1P9QC

Structure of a hypothetical protein af0491 from archaeoglobus fulgidus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
233
structure length
230
Chain Sequence
VSLDKAVIARLRKGGEEFEVLVDPYLARDLKEGKEVNFEDLLAAEEVFKDAKKGERASVDELRKIFGTDDVFEIARKIILEGEVQITAEQRREMLEAKRKQIINFISRNTIDPAPHPPSRIERALEEAKVHIDIFKSVEAQVKDIVKALKPILPLKFEEMEIAIKIPPEHTGRAISALYNFGGVTREEWQRDGSWICVMRIPSGMYGDLMDLLGKVAKGEALTKVLRRIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Shwachman-Bodian-Diamond syndrome protein family is involved in RNA metabolism.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein AF0491
total genus 58
structure length 230
sequence length 233
ec nomenclature
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01172 SBDS Shwachman-Bodian-Diamond syndrome (SBDS) protein
C PF09377 SBDS_C SBDS protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.900 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1p9qC02
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1p9qC03
3.30.1250.10 Alpha Beta 2-Layer Sandwich Hypothetical 12.0 Kda Protein In Nam8-gar1 Intergenic Region; Chain: A; Ribosome maturation protein SBDS, N-terminal domain 1p9qC01
4FN5A 4ZCKA 4ZCMA 1P9QC 2J7KA 1N0UA 2I8EA 4ZCIA 2WBMA 4MAKA 3ZZ0A 5G4DA 4M1KA 3ZZTA 2BM0A 4MYUA 3B8HA 3LH2S 3B82A 4TNOA 1NYNA 1U2RA 1N0VC 1ZPWX 1ZM2A 1KTVA 3E3XA 2EFGA 3ZZUA 4ES2A 2I0XA 2CVEA 2E1RA 2XEXA 2L9NA 1ZM9A 4ES1A 4QR1A 3UI3A 4ES3A 2ZITA 4MYTA 2BV3A 2IVYA 1FNMA 1ZM3A 3OQ2A 2KDOA 1DARA 3EXCX 2NPFA 4ZCLA 2BM1A 1ELOA 4QR2A 3B78A 4QR0A 1ZM4A 1T95A 1VI7A
chains in the Genus database with same CATH superfamily
