3BY6A 1HYSA 2VJVA 3TUJC 4WYLA 2LKSA 3ML6A 1U8WA 3O6BB 1S9EB 1F2HA 2B9SA 2ESHA 4YMEA 1ZN2A 3C6UA 4DUZF 4IFVA 3OTDA 1VQ5I 3FZ2A 5LHGA 5LRRA 3AG2H 2CDQA 2FLOA 2WOMA 4OZJA 1IUYA 1F0XA 2XASA 2XSJC 1BQNA 2M3DA 4EJTA 4F3MA 2KL4A 2YY3A 3IC1A 1H7XA 1GT0C 2L0KA 2Y9YA 3ZQ7A 3AAFA 5IC4B 4OI2A 2J7KA 1IVZA 1ZK8A 1MBKA 3F23A 1WD6A 1M5HA 4R0EA 3AA8A 3LWLA 4UZCA 1XGNA 1URRA 1CJUA 1ETYA 3G73A 1LOUA 4TY8B 1QRYA 3RPUA 5E3LA 2JHEA 3PIPF 2XGEA 4BS9A 3CEDA 4K4XA 2ESNA 3ZXWA 5LMUJ 2NVYJ 1DGRM 4UOFA 2DDAA 4DYQA 3NCQA 3O3KA 5HI7A 2QQ8A 2J9DA 3KG0A 4OHWA 3LSRA 4ZS6A 5GAGU 1MU2A 2KT5A 3AOAA 4IRIA 1FRHA 2ZMEC 2CVEA 3QIPA 1U9NA 4ECUA 4JI3J 1FCAA 4E8UA 2XKPA 1V5EA 2DITA 3CC4I 2B9YA 5D0GA 1RI7A 4S04A 3GR0A 2QJ3A 5HN0A 4Y6IA 2YU3A 1WI8A 1AFJA 1RDRA 2CVIA 2CWKA 2CW7A 4LVNP 1NKCA 3AB4B 3TNVA 1BXNA 4BGDA 5FJ4A 2MY8A 1W25A 2EFQA 4ICLB 4DX6A 5EEAA 3PKMA 2J7WA 4A6DA 4YFKF 1U5TA 4NLPA 1DAXA 1R0AB 2C2RA 2QC3A 1L3LA 3EXCX 3CMYA 2ADCA 4G7OF 3UPFA 4A3KJ 1SC1B 2KT2A 1X3ZB 3PY8A 4QWCA 2IAIA 1FYMA 2UUZA 4R5PA 2ZXJA 2X6XA 5D5WB 4LIVA 3DMJA 1WDDA 3BJAA 2WB4A 5DZ7A 2FJVA 5HP1A 2B4PA 1IRZA 5E1XA 4UUXA 2IA1A 2K5CA 2BOLA 3ITHA 5FKMA 5DDGA 3SDEA 1R1TA 3ENVA 1V6HA 2DGQA 3G6ES 2WRMA 4EVIA 1QTNB 3PQKA 2C28A 2HWTA 3IRXA 5LMNJ 1O6XA 3LANA 3P7NA 1BL0A 2CQ7A 1FX4A 2XSFA 3GJQB 4LLGF 5IP7J 1APLC 1KLNA 3HZGA 4IFYB 2W2PP 2CPEA 3OUYB 1WUUA 1JLAB 4ELUA 1KU2A 3Q89A 4C0BA 4NC6A 2JSXA 4C0HA 4F4AA 4LLLA 4JI2J 4OLPA 5CVJA 3JAMY 2VI6A 3S16J 1MSFC 1XDUA 1WACA 2B56A 1X1BA 2A5YB 2LU1A 4MLOA 2I5UA 3NGTA 2H1YA 4N77A 4I6ZA 5L1LA 2HHHF 5KFAA 5H1SV 2DOFA 4DSKA 2NS8A 1P6TA 2WONB 1YITS 1X4CA 2OEMA 5LOQA 3R6LB 1RTJB 3K5NA 1E3PA 1S6QA 3ZZZA 4TKTA 1AXQA 2MABA 3EPZA 3FEYB 2UXDJ 2V9KA 4XRSA 4LRFA 1B7FA 4ZTJA 3AKZA 2DDBA 3KG1A 4P52A 1WHUA 5JVTA 2ZJ2A 4AUKA 4DZDA 3VYTB 2HK2A 3BR2A 2U1AA 3MM8A 1URNA 3KYCB 1SVLA 1XK8A 1XR5A 4GFBA 2BBYA 2LC2A 2B5JA 1ONVA 2MQPA 1CVJA 3S3OA 2WAEA 1RTHA 2E29A 5CABA 2R7FA 4PQUB 4YHHF 2IRFG 3QRRA 3KZYA 2PLYA 4CDIA 3H5YA 1BI3A 3R3TA 3BDDA 2Y0MA 1H0HB 3I31A 4GRIA 1NKEA 1I1SA 5HDKA 1LE8B 4EJWA 4G8XA 4FZVA 2I5JB 2ZEJA 1O57A 1V9OA 2H6CA 4ZPCA 4RPFA 1WCMJ 1NHAA 4X66J 3K4BA 1YZ7A 3GLXA 4FN5A 2DGVA 1HMVB 2FTRA 3EZ5A 2B4OA 1J5OA 3LSMA 2MKIA 2QF7A 5E3NA 1RRJA 1CC7A 1IN6A 3R0JA 2JC0A 2ZNYA 4Y7NJ 4ENKA 4XTTA 4CO2A 1RA7A 1QPMA 3HSRA 4CYDA 5KT7A 5HS9A 2VLAA 3LWMA 3Q5FA 1N6QA 2BXYA 3O8GA 2Q2EB 4P55A 3U27A 4Q2LA 3J7AO 2UU9F 5B1AH 5E1ZB 2HDWA 4X4SA 2O03A 1JLCB 3NQOA 2DY1A 2M70A 1Y4ZB 2KVIA 4ENJA 2UUTA 1HBMA 1VBKA 3GXOA 1W26A 3S1QJ 2M7AA 2CG4A 2LNBA 3U1MA 1V5VA 2Z2SB 3NG8A 2BY1A 1RGVA 4HA8A 3DXBA 4EM0B 2HW3A 1OY6A 4YB1P 2W4CA 3LNQA 1WSRA 4TLRA 3E1SA 4I7FA 2H3EB 5KFUA 4K8RA 4NI2B 1VOMA 1GTEA 5KG6A 5F8GA 2EBEA 2F9DA 1NBEB 3IRXB 5IT3A 2H4YB 4J9KA 4TV7A 3LSHA 3MKYB 1S0NA 1PUFB 2WW8A 1IXSB 2COBA 1UJ6A 4JV5J 3QIDA 1NG7A 4WF2A 1RTZA 2XLIA 3PM1A 5J2NB 3KFWX 3NBPA 2JX2A 1LWFB 2ASYA 2F7VA 2FD5A 2BYVE 3OFGA 2A61A 3Q22A 3NWSA 3I55S 2HXOA 2UVUA 3DPTA 4DL5A 4UUSA 5ETKA 5D8LB 2DR7A 1K6YA 4BEHA 3QAEA 1LEOA 4DZJA 1T3NA 3FM5A 5F8HA 4WK3A 4CXFA 5FD5A 4RNOA 2IP2A 2AHOB 3O2IA 3NS7B 3R8YA 4ZPWR 4Q5SF 4LR9A 5E3AA 3QFWA 2V1XA 2ZBCA 2OSRA 2K9MA 5FD1A 2HFNA 3IWXA 4YDDB 3L2WA 2YQ0A 4RW6B 4LK1F 4EO8A 2HHXA 2HYJA 3I59A 4DPTA 1OO0B 3MDFA 4PRFA 2EC0A 3PJ9A 1XR6A 3FMSA 3CTRA 3MEXA 2XSJA 5L9XA 3VWSA 1Y10A 5JFRA 3RI4A 2VIHA 3H0DA 4RWXA 2RNEA 3GEZA 2HNZB 4BY1J 4ZLNA 4U87A 4FASD 3DDKA 2PMUA 3ZPLA 1JMTA 5F1RA 3B78A 3BPDA 1YHQS 3RYRA 1D9FA 3QGGA 2IBKA 3I0SB 1HKQA 2F4FA 5DEQA 3IP4B 3EX7B 1HHSA 4Z7CA 2W82A 3HZEA 2R2TA 5E3RA 4HLBA 1BC7C 1UZCA 1CF7A 3SSQA 2X1FA 2OCEA 4I1TA 3W2WA 4OYMA 1FYKA 3TP0A 2G0JA 1MBGA 3FXOA 4M95A 5FKNA 1OYWA 1TELA 2WB1D 4ZMMA 2M5YA 1VQ7S 2HQCA 2GO8A 3VQTA 1X1DA 1T6SA 1ZREA 3MM5B 2ADUA 1SCJB 2HKOA 4S05A 4HX4A 2Z30B 4ZYDA 2KJWA 2R3SA 3HOSA 2NSBA 1U2CA 2VQFJ 3CMES 2L9SA 1TL3A 3FK4A 4PWDA 4FF2A 4B08A 4EJOA 1FRXA 1WOSA 1MBHA 4BWJA 2R4FA 2BANB 3MCMA 4K2JA 1C1BB 4B9TA 4QPQA 1Z6TA 3NAHA 1HBNA 1DLOB 1IW7F 4OIXA 2JZ5A 4Q43A 2VQEJ 5F8MA 3F0NA 3QODA 3MUTP 2CNLB 3MI7X 2GAGC 5IOZA 2HNYB 3AHPA 2VPLA 1YJNS 4ANDA 3KP4A 3BPVA 3B6CA 4M6YA 2GIQA 3H90A 1U7LA 1UMQA 2HQRA 1VR6A 1HC8A 5F3TA 2KDZA 3W9IA 5C4XJ 2HFOA 3THTA 4OX9J 2HHUA 4NE9C 3ZTOA 1QZZA 2WCXA 1RAGB 4LG3A 1OJLA 5IT0A 2R7UA 2HQ3A 2I0XA 2C2OB 5GMDA 4Q48A 4FYYB 1U24A 3RB4A 1HBUA 3JRFA 2YKNA 4C3JJ 4I7FB 4XMYA 4RGUA 3MR2A 3X2QH 3CJQB 1X19A 2F3JA 4LF4J 1S99A 3FF5A 3I9V9 1U1PA 3KHLA 2G1HA 1XPXA 4NLOA 1WJDA 3ZTRA 1SMTA 1B6AA 3DLEB 4F91B 1BN5A 1S1XB 2V4JB 4G1QB 2VKRA 3HD1A 3LF0A 3OD2A 1BC8C 1TBXA 4MJKA 1T9TA 1SJ3P 5FKOA 2CUJA 4OIOF 1U8BA 2K86A 3M8PA 3IAS9 1LW0B 4B1RA 5DGAA 3BR3A 2HQFA 3GTOJ 2QFIA 3W7BA 3LP2A 4DV0F 5CYVA 2BQ3A 2YPYA 5IP9J 3QMQA 2P9EA 3BDPA 4MGRA 4ZZLA 3JSBA 2GAUA 1MWZA 2JH3A 3VAIA 2KIMA 1UCRA 2ZH9A 1J27A 4KDPA 1XERA 3QPHA 3SJMA 3OXGA 4HI1A 1T02A 2LXIA 5ETMA 4S0MA 2CWXA 1BWVA 3TJAA 3CXCR 4ZJLA 2R7ZJ 3WTTC 5CVRA 2F8EX 2V4QA 3M1VA 3RKXA 1UEKA 3ZZTA 1MIJA 4O44B 1G59A 3MEDA 1RAHB 2K7LA 2Z1DA 3HBLA 1YRUA 3BBBA 1A6LA 4UUWA 4EFAC 2HNHA 2PFBA 2E7VA 3OIQA 1FX2A 1TU0B 3K1NA 1ORKA 2OJED 1SQFA 3A8KA 3EDQB 2UVWA 1JJHA 3HRUA 3C14A 4UOCA 2B4UA 4X2BA 5GAHI 2FJXA 1H2VZ 2M1BA 1JKHB 4DG1A 3U2RA 1S1UB 4NNJA 4Z2XA 2EK1A 3PRDA 1ZRDA 5HJYA 4OJGA 2XAUA 4PWDB 5ETLA 1FNMA 2QUFA 5EDNA 1YDLA 5FLXZ 2YH1A 3I5UA 2GWRA 2EILH 3ROUA 3CJRB 3QP5A 5BQTA 2OPQA 5KT5A 2ECCA 3KIOA 3BOQA 3FMWA 1RHRB 3M2VB 2V6EA 4Y0FA 3UI3A 3DOKB 2K4BA 3DRRA 5A2QK 1SEUA 4TVAB 3J7A1 4HI2A 3BCAA 2HQNA 1SD7A 4FNIA 2W2OP 4ZHRA 4KGVB 3TARA 2C2EA 3V6DB 1V5GA 5F64A 3HHDA 1FKPB 4CNYA 2J0SD 3Q3SA 2K9LA 4NLUA 4WXCA 4EEFG 2LDUA 1NB2A 3PNVA 1UVNA 4B02A 1MJBA 5HLHA 1S6UA 3OIPA 2RB7A 1CJVB 2J8AA 4XRSG 2ZC3A 3T1BA 2BM0A 1U6GA 2FA5A 2FOKA 1FESA 3KKFA 4JI6F 1O51A 4HT5A 4DYRA 1SQGA 3QPIA 1FRKA 5DQGA 5BPIA 1Y11A 3HDSA 4DDFA 4WFBQ 2O5DA 4XM3A 4CM2A 4B3XA 4DL6A 4RW6A 5KFYA 3VVTA 1ZYQA 3AT1B 3T5KA 4DR1J 3MD3A 2VUMJ 5BPDA 4K4UA 2VJIA 2ZFWA 2F8HA 1KLMB 2H54B 1FT8A 1ZGJA 3FZBA 4ZCLA 1BWEA 1T05A 2UUWA 1T94A 1K61A 4W92B 3MHYA 5LM7E 1Q81T 4PYDA 3D3CJ 1M1KT 4KGXB 3TDZC 1EIYB 2E9ZA 2XDVA 1TKTA 3K70D 1HNWF 4N56A 1EP4B 2JMWA 1PAEX 2SXLA 3C8YA 2YKOA 2EPFA 4RUAA 1PAUB 3P96A 2IXSA 3IKTA 2QENA 