1UHWA 2ZOMA 3UR3C 2ZO4A 3EX7B 3X2QH 2K2PA 1NZAA 2Y1IA 1TAUA 4PUOB 5J2PB 4ZYGA 1TQIA 1RT6B 3W9JA 2PG4A 1IN7A 1TP7A 1DQUA 1WF2A 2HVRA 4C3HJ 2FBIA 5FO5A 3J7YJ 1J0RA 3HHEA 2ZKTA 4ZCKA 4X84A 2RNJA 2BW3A 4KY3A 4F26A 1Q8IA 3HSGA 3H5AA 3OIQA 1R8AA 3WG9A 3A3NB 4UOCA 2KRCA 1F36A 4I6ZA 2JVOA 2D3OR 4MHGA 1RCXB 1R5ID 3CMQA 4NLYA 1IR1A 1YFHA 3QU3A 3Q22A 4J9OA 1ZYRF 4L18B 2ILYA 2Y2ZA 4JI8J 4NXNJ 3US5A 5HVHA 1S0OA 4TYAA 3BR6A 4DCJB 5I4MA 3ULHA 2CJQA 1DP3A 4C9YA 3OFFA 2N7YA 4DV4F 3OR2C 4UVBA 2NVUB 2L2OA 2FLLA 3M6XA 4XPCA 2W4CA 5KG2A 1SJ4P 4IRIA 1L3UA 2UP1A 1VQ9S 4ETXA 4AQYJ 1S7AA 2XB5A 3J7AY 3N0VA 2HQ3A 1Y4ZB 2ZD1A 5DG8A 2KMUA 2E9TA 1XCBA 3KG4A 4FX4A 2E5LF 3O8WA 3U1LA 2QL9B 3DF8A 4BACA 2EILH 3ERMA 2OUGA 3HDDA 1Z21A 2UXDJ 3AD9C 1I6JA 1PUEE 1FRLA 1U5TA 2P9EA 2DRAA 2XO6A 1NB7A 4C2UA 3K69A 3IO1A 4JX6A 2KT2A 3Q0UA 1OWXA 1MSWD 1X4CA 3QO9A 3THTA 3W60A 3AQPA 2CW7A 1QAYA 2MD0A 4MKAA 1JE8A 1TUGB 2IYGA 1ZM2A 2DNZA 3SCIE 2V4JC 3IFEA 3LAMA 4J9MA 2CQCA 3PIOQ 3JXOA 3VGTA 3DMJB 9ATCB 2ZD1B 2R92J 2GS8A 2RDIA 2GIQA 1J59A 3MCSA 1TVRB 1NH8A 1SL0A 1SQGA 5DM7Q 1OISA 2VASA 3M8JA 3AD7C 3FSXA 2KYXA 3GFJA 3S17J 5HROB 5KFHA 5FRNA 3V5RA 4OIRF 1QVGR 4HH1A 3M7VA 1CLFA 2DJIA 1HMVA 2DBBA 1K9MT 4E7KA 3IWFA 3JREA 3B6CA 2K4BA 1QRYA 1UFMA 5AXLA 1H98A 2QM3A 4CUGA 5LHIA 1F0XA 4RGRA 3FX3A 3DTKA 1DP7P 3E5XA 1HQEB 1FKPB 4OZNA 4F67A 1WKLA 2FZKB 2KRBA 2JSCA 3DLHA 2E1PA 1TWCJ 5KT3A 2BW3B 1JMTA 3LQQA 4IH7A 2ASYA 4IG0B 2V50A 4C2TA 1K47A 2H65B 2NVXJ 1TL3B 3FBCA 3KDOA 5ICEA 2DIVA 5CZVA 3TKYA 3PO4A 2GQ2A 2M8DB 1U1LA 2HVDA 2W7OA 1R00A 2VXZA 1WEZA 4RWWA 1I1GA 4QTRA 1VQLS 2DNRA 1YI2I 1TWHJ 1EP4B 2FA5A 1YJWI 1WJFA 4EM2A 2C6YA 1HD0A 1VQOS 1N4LA 2V8GA 1P4AA 4NDLA 1ZARA 2KDOA 4BXXJ 1SB6A 4NXNF 5D8KB 3ZQGA 3CWJA 4F93B 1FFWB 4AU7A 2EH3A 4HA8A 2A07F 1NNDA 3C6TA 2FD5A 1N6QB 3PW4A 2LF7A 3Q8VA 4I6WA 