1ZLKA 3CSKA 3UD5A 1QZYA 4NRUA 3VCDA 4XKVA 1NK6A 2VE9A 2HNDB 4HEA9 5A8KB 4TU7A 3PYEA 1CJKA 4F4KA 2PMZD 1XG1A 2DPUA 4D7MA 1EKRA 1MU2B 2AYBA 1FSEA 4ZP8A 1JUSA 2BE9B 3HKZA 3KLGA 2H09A 2PQ8A 2XPVA 1DQUA 3JQJA 2F4OB 3SBMA 3P5BP 2MHEA 3ZC4A 2ZMEB 2HVEA 3T5LA 1Z3XA 3LALA 3O2PE 3PIOF 4A5NA 1P27B 3H59A 2D1VA 4XDDA 5IT9Z 1GXTA 5DCFA 3JYTA 3P5TL 1QVUA 3T5HA 1WG4A 3TX0A 1KFSA 3FKBA 4AQYJ 1Y56A 3P3DA 5D6EA 2W8KA 3M8EA 2VASA 5HQMA 4CI0B 2G1DA 2Q1LA 4DV4F 2ZH2A 3CJRA 2B51A 5KG2A 3D9BA 5L1KA 2Z16A 3D0SA 2GX8A 1XMOF 2WAFA 2KYZA 4ENNA 2DB1A 1FHTA 2KRRA 1IGNA 1S49A 2H27A 1JLEA 3KLOA 3OL4A 2K1RB 1XGOA 2AYGA 4E7LA 4F26A 2FXAA 4ZN3A 1RWWB 4XICA 4LFCJ 3BC8A 4DJAA 3MD1A 5B0BA 1Y00A 2QRRA 3CO9A 3CT9A 1IWAA 3CD6I 2CNKB 2Z8QA 2RU3A 2UUBF 5GPAA 4UB8C 4K50A 4CT9A 2KI2A 4ZDOA 1NK8A 4HT7A 2NS7A 2XEXA 3H3VK 4CT8A 3FMRA 4DL3A 2BVZA 4CIOA 1Q8IA 4GVLA 5DGBA 3GTLJ 5M5YJ 1X8DA 4DV5F 4PKDB 5EYRA 4LBPA 3F44A 4KA4A 1ACIA 1TK8A 3KP3A 3VSLA 3TRGA 1PDNC 2HRUA 1D8KA 1TQLA 3CPWR 3LP0B 1B4SA 7FD1A 2ID6A 3MVPA 1PYSB 3M6WA 3NGSA 4CH1A 1F5AA 4I0WA 3JQMA 1YX2A 3CB4A 4ECWA 5FDLA 2I2YA 3LUYA 3MMCB 2MSYA 2GBYA 2GHVC 5GTIC 2I1RA 1TWGJ 2CXEA 1S9GB 3AY0A 1SVOA 5KAFC 2V1DA 1LW2A 2GHPA 1HLVA 1SB6A 5KOXA 2IBDA 5E7OB 5DRKA 1CEZA 2J6SA 4BL0B 3GIIA 3CO7C 3IS9A 4DGWB 4XSXF 1R9TJ 2IC3B 1X2MA 5DLFA 3QP6A 1Q82T 1VQ8S 5B1BH 3HM5A 3A4TA 2AEJA 1RTIA 4JV1A 1E0EA 3R6GB 3MFIA 2VOOA 5C7PA 2OLWA 3H4BA 1Z6RA 2M34A 4GRSA 2A5WA 3V2UC 2RD5C 4BC9A 3K4NA 5HO4A 3M2UA 1R89A 1I5OB 5FJ8J 1HR0J 4JI7J 3ZTSA 1GLNA 4BKXA 3RJPA 4O0NA 2IGNA 4IH6A 3M8SA 4WIQA 1LKXA 3J80Y 3K58A 4DYCA 1O3TA 2BEOA 1JJCB 1OCTC 1JIHA 3CF2A 1ZOTA 3J7AY 5K5RA 2NOGA 3CD5A 2L3MA 1IBKF 3DGPA 1Q8KA 4DQSA 2ZZNA 4D3GA 1IJFB 2EBIA 3OR2C 1KHWA 4RKUC 1C4CA 5ICFA 1NK9A 1SKUB 2DA6A 4MFBB 3O44A 3CUQC 2QLZA 1NHKL 1ZPWX 4YFUA 5C2GA 1HKTA 2VQEF 2BHZA 4URGA 1VQPI 2IM1A 3U1NA 2OPTA 1C0TB 1MDMA 2HVQA 4E6KG 1AUDA 2DA4A 1KU7A 3CDAA 2CGPA 2KO1A 3OYHA 2R7DA 5AT1B 5ETNA 3PX4A 1HD1A 2YWHA 3D28A 2O0YA 4MKYA 1H73A 4DU7A 1TKDA 3C2GA 3DRSA 3ONQA 4ANEA 2VT2A 4IG3B 2DFHA 3LPYA 3MPWA 4CTAA 2WV0A 3H20A 5KNLA 2DA2A 4QU7A 2A6HF 3CJ8A 2JVRA 3F6VA 1UPPA 2VE8A 1X5TA 3PW5A 3E7LA 3GP9A 2WBRA 5CYMB 2MKKA 1Z2LA 2F5FA 2G7UA 3ESWB 3OL8A 3C46A 1AWCA 4M5GA 3KUHA 3LPEA 1QA6A 1BJAA 4NLGA 3HVWA 3R61A 3WG7H 1WG5A 2PE8A 4PEOA 3W2WB 4XSZF 4B4CA 3KJFB 1VK8A 3A0BC 2VBYA 2IYIA 2KJVA 1MNEA 3PNTA 1F3FA 5IWAF 1YOVB 4KT5C 2H94A 2RRBA 2XPUA 1VIOA 4JBCA 3H5UA 1ZTTA 3EDPA 5B3SH 1RAJA 1QAIA 1UL3A 4U88A 1TZ0A 3GLLA 4OYBA 3QU6A 1PYOB 1O3QA 2UXCF 5FDLB 4F8RA 2XNRA 4RW8B 5TJJA 3PQJA 2RS8A 1QY7A 3MAJA 1X31C 1WG1A 3M07A 3QFHA 4CP5A 2Q66A 2FBKA 3C7JA 4XRMA 3KLHA 2XYPB 1GXLA 2DHXA 2HXIA 4DV7J 3DQVC 4HBLA 3FNNA 1X4HA 1UP1A 3PHEA 2V6AA 3HPHA 1C0UB 3M7VA 4B48A 1SIZA 3T5XA 1WC0A 3C16A 2DVIA 3REOA 3ISZA 3GIMA 3MCNA 2CWEA 2ZJRQ 2HGLA 4LFAF 1TWCJ 2GM4A 1RUOA 3PO5A 4AIKA 1AROP 4QBUA 3N97A 3MR5A 1Q16B 2F4MB 3HT3A 2G4BA 2EEYA 2AEFA 3SQGB 2O6GE 1I6HJ 3Q83A 4NLSA 3M3YJ 4KT0C 3ET6A 1BLUA 2LK2A 1TMMA 2KIUA 1HW2A 3GYGA 2GJIA 1FKOB 2PO4A 4DL4A 5ETOA 2HAFA 3BR5A 3H0GJ 1JKOC 1X5SA 3DOMB 3THPA 2VFRA 4DX7A 3W2VA 1S12A 3I0SA 4XR6A 2F8MA 1PUFA 4HDUA 4FVCA 4OWRB 3CJKA 1K6OA 1UVKA 5ETSA 4OFZA 1RBOB 4S0HB 4KIFA 3OYAA 4ZIWA 3F8CA 1G7CB 1P4XA 2V68A 2PX9A 4ZVQB 2BHYA 2VONA 2IM3A 1R58A 5C44J 1VQLI 2XGPA 2RUSA 2POKA 2BVMA 2LDYA 2VBWA 1UFWA 2XV4S 1NZ8A 1REPC 2B8PA 3NEKA 3SFUA 5CA5A 2OPRB 4F0MA 4JI1F 3K57A 2MG4A 3HTUA 1MJAA 1D3WA 5HVGA 1IN5A 5IT9K 4A3MJ 1D8ZA 2JQ7A 4RO0A 2RHSB 5D4OA 2BUNA 3DU5A 3PUFA 1NJYA 1M1EB 1JJ4A 3QZ8A 3D66A 2IW5A 3IUOA 4WP3A 1XWLA 1K79A 2M2BA 3QO9B 2HBRB 4B9NA 1RABB 4YEAA 3DLLF 3CCVI 3IP0A 1NZAA 2EI5A 2HGNA 4DR1F 1YIOA 3K4LA 3CCQI 4BJTA 4DV1F 2UU9J 2P0WA 2N4CA 5HMWA 2YNHA 2CUYA 1D9DA 1RHKB 2Y9ZA 3OWTA 5IFMA 3P9KA 3SV3A 3CCUI 1VLYA 3KOAA 1K7AA 2DNPA 3QIPB 1S48A 2BY2A 4IH7A 5AE2A 4J37A 1WSUA 1U8SA 2KQRA 4DWIA 1MSEC 5LGNA 2GMLA 5BYQA 5AXKA 2HBYB 4CNZA 5F0WA 2MZTA 2LG4A 3ZZ0A 3K7RA 4KO0B 3BTLA 1HKAA 4F0KA 1N0VC 1EV7A 4Y3CA 2AEMA 4N76A 3SZPA 4PZJA 5B0CA 3KLHB 4ZHRB 3E01A 2MLKA 3B6BA 4KHRA 4D5FA 2VA3A 2C2MB 2Y0SD 3S1TA 3J80Z 3NY0A 3QSIA 5LEJA 3A01A 5AIQA 1ZRFA 1NEEA 1B4AA 1IRXA 2KFYA 2DNNA 5E33A 1EH7A 1H98A 5EF6A 3MTKA 4ZP6A 2GVZA 4XLCA 2DT6A 2O5RA 2IMWP 1UKUA 1SKSA 2K40A 2VKHA 2KZMA 1ZGAA 4LG0A 2CPZA 1XCVA 4KGZB 1DFDA 2DRDA 3BSNA 3DBRB 1HW9A 2NPIA 2FHJA 4ALZA 2EW9A 3B4DA 2V2ZA 3H9QA 3DCAA 3LW5C 1QM9A 3KHRA 2LKZA 4ZP9A 3MKZA 4NMLA 1D1BA 1GUUA 2OZ6A 1KFDA 2R9LA 2IVFB 1RWVB 2FB0A 2FQ3A 2AV5A 3ZTQA 1IKVB 4UUTA 3TI0A 2E5IA 3K4CA 3M8RA 4BACA 6PAXA 2MQ8A 1AFIA 2WA0A 3DEEA 3CJ4A 5G4DA 5I3QA 2ROEA 2HPIA 2VT3A 2COMA 2XZDB 3L7PA 4ZPVR 3T8TA 1S7HA 2ZBRA 1H74A 3FBFA 2Z56B 4PGGA 1AZSA 3HMJG 3C16B 1BQXA 4OHXA 3H3UA 1NG6A 3NXZA 4HHJA 3C3WA 4PFPA 4YG2F 1TW3A 1WSVA 2OPPA 4BUPA 4G3IA 3PRVA 3OL9A 3P8BB 2ZE2B 1FOKA 5E0OA 4HDVA 2X1GA 1JJ2R 4XN0A 1YJWS 3PO3J 3BZKA 3QWLA 2CQPA 5IS2A 3WODF 3Q24A 4Y2AA 2ZC4A 8RUCA 2DK8A 2KYXA 4GKKF 4H4MB 3R9LA 4K2XA 1R6RA 3DOLB 3R5AA 3UNYA 2BEFA 4B3RF 1TLHB 3J80U 4EI2A 4QR2A 5ETTA 1TL7B 1N34J 1BGXT 1ENHA 1NK4A 4TU9A 1RISA 1RA6A 3CIMA 4DQPA 2QIFA 4FKXA 1K8AT 3U1DA 4TYBA 5TRDA 1Y9OA 2STTA 3VYSB 1XN9A 4OI1A 2UXXA 4J91A 5LT5A 4XIUA 4NPOA 5E3MA 2EFGA 4JI3F 1O4XA 1WTBA 4ED3A 1JLBA 4GO5X 4FVMA 2BV6A 5IV3A 4I0BA 3WGGA 3W65A 4MK8A 3RW6A 1R31A 3N6NA 3GFLA 3UDCA 2NQPA 1IN7A 1ELOA 3IL2A 1P8GA 3R1HA 2L4MA 1NK2P 2RUGA 4OIQF 5CPRB 1IR1A 1SC4B 4A93J 3VWBA 2FVQA 2H6BA 2P5LC 3PIOQ 3D1QA 5H9EK 2BV3A 1HQUA 2QYCA 5IM0B 1EETA 5KFJA 2HHQA 4CCNA 4QR1A 1JUPA 2MLXA 2XCAA 1R4MB 1B8IB 2WZ1A 1ZAVA 1SVDA 2EFNA 5THWA 3QGHA 3IAM9 2DHHA 2HAIA 4ESJA 2DGTA 3H1CA 3UQSA 2HRTA 2FLPA 4LREA 3QYEA 2ERRA 1YJ9I 4A3FJ 2ZO4A 2WSFC 5GMKa 2BJEA 3S6EA 3LQRA 3FEZA 1R8CA 2AF6A 1HHQA 3KLNA 2CQHA 4RR5A 3TA1A 5TISC 2QLWA 2PI5A 2Y75A 1DTTA 2FZCB 4IR9A 4ENOA 3QLHB 2B9XA 4RW9B 3ZNUA 2OSQA 4UOHA 4RUBA 5T7LA 3M4XA 1SFEA 1ZTWA 2NZ4A 2C3OA 3SXLA 4I7HA 2MB0B 4R0JA 3W3CA 1UWBB 3SEZA 1WGXA 1FFSB 3WGHA 1WKKA 3QRQA 2VL8A 3M2RA 1VQ4I 3K9TA 3M9AA 4G6VB 2L7MP 2VKVA 4DLEA 2E2JJ 4LOCA 5LEKA 4ZIVA 2VICA 3CCUS 1VS3A 1W7PA 4C11B 1OSDA 2RSQA 2H1LA 2QMXA 1NK0A 2A6EF 2P6SA 1RKTA 1AUSL 2QN6B 3LP1B 3IR6B 