2CZ4A 1T9TA 1YJWS 1IBLF 1RTHA 3G96A 4KIBA 1RT1A 3QLHA 1JHHA 5HMYA 2HW3A 2QKLB 2R3SA 4L76A 3HJEA 3MCZA 4CO2A 5HOOA 3RDIA 2VQGA 3LOUA 3HHLD 2ZKUA 1SQFA 2NYXA 2PDAA 4QIVA 4U8VA 4G6DA 3NOGA 4P55A 4L0ZB 5DG9A 1A36A 3AG1H 2FJEB 2M4GA 2K86A 2H5JB 1U1MA 3DU6A 2RQPA 1LFPA 3K2ZA 4V19K 4A93J 5KG0A 4Y0FA 2QT7A 4HZFA 3OS1A 1AU7A 2ID6A 1UWBB 3ASOH 4EZ9A 1NMEB 4AD9A 2N3OA 3RJMB 3FZBA 1LFUP 4WFAQ 2DNQA 4MK7A 2FTRA 1R7IA 1DY3A 1XN9A 3ABTA 3AA8A 4HHJA 2MQPA 2B9WA 2W9BB 1FMVA 3CMMA 5F8LA 2EV5A 2VPYB 3I82A 3OL8A 1QUVA 1IWGA 5H6RA 3PNIA 1HFEL 5A2QK 3V4MA 1TK5A 3QAUA 4RNHA 5J3LA 5L3CA 3H92A 3HUGB 2QA1A 2EZLA 4NLXA 3OYCA 2RKIB 4ECZA 1FVQA 4EJOA 2JWNA 4OLPA 3CO0P 2EQRA 2GIFA 2AJFE 3FMBA 3SJMA 2IVYA 3BH6B 2HLTA 4WK8F 1DTTA 3FQKA 3W65A 3VTIA 4L5JA 3ZN1A 1Z6TA 1N0VC 5HI7A 2IBDA 4RR5A 5AE3A 3ZZUA 3RYRA 4HX7A 4HX8A 3CJ0A 3P9CA 4N5SA 2EC2A 5B1BH 1ULRA 3QGIA 4BQOA 2Y1RI 1S1VB 2BE9B 1JJHA 3I3LA 2OJED 1U0HA 1VQOI 3N28A 4MKBA 1U5TC 5AE2A 5L3GA 2ZBQA 1VJQA 3QPHA 1HQ2A 2BBEA 3TOAA 3GIKA 3VGSA 4AVZA 4DR4F 4ECYA 1SC7A 2OEJA 3TEDA 3KYLA 4IRKA 1JLQA 1GT8A 5E8IA 1S97A 2F6CA 5H1SV 2QSFA 1VZ0A 3FRZA 5E3QA 5ETQA 1CJVB 2AD9A 4K4ZA 3VYTB 2CQ1A 2GHPA 3ZTQA 2Y1LB 1KD1T 3KZYA 2Y0BB 1ULYA 4OIOF 4E7IA 5EEHA 4XOTA 3CMAI 1HNVB 2DXFA 4DR7F 3OR1A 5JUMA 7FDRA 4EJTA 3BC8A 3EGWB 4DW6A 5F3TA 2CPJA 1S76D 5FJ4A 3BTLA 2DPJA 2VC0A 3OYKA 4TV7A 1ZPWX 1U8SA 2HVZA 3FMSA 3FMWA 2WW4A 1F1BB 3QGHA 3MM5A 4BDYA 1M1EB 5J47A 4WBFA 3TA2A 4Y34A 1RT5B 4URSA 5M3MJ 1HHTP 1XGMA 1C1CB 4GC7A 3OYGA 4XLFA 4JP0A 4OJGA 3ZP5A 5A6WA 1UVMA 1RT7B 2PQ8A 4MTEA 4HV5A 4WXCA 1FE4A 1FJ7A 1Q1KA 2A05A 5THWA 3BG3A 3BG9A 1S6LA 4RM2A 2F9JA 2W48A 1JJ8C 1FRXA 1ZH5A 2BXJA 5LJ3Y 2ZM6J 3C2BA 1WOOA 2L5QA 4WU3A 2DISA 1L3KA 3MM5B 1VDHA 5EF6A 3F72A 