3P9CA 2DK2A 5EUHA 5F27A 5I4MA 2XAQA 2A2CA 4M74A 3ZOBA 4J01A 4NL5A 1X7VA 4NA1A 3TW0A 2D3OR 2J9EA 4AYBN 4KH1B 2L3DA 1HW5A 3JSPA 2HHSA 3FK7A 2CYYA 2HOEA 5EX0A 3N4WA 5F0HA 1ZM3A 2ELKA 1YRNA 2ZFHA 1BOAA 3HKWA 3US5A 4WCGA 1YJRA 3GIJA 4FT8A 2RQ4A 3JTPA 3MR3A 1NJWA 3MXHP 3KX2A 2RDJA 1LWCB 2RKIB 4J9NA 2W2MP 3CW2C 4KC5A 1DRZA 4N4OB 2R92J 1FEHA 4QWBA 3CLOA 2M7SA 2NYHA 5K7ZA 4BQNA 1R8HA 1R4NB 1WJ5A 3EVOA 1U8RA 1SJFA 1FTCA 1RAAB 2M88A 3NWGA 1FNXH 3VQSA 4WU2A 4IHSA 4LJMA 2BJ1A 1QU3A 3ERMA 5KFTA 2ZXWH 3MMYB 1QAYA 5DG9A 3DP7A 1T56A 4LF7F 4OZNA 4AFFA 3CJ2A 3FEXB 2CU7A 4PSXA 1WH5A 3CCLS 4XQFA 2J5AA 4UUSB 2KFNA 3MEEA 3T6JA 4RBTA 3F8BA 3H92A 3FBCA 1HFEL 4AIJA 2GA2A 5D77A 5L3DA 4FDFA 4BXUA 1YG0A 2CQKA 3FBEA 1D0EA 3GCMA 5HNFA 3OTBA 2K8GA 3LA0A 2HVIA 5L1JA 2AJ0A 3IM9A 4M73A 3RQIA 4CZCA 4UNOA 3L9ZA 4FS1A 4HYKA 3JCUC 3HFKA 2W4PA 2DNMA 1RYSA 4MKVA 3PFYA 4U7UD 2VOPA 2E1OA 1WEXA 1UG0A 1FTRA 2RAQA 4U7DA 3LOCA 4HQEA 1BHNA 4A48A 1IKYB 4DV4J 4KYWA 4NQWB 3GTPJ 2EZIA 2LY2A 5EEGA 3OS2A 1EJ7L 3FWEA 3ZGKA 3ZR8X 2VPRA 3H98A 2NOJB 1W5SA 3K17A 3NWTA 3EZOA 2XMVA 4V19X 3POTB 1LFUP 3A12A 4KSEB 2DQRA 2DW4A 4ZVHA 2F5VA 3I6PA 3C1DA 3HGGA 2CO5A 5J4VA 3W66A 5ADZA 2E34A 1X5OA 1GMWD 3C2HA 2HQAA 3GQCA 2OF7A 1PJ6A 2ZH5A 1IRGA 2C2NA 1O3RA 5HS7A 3M30A 5LHIA 3VAJA 5HSPA 3HK2A 1PG5B 3D5SC 4ID5A 2MTLA 4Q7AA 2HKXA 2B7CB 2LECA 3BJ6A 2MKYA 2UXNA 4MTPA 4NZ0A 4C3LA 2QT7A 5B0AA 3LL7A 4QPTA 2NUHA 4G65A 3RPUD 1V5FA 1RK8A 3X1LB 2BE5F 3GE9A 2D7SA 2HS3A 2ATLA 3WE3A 4HKQA 4AQYF 3K4KA 1C4AA 1I3AA 1WI9A 3CTAA 3LSGA 3PDNA 4RB2C 4LB6B 4DFJA 5KFGA 2PFDA 1NSQA 1TUWA 4ECXA 3D6TB 4I98B 3OY9A 4G9YA 4ECZA 3OTOJ 5J2MB 4HZFA 3UN2A 3OJSA 1YJUA 3CZ6A 2HQ5A 2VG7B 3EMTA 2CPDA 2BR0A 1Z4UA 3GFZA 1USTA 3KLVA 2ZJRF 1OISA 2EA4A 1TVRB 1VBXA 2HURA 1HNVA 1CSJA 4BYYA 4I56A 1GDTA 3VPRA 4ELVA 4P96A 2VG5B 5I3UB 3H2LA 5KFKA 1B70B 4B17A 4X65F 2M0CA 2A3JA 1T0TV 2V67A 4E7IA 3I56S 3BREA 5KFRA 1XMAA 1MW7A 1Z21A 3NP5A 1QLNA 2XHKA 2ZDPA 3JXOA 3V7SA 1J75A 2X9DA 3LQVA 1JHHA 4A0XA 4ZVEA 1OKRA 2M4KA 4LITA 1S6QB 2MHNA 2AQ4A 4RLFA 1H89C 1EB0A 3BO2A 2PFFB 3GONA 3B73A 3HDDA 1DP3A 3HRSA 1U6ZA 4ZPBA 4A8OA 3H5XA 2DHAA 5FLXU 4USJC 1CS4A 1GXPA 2WBMA 1T11A 3DOKA 3KLIB 3Q0AA 1L3SA 1RCXB 4LF2A 4C8OA 3CMAI 2BKOA 3DBHB 3NS5A 1FRJA 2DMTA 2QYOA 2QKMB 2D1HA 2RRNA 2E5NA 4EBEA 1FX7A 4DSFA 1LW0A 2M4GA 1PBUA 3RB0A 3MEGB 2J7UA 3DDNA 1OYEA 2ASDA 1GMVA 3N5BA 3PR5B 1SFKA 4PCQA 2RHQB 1T9XA 2VFUA 3HC7A 3R2DJ 1WWXA 3OR1C 1S1UA 4XLFA 3R6SA 2DQLA 3KETA 1APSA 1Y5LB 1BI2A 2XNQA 4ID5B 2IA6A 1F2GA 3NRVA 4DS4A 1J59A 1IR2A 3M9OB 1HNZJ 1JXVA 4WFYA 4L9JA 3SSRA 3KLGB 5B0GA 2V34A 2E36A 3E5QA 1J09A 4PUSA 4M1KA 2JWTA 4IRKA 3EVMA 1ZH5A 1UA1A 2C42A 3CF5Q 3AA9A 1VQ5S 1SC6A 3AD9C 2AYMA 1B59A 4RGXA 1EKSA 4C7QA 1YIJS 1QDUB 3DOMA 2DHGA 4BHQA 4D7NA 3BG6A 1E6VA 3PUBA 3S3MA 4U7CA 1HXDA 4L73A 5HJXA 4ZVFA 2ZHBA 4M5HA 2ZZTA 2L48A 5DCMB 3IBCB 2DOAA 1QO0D 1TWFJ 3F0CA 1F43A 4RAGA 2A3SA 1T3OA 3LP2B 2CW0F 4UVAA 5DM6F 4Q5VA 3PX6A 3F21A 3RW7A 4W4MA 5FIIA 2XMTA 2IRYA 1HCRA 2N7CA 4FXVA 3ECHA 1NH3A 3JRGA 4EWTA 1W4MA 4JI2F 1RB0A 1U48A 4O3RA 4XONA 4RBUA 3CP2A 1JLQB 4X4QA 1OR7C 3K8VA 1AKHB 3MEEB 2LVWA 1NUEA 3BN4A 4DL2A 2GOXB 3KXDA 2GAHC 2D9PA 3MPUB 3K2ZA 3DM2B 1S72S 5E8GA 5KFWA 5IT4A 5IYBJ 2JVGA 1R0BG 3K4JA 4RW8A 2UXBJ 1RAIB 4WFXA 1TC3C 1S4FA 3LWFA 1LWEB 3K10A 5DV5A 4A3BJ 5DD4A 5HROA 4AIDA 3B6AA 4Y2MA 2XMWA 1RYRA 1YWXA 1RLCL 1RSCA 3BG7A 2AXTC 3BTIA 1OQ6A 5GAHJ 3W2VB 4LF9J 5AE1A 4N41A 1SC3B 4DV2J 3C6UB 3IWZA 1CQTA 1Y0HA 2JRSA 1WRJA 3UN3A 2IAJB 3L2QA 1F4KA 1XNRF 2J8SA 3EDRB 2FC8A 3ABTA 1Q8LA 4A12A 2HOAA 4HNTA 3OSNA 1CC8A 1ZAWA 4C0OC 1JLFA 3JTNA 2HPUA 1KYZA 3HL2A 2LFVA 3QRPA 2R93J 2WVEA 4WBFA 2PIIA 1SC7A 3TKYA 2C2DA 4W90B 1UEVA 2BVLA 2OEKA 4FYWB 1S1WB 3RCOA 4NCGA 1MWYA 3VVUA 5KFVA 4UHTA 1VQMI 4NB5A 4CH7A 2V8VA 4X6AJ 3QZ7A 2X6YA 3LA7A 2KZVA 5K8PA 2AQFA 2MSSA 3ZMUA 2QTWA 5HK4A 4DV3J 2BX6A 3Q23A 4ZLPA 2DFEA 1S6PB 1RHUB 1FXDA 2WWYA 2EIKH 2M8GX 2ZH8A 3KEQA 1VRUA 3IXQA 2LMIA 2NCKL 2HYIB 1B3TA 3Q8QB 3R0AA 4M3FA 2EWHA 5ILSA 1E17A 1BC6A 2XS5A 3GV8B 2V4RA 2DN0A 3W6KB 3L2CA 3TUPA 3N6LA 2VF3A 2HLTA 2L02A 3PNYA 1CJTB 2LBFB 3ZCOA 4JBAA 2W4SA 4KRWA 3L9FA 4C8LA 4QZVB 1X3WB 1I5ZA 1QGPA 1QSSA 4U67Q 4JYAJ 2O8XA 2IS2A 2LRDA 1BE4A 3MGJA 3L3CA 2UWMA 2JUGA 3MWMA 2CQCA 4JX6A 2KXFA 3MWBA 1U6BA 4JX4A 3CCWA 5LLQA 3GU0A 1CLFA 1A6IA 2FMYA 1CULB 4RBVA 3Q8PB 4OX6A 3T1YJ 3ECOA 1TMJA 4II3A 4UY8I 4KITB 2IA0A 4XO0A 2R42A 3HJVA 4B8XA 1AYEA 3H40A 1Z7LA 3OPKA 3TOQA 2NAZA 1RQ0A 4ED4A 4X66F 2GJFA 1SBRA 3GIRA 4C2TA 1N33F 2QBYB 2VBZA 3CUNA 1D1CA 1JLBB 4IQ4A 4OX7A 3UO0A 4ZJQA 1KVIA 3GB0A 3CCMS 4W97A 5K20B 4MFEA 1HQUB 4L3NA 1AW0A 1D8YA 2B63J 5M2PA 4EBDA 1WKMA 1N5TA 3N05A 1N56A 3K59A 1C2PA 1P6RA 4WXDA 2GFFA 2DJIA 2DH9A 1M5SA 5GVQA 3M7GA 1IKXB 5HVQC 3A02A 3VGUA 1AHDP 2WK4A 4NUBA 5KFEA 4M3DA 2XMAA 1U02A 3LFUA 1TL7A 2DODA 3G71I 3W9HA 3E2EA 4NA3A 3HHGA 2WV1A 5E5NA 2YKNB 4KKOA 3CNQP 5CH7B 1GAOA 2W7OA 4DV1J 4O3SA 2OA4A 4DI6A 3OTCA 3PW4A 2B4VA 2JA5J 5EWFA 2JN6A 2JEIA 1R23A 1BY9A 4P74A 1TQIA 3CJNA 2AQEA 4HV5A 1LXJA 2RU9A 2HWVA 5J4YA 1U1LA 4X4VA 2ZBKA 1RKJA 2ZJPQ 4KGMA 3IWNC 2D9OA 3K8WA 4PDKA 4LSLA 3SEOA 4IOAF 5FRNA 3HHLA 2RDDA 2Z0GA 3LA2A 5E3PA 1MZBA 4A0ZA 1RBLA 2Z99A 1LB2A 4JI0J 2VH7A 1HL6A 4NLQA 4E2FB 2WSCC 3I96A 1R00A 3QNWB 3CJTA 2E1MB 1C1BA 4OI0A 5DETA 2HFZA 2EBGA 1YJVA 6FD1A 1N5QA 1IXRC 4J90A 5JLWA 1K1SA 3ENWA 3JTOA 4DPWA 1I94J 3V81B 1WC1A 5LJ5Y 2IC3A 2A07F 2ISYA 1AZSB 1GV2A 4R8UA 3RYPA 4USIA 1HBOB 4ER8A 1S1TA 3J7YI 4X1EA 1Y7PA 3FCVA 2YVSA 4JI4J 1OYYA 2PMZA 2C3UA 3HLUA 3U7JA 5EX3A 2FLLA 2MKCA 4IRHA 4WFNQ 3SI8A 2MC4A 1POGA 3MZYA 1MMDA 5CVIA 4CCLA 4N8OA 1RR7A 4FP9A 1LVAA 4OAYA 3MMAA 1SL1A 2K06A 3SSSA 4ECVA 4ITSA 2P8TA 3TQNA 5FLXY 2GNKA 1VQ9S 4Y33A 3OQ2A 4WZMA 2FC9A 5C42A 2BW2A 2O3DA 5B5EC 5KFNA 3PX0A 1J9IA 4F4XA 1MG7A 2DAOA 2XHCA 4B3TJ 2N3LA 4K4ZA 1MMNA 4X0GA 5D4LA 2A6TA 1WHYA 1W36D 3B8HA 3T41A 4ZP7A 1CG2A 4TN2A 4JI8F 1X1CA 1N5SA 1FBSA 4WZQA 1YITI 4XPCA 3UR3C 2QL9B 2JVHA 3OYBA 3WZ0A 3CCJI 2BKNA 1RHQB 4IHWA 3EYIA 5F8NA 2VZ9A 3GFHA 1EP4A 2HLUA 2D41A 3G6VA 3BPXA 3IAS2 1CQMA 1DJ0A 4F50A 3TVZA 1QUPA 3WHIA 1BA5A 1ZARA 1F60B 3DWLE 4XOTA 5GAEJ 4OYWA 3RAMA 3B54A 2E5LF 2V6CA 2WONA 