3HOWJ 5H9FJ 4MKVA 1FJGF 2AW0A 1WEYA 3ZMDA 2ZHAA 2OQGA 2R5YA 5IV3A 3FBEA 1Q8BA 5IC6B 1HKTA 1W2BR 4I56A 3IS9B 4DZ6A 2A18A 5J2QA 3NGTA 3J81U 2OPQA 3M1VA 1CS4A 1S72I 1I3QJ 4AT1B 4XONA 1WJ5A 3DFGA 3VPRA 2QMXA 1VQ8I 3BKUA 3OIOA 4JOUA 4PK4A 4B3RF 4DL2A 4L9JA 4FVMA 3WHBA 3G1MA 2HVEA 3BBBA 3UVJA 1TTHB 4KNYA 2ACMA 2X7IA 2V69A 2KL8A 1XSDA 4ZPVR 5KFZA 1EZZB 2VQEF 4ZS6A 5KFFA 3BTJA 4C8LA 1MMDA 4P71A 4NYOA 2DB1A 4QWDA 1TTYA 4RBUA 4U0YA 1UW9A 3M6WA 1TLHB 1RT4B 1V9OA 3H98A 2VT2A 4I0AA 4OZJA 3HZJA 2E2JJ 2CPYA 3WU0A 3CMYA 2UXXA 4RAZA 2FHJD 3I6PA 1RHQB 2XMUA 2G9OA 2XMVA 3DLAA 1WKMA 4HQMA 4MIAA 2L48A 2JRSA 2MYFA 1U1RA 3IH4A 1GQEA 3VALA 3RB4A 1G6BA 2Z0GA 4USMA 2LBFA 3ZCOA 3IS9A 4Y2AA 1Z91A 3KLEB 1SKUB 2OUMA 3MUVP 3J81Y 4X4PA 2C3MA 1IV8A 4C3JJ 2PA8D 1LW0B 2LQBA 3MZ8A 1QVFR 3QIDA 2KH9A 2EIJH 2IMWP 1IKXB 4LFAF 3H9QA 4IDKB 4NBQA 2W4SA 1RQ0A 1JJ2R 4B44A 5FD5A 1FSHA 2Y0MA 4W98A 1WEXA 1JNZB 1T08B 3OQ2A 4EI2A 3ZQHA 4JV0A 2Y1JA 4B9SA 3BR0A 4DIQA 3CULA 3HHNB 2YPRA 3WU1B 1HPZA 3AA9A 2F3JA 3SCJE 5A2QZ 2B6AB 3C6UB 4II3A 1MH3A 1T38A 4ZJOA 4IH5A 4EJUA 4BS9A 1KVIA 2BVLA 5IT4A 3F22A 2LLZA 4OLOA 4E8UA 2MLKA 2AYEA 4CDGA 4ECXA 2PMZA 3LANA 3Q24A 3CMES 4C9DA 3E01A 1X4HA 1ZAWA 1D9AA 3M8EA 3DRRA 2QZ8A 2PJPA 2DNGA 4K4TA 3BG7A 3H1CA 3HM9A 3QT5A 4ZVSB 4ZDOA 3S32A 4OYIA 5L1IA 4WKYA 2UXBJ 2GV1A 1E17A 1AUSL 3KYDB 2HR3A 2BEFA 1TV6B 3UD5A 4A3IJ 1RBAA 4WF2A 2VJ5A 2KT5A 3LO3A 3ET6A 4DYRA 4LFAJ 4M5IA 3U1KA 1V5EA 4QOTA 4P96A 4RB3C 1RK8A 4G6TB 1I5ZA 3VAGA 5A8WA 5IM0B 2QSWA 5HQMA 1R5HA 2J0SD 6FD1A 1HBXG 1KP6A 1LUJB 4DR3J 1UFLA 1HA8A 4IFVB 3MQ0A 3LALA 3J80Z 1G3TA 3QLHB 4ZP9A 1W26A 2WVEA 3TUJC 3DGVA 4N0BA 1DQAA 4EATA 3M8SA 1JXSA 4OV1A 1VBXA 3D0GE 3BGUA 4BCAA 4Y7NJ 2YNHB 1I39A 3I5CA 1KU7A 2FJBB 2I10A 3VF0B 3CUNA 2ZWOA 2FMLA 2VQHA 2GXAA 2Z8QA 3Q86A 1IN4A 1K61A 5FROA 1VBZA 2HOTA 4QR2A 3UCGA 2NOGA 3M8QB 4IO9F 4DV1J 4EBEA 2CQ0A 4V1Ak 2XYPB 2EWHA 3BR2A 1YRTA 3N6LA 1JLEA 1G3SA 3ET6B 2L54A 1EX8A 1L5UA 5GAEJ 2XULA 1R23A 1SFEA 1IR0A 5C24B 2DN0A 2XM3A 5EZHA 3N4MA 3J7YI 3R60A 4DFJA 4PCQA 5EWFA 5ETKA 1T0FC 1IN0A 1S0VA 2Z57B 3M8FA 4CM2A 1X1BA 1TNSA 3PFYA 2Y69H 3ROUA 4DV5J 3PIPQ 3KOAA 3DRRB 3V4GA 1KQSR 2FQ4A 1TL1A 3GFMA 3BZCA 1WG4A 2CUJA 1HW5A 2W2PP 5DUIA 2M4MA 4D0PA 4HNVA 2MDAA 5AONA 3CIMA 1FEEA 4OQJA 5GP9A 1U0SA 2M3AA 2UXDF 4DFPA 4LF1A 3J7AN 5C25A 4KMUX 2KZMA 5G4DA 1K8AT 1VQKI 4DYCA 1QTNB 4K59A 1YRNA 3J7AO 1SC4B 1XS9A 4NZ6A 1Q5YA 3ISND 4B3MF 1KEKA 2QE5A 4ZC3A 2GBYA 4ZJZA 4FXVA 2ZBCA 2VI6A 5LEKA 1NB2A 3F6OA 3LOCA 4OI6A 4FYYB 2JLEA 3RR7A 1Z67A 4LG0A 3IKTA 1MWYA 4CH7A 1S9FA 2WBRA 4I99C 1B64A 1YW7A 2PA3A 2L3DA 3MPUB 3GIJA 3KHRA 1RWUA 4IZZA 4MEYF 3V4IB 1VK3A 5A8WB 1R49A 4B9LA 1GVDA 2BYVE 5HAOA 1E6YB 1OY6A 2AKWB 5HLIA 4USJC 3BM7A 3DLLF 4B3TF 2IC3A 2NPIA 3SDBA 2EWNA 4XLNF 1FEHA 1WC4A 3C14A 4DLGA 4Y33A 4AVPA 3ZNJ1 1FDNA 2ATCB 4B47A 1Y8QB 2BXYA 3OD2A 4DXLA 5ADZA 2XMJA 4A0ZA 3FZ2A 4F3OA 1MBEA 4ECQA 1H6KX 2MKHA 2GC8A 1Y5NB 2AX1A 1FNXH 4KAIA 3NCPA 2PMZN 3R27A 5DCFA 2YSRA 3I0SA 5LSOA 3MURP 2RREA 3MEDA 3TZYA 2FDNA 2GJIA 4LK0F 5JXSA 3MHYA 4ZPCA 1S12A 1WHUA 2XCAA 4ZVRB 3E7LA 3W6KB 1YJVA 1UEVA 3T1YF 2QQBA 2E1MC 1HNXJ 2RB7A 4ENKA 2WV1A 5IZHA 5DD8A 4CYCA 1KKHA 3KP6A 2GQCA 2LNBA 4RNNA 1X1DA 3GVAA 5K1YA 1HWLA 1PJ5A 2AV5A 3QFWA 4XAKA 3QMQA 3M4OJ 3KXDA 3T1HF 3CCWA 3P6YC 4IEJA 4RUHA 3ILJA 3DRYA 5F8GA 1ZA1B 4PG7A 4GYGA 3HHKA 3DDIA 4LSNB 4IH6A 1HDPA 3QSYB 3N97A 3CCVS 2A3JA 4NLRA 3JRGA 5LEJA 2NXJA 3W2WA 3RR8A 2OLWA 1RGVA 5KNLA 4PFPA 2R4GA 1S7OA 4E7ZA 2CKWA 2LA4A 2UVWA 