3FSIA 5BR8F 4OHZA 2XPWA 5KFMA 1U0SA 2CZ4A 2R5ZA 1Z9CA 3QWUA 3JSRA 3M05A 5KFLA 2A6MA 1P1TA 1KNZA 5BMZA 3J7ZI 4O3QA 2KT0A 1LJ9A 2AJ2A 1G3SA 1FMVA 4O3OA 2OTJS 1PJ5A 3HO1A 1Y0UA 3FSXA 4LRDA 2QX0A 4BCAA 4ES1A 2MDAA 4XDCA 3R5GA 5KG0A 4IFYA 3UCGA 4C2MA 4CLWA 2UP1A 4PG7A 3V6JA 4MK9A 1CJVA 1YI2S 5FROA 2HFHA 2PI0A 2JEJA 3HXMA 5LXRA 4WFAQ 1XC9A 3KK1A 2AYEA 3SDEB 2DISA 3W5YA 2R2SA 1QHGA 4G6DA 3S8SA 1TK5A 5DUIA 2ZOGA 3BKUA 5EWEA 3BH7B 4ZPDA 1VQYA 4BDZA 3ZQFA 4YB6A 1J5EF 3ZMSA 3LMMA 4KHPF 3D5RC 2VQFF 3W8PA 1T95A 3DLGB 2DBBA 1VC5A 2LMDA 5KFBA 2E5HA 3IH4A 3M2VA 1PC4A 5J2PB 1KQ0A 1U4BA 3SZTA 1RADB 2UZAA 3H0PA 4PG8A 3HP6A 5B0EA 2BRKA 3CC4S 4ZVTB 3JSOA 2ASLA 1KQGB 3EVWA 2QMWA 3JREA 2K02A 2NXEA 2ZUAA 1KLMA 3KLFA 3DHWC 2AU0A 2KRCA 2M9HA 1IAWA 1U1MA 4EM1A 1FD2A 3NGUA 2HIYA 1UA0A 2X48A 5KG5A 1NPPA 3CDWA 2R3VA 1VCTA 2L9WA 1FE4A 3J81j 3ELHA 4UQGA 4F4ZA 1EX8A 4KTQA 2DFFA 3WG9A 3ZQLA 1NAQA 2HVHA 1C0WA 2I5JA 5E8IA 2OJ3A 2W24A 1K4SA 2PJRB 4AIHA 4MQ9F 3AXKA 4J9UE 1RT5A 1QZEA 4WP9A 3TZWA 2R7TA 1ZAXA 5D0HA 5M3FJ 2FJBB 4GKJF 4D1QA 4RZRA 4Y28C 4M5LA 4H4OB 2KIQA 3TMOA 1XMQJ 4D9JA 1JWWA 3MEDB 3FDSA 2VBXA 2B6AB 2XI2A 4P2SA 2YWWA 3PYFA 1WORA 1TVRA 1UAAA 2Y1LB 5L3BA 1IV8A 2GXBA 1WH7A 5TGTA 3Q0WA 4N7TA 3MM8B 3GILA 4I76A 2YKAA 4DV6J 4HDGA 1R5ID 3U02A 1MNDA 4RX6A 4UTGA 2RAEA 4F7ZA 1S7EA 5C24A 3RB3A 4OX9F 2BKPA 1G3WA 3MM7B 1SD4A 4KKOB 3DLLQ 3SXYA 1D5VA 2XY6A 5A0YB 4LRCA 1G4CA 4H54A 1TL4A 1OPZA 1FWKA 1OPIA 2HPMA 2KM8B 3NL0A 1S3JA 3T6BA 3P4UB 2UV8A 2A0FB 3A03A 4AL6A 5L3EA 2KVQE 4I6YA 5A6WA 3OR1A 3A8JA 5LL6d 4LFUA 2XF5A 4BDYA 4JYAF 2HRYA 2CQBA 3W63A 2KZZA 1Y5NB 2V7FA 3K0JA 1NSAA 2VG6B 1XMXA 5ICEA 2WVDA 4M5DB 2LR8A 4YIRX 2TCTA 1G8XA 1YI2I 1GX5A 4ZVUB 2MZQA 5HODA 2MKSA 2FJEB 5AIPA 3VYRB 1QAXA 1FEEA 3MZHA 2ACJA 1OY8A 3W61A 3IN5A 2CUEA 1C0TA 3N28A 4G12A 1YVFA 3R5JB 5F8JA 4YB7A 5F9LA 3MMBB 1J0RA 4L5EA 3TVYA 3HJEA 2V8PA 1A04A 1NO8A 3I58A 1VF9A 2F2EA 4OYOA 1PO6A 4RW9A 2DNOA 4CYUA 1ROFA 4ILLA 3ITHB 5AJ3J 3IH3A 3CC2S 4BU2A 1DTTB 3OIOA 2MKJA 4FNHA 1W5CC 3J7YU 3CESA 2ALYB 3CCRI 3FBBA 3S01A 3DLJA 1SH0A 2ABYA 4F36A 1WJFA 4JI6J 4Y00A 4DFPA 3P6YC 4DSEA 3ASOH 3H35A 1S6OA 5HS8A 3OLAA 4K4WA 4KNYA 2M0GB 1XNRJ 5AONA 4ZVOB 1RWMB 2FD2A 4YR3A 1Y39A 5DG8A 2V4JA 4LQ9A 3KMQA 4EM2A 2DJWA 1HSTA 1RTIB 1X0PA 2QWWA 2GHWA 4ITVA 3EYZA 1MBFA 1IV6A 2TRTA 3MEGA 1Q1VA 2HVSA 2QCOA 4JI5J 3M2UB 4NCGB 4I67A 2ZH6A 2KL8A 2EZHA 3WHCA 3GSIA 5CZXA 1ULYA 4ZJOA 4DQRA 3EE3A 2DMNA 5JI6A 3U1KA 3GCWP 2BJDA 3Q2TC 3TVKA 3T1HF 2PA8D 5IYCJ 2A10A 4G94A 4ERDA 2KZGA 3UCZP 2E44A 3NGDA 1LQ9A 4ZA1A 4ON0A 3HOWJ 2CDRB 5HQ8A 3PO4A 3CCES 4RLQA 3GFJA 4V19K 4TY8A 2MH2A 3OHBA 2B6AA 4M3GA 5A0YA 2HK3A 2IA2A 5EEHA 2HG4A 3MM6B 2XAFA 1MGTA 4FE7A 1TAQA 3Q0VA 1LWEA 1TTHB 3F72A 2OD6A 1SH2A 3AD8C 3BQZA 1F6TA 1WVRA 2M8EA 5I3UA 3UVJB 2PJRA 2DXFA 4CM0A 1TK0A 1ZRCA 1U26A 1HNXF 2WOMB 1J5YA 2DCLA 2VFTA 3I5CA 3OYMA 1GXUA 2M30A 3W2AA 2W9BB 1Z05A 1L3VA 2XGQA 2LY1A 1VQKS 2DR9A 1PYVA 1SUQA 2BY3A 4QYRA 4BQQA 3FRZA 1FDBA 2NREA 4KYZA 3CDLA 1UTAA 4EZ6A 1VQ4S 3CCTA 4QCLA 3EGZA 4JK1X 4LIRA 5GAEU 3MAAA 3EUHC 2O9LA 5IOYA 3MUVP 1S6LA 5F0FA 4MIWA 4MEYF 2WY8Q 1UZDA 3GCXP 4N4NB 4OYIA 3PW7A 1IBMF 3GFXA 4CSWA 3G2BA 4MTDA 2R8GA 1SANA 3L7WA 1UVMA 2X85A 1X1PA 2CG8A 1WKLA 1VHFA 2IAJA 1YW7A 2VQCA 3WIVA 1KU9A 2W84A 1DBDA 3VHQA 2CUFA 3H9GA 5EZHA 1X58A 4Y2IA 3IWFA 4AXJA 1J7KA 1ZETA 4IO9F 2Y0SN 1U1NA 3WTZA 2AKWB 4RJVA 4WWCA 2XF7A 3R7NB 4OYXA 4I6WA 3WTVC 1OCCH 4IDKB 1UVLA 3I5AA 3SYTA 3BG5A 1X9MA 1GH8A 2EIJH 5FD6A 3M8QB 2VFSA 1RHJB 2ZFUA 1FDDA 2DNZA 1F1ZA 4XL9A 4IH5A 3OSPA 4BLGA 3JB9k 3OBIA 1MWQA 3FUYA 1RT1A 3DRXA 1M5PC 2MYSA 4RUCA 2HGMA 4A8QA 5I42B 2W00A 2Q79A 2LY9A 2VIXA 5RUBA 9ANTA 2XB2D 1EETB 4ELTA 5GADI 4LIUA 3IR7B 4A4JA 5B08A 3M1EA 4J9OA 3C3LA 3CJKB 4N0BA 4KN4X 1DTQB 2E35A 5HNHA 2OU2A 4UQTA 4K5RA 5D15A 5BNGA 3BGUA 2GJ2A 5IV4A 3G8TA 1HIYA 4HTJA 2CQ1A 1J5EJ 3ZQCA 3W62A 4O4GB 2CJYB 2HEOA 1LEBA 1GMWA 1H3DA 4IKAA 5HQLA 5JJBA 3QQCD 1FDAA 1FKOA 1BBYA 3CD6S 1G6NA 4BHCA 2Y3YA 3TOBA 1G3OA 3WX8A 4QIWD 2K27A 2D69A 2MGZA 2W2QP 4IF4A 2XAGA 2DI3A 5MLCV 2LU2A 4RWWA 3G6EI 1XX5A 4ZDNA 2CV1A 3HUGB 5J47A 2VJ4A 3RIRA 2HVRA 2MSTA 4ZVSB 3FM3A 3JRBA 2HFVA 3PJXA 3B02A 4M3BA 3GG0A 4RGSA 2PEHA 3A3PB 2PGCA 1NH8A 4CA0A 2KN4A 1FFWB 3DBLB 1IM4A 1ZPVA 2H9ZA 2P8IA 2Y2ZA 2C3MA 4MQVA 2M3AA 1FXRA 2FY1A 1R6VA 5C42B 2VV5A 1BJZA 3QGPA 5JHFA 2O8KA 2OFHX 4RS8A 1TT5B 5HLFA 3BROA 1ZM2A 4YP3A 2L4AA 4Q0BA 1FJCA 1XMQF 2XTJP 3KEYA 3DRRB 2RRAA 3THVA 2GZWA 4RA2A 2X51A 1TP4A 3CCSI 2XKOA 4IRDA 4XPEA 4RAZA 4CCOA 1R5GA 4ETZA 4G1PA 1Q5YA 3L4BC 2H5EA 3RUBL 4O6JA 4F0HA 4P2XA 2CW8A 2CPFA 3RYLA 1BQMA 4UY8T 1NM2A 2DR6A 2XYHB 1FLIA 4GO7X 4OIRF 4OZ0A 1I1GA 3TQEA 1TKXA 2EG1A 2E1MC 2F5EA 2H1KA 1HMVA 4DN9A 4X64F 2V26A 1Z1ZA 3I4HX 1IWGA 4UT4A 2DH8A 1GVDA 2B43A 4V1Ak 1VQMS 2FHKA 3CIZA 5IWAJ 1FOXA 3D6MB 2V1NA 3MAAB 1YG2A 5EN1A 4A8MP 1HNZF 3M2RB 1NK3P 3M30B 3HULA 3EPGA 1JLAA 2FOWA 4HOBA 1E3OC 4OJHA 3CDEA 2OTLI 4A2UA 3CVKA 3OSGA 4DZ6A 2Z33A 2W9CA 5DQHA 1SUQB 1UELB 4M71A 2V8HA 3OYJA 5IZHA 2W9BA 1RTHB 4XAKA 2WW4A 1T9VA 4I2QB 3CJTB 3E01B 3NNHA 2X1CA 4NYOA 4LFBJ 2DR5A 1QQIA 4A3DJ 4UV9A 2RDIA 2QA4I 5ERIA 5HBMB 2Z57B 4EQQA 2KXNB 2E2HJ 1HA1A 4LMYA 1X2NA 3SMZA 3FQLA 3HSZA 2MQQA 1ITYA 3RU0A 1T0FA 4WK8F 2DU9A 1YS6A 3ZMDA 4LF8F 1IKXA 4A6EA 5K8OA 3WE2A 4LUBA 1DQ9A 3MPVA 2MGQA 1L0OC 4QIGA 5AXLA 2YNIB 1S57A 2YNHB 4MH8A 3R7BB 2QFJA 4GGGA 3TEHB 2XGXA 1Q53A 3T1HJ 4GYIA 2VPZB 2BJ8A 2HOSA 5DDQC 4YDXA 5T41A 3E97A 3ENQA 1IR0A 1E6YA 4YHHJ 3FCWA 1OQ3A 4GKJJ 4CCHA 4PABA 3R4KA 2FIUA 4QWAA 1SPBP 2DA5A 1LV5A 2XS2A 1L3UA 2OUGA 2BMBA 1U09A 2CPXA 2VB6A 4CTAB 3CJSA 4FYDA 3K2AA 1VQ8I 3JSMA 3ZN0A 1KU3A 3TUZC 2ETHA 3PFIA 2OPRA 3M8WA 3POTA 4ZITA 4FETA 3FGVA 2HMIA 3UW1A 1B72A 1I94F 3PZPA 2HTJA 4DOZA 4RBOA 1RPWA 3MZ8A 5BYRA 4EGZA 2HWIA 1LW2B 1RT1B 1DU6A 1VK3A 3QYYA 1RTDB 2YKMB 2Z4PA 3HPGA 4YFNF 5C2CA 4DR2F 4ETXA 2MLGA 5ILUA 2ZBPA 2XIGA 1FXLA 1J2VA 3L7OA 5F6FA 4M63A 5IXUA 4NXMJ 1ICEB 2B0GA 4QPOA 5J1RA 3EGNA 5B0DA 4X4NA 3GZ5A 1GTHA 2CPJA 1S0OA 1BQNB 4USMA 3OL6A 3R2CJ 1RWUA 2DTJA 2FBIA 4RNFA 3KJVB 3BDEA 3HD2A 2BXJA 2BANA 1X9WA 1FVQA 1UMJA 2AGQA 1N52B 4MK7A 5E3QA 5EHHA 3LP1A 2WSEC 3ETMA 2W9CB 4PUOB 5A2QY