3DRXA 4ZKAA 2PIIA 3CC4S 4PQUB 4F0HA 3E51A 3BREA 3P4UB 1G7CB 2E1RA 3LWLA 1PCAA 4J9QA 2F1FA 2MG4A 3O6QA 1UZCA 5BJRA 4Q5SF 3TA1A 5B7WA 3E3VA 3EE3A 4G6VB 4A8WA 2P0WA 4NLTA 3TJAA 4LF8F 3LSMA 3VZIA 1FX4A 2AEMA 4NX9A 2V68A 2W82A 3OSNA 3UDLA 4RW8A 1RHRB 2DOAA 3WDOA 4OX9J 2P6SA 2RHSB 2HURA 1RUSA 3OR1B 4OX6A 3IGNA 1X5OA 5A8KA 1XTAA 2QCOA 3ILIA 1EKSA 3IM9A 4LR7A 4ILRA 1T94A 2OCCH 2FRHA 2JPBA 3VAKA 5KG5A 2VG5A 5FB2A 4FF2A 1CJVA 4P2SA 1YG0A 1FYLA 1M1GA 3KJVA 4OJHA 5KFLA 2KU7A 1UA0A 1T0FA 5J1UA 4AL5A 4KRWA 2ZCWA 1PBUA 2WK4A 3A0BC 2DMNA 3A3OB 2D3O1 1HKAA 1XEZA 1POGA 3J7YU 1DBDA 3R5GA 4W92B 1VQYA 2VBYA 3BJAA 3P5BP 3D1OA 1T56A 4KT5C 4FPRA 2XG8A 4E4HA 4O23A 2ZC2A 4KSEB 2PMUA 1YBAA 1HR0F 1WQ2A 1T03B 1YGYA 1CC8A 2G13A 3SZ2A 2OPTA 2CYYA 4GRIA 2PE8A 1VI7A 4J00A 2HPMA 1JKOC 5D6FA 4K0KJ 2V6AA 2HQIA 3T0YA 5FFZA 4DPWA 3AH6A 2K7KA 1F9HA 2JRMA 1R58A 3DKDA 1FOXA 2ZMEB 2UUAF 1EQMA 2CW0F 2A2CA 2M1BA 3ZN0A 3MUTP 4MK9A 4ZVUB 5HVGA 3FXUA 3WTZA 2RGVA 3LSGA 1FDDA 3QWUA 2QSHX 1WWXA 2AQFA 3P7NA 1O3QA 4MTDA 4TY9A 4IJAA 4XIDA 2K9QA 4UHTA 4WXDA 2HKOA 1X4OA 3S16J 1SIWB 3V81B 2WONA 3BT9A 1WOPA 1NU4A 2HHUA 2WTFA 4DJAA 3I96A 4KN7X 2D1CA 2B7EA 2VJUA 3H9GA 4DCPB 3K2YA 2XAJA 1B0VA 4DPTA 4ZMMA 4RM3A 3RG6A 2DR6A 1LW2B 4XDCA 4ZYDA 1RLCL 5C42B 3D7SB 1BJZA 2D5VA 1B59A 3PR4A 4FKXA 2BKPA 4FS1A 5K7FA 4P2XA 1RWMB 4NI2A 4LF4J 2DYAA 2EIMH 2V8DA 3BO3A 2QLBB 3DNCA 1NXIA 1MU2A 5T41A 2R5ZA 3D6FB 1MNDA 1QVUA 4B9VA 2MZJA 1RWNB 2KJCA 2O67A 2Z2LA 3TDUC 1MDMA 2CJKA 4QLCU 3SSSA 5IP7J 2EINH 2AXLA 3NNAA 3K8VA 1UCNA 3ITHA 3U1MA 1TQPA 4TNOA 1B9NA 3H9JA 4RW9B 2M7SA 2BANA 4KQZA 2IC3B 2VJIA 4BQAA 4Y4RA 1KR4A 1N33J 2DYRH 4YIIA 4QIGA 2J8AA 1S0MA 3Q8YA 5EX3A 2RU3A 5DRKA 5LSLA 1H0HB 2PJRA 2HIYA 4LG3A 2XQCA 2W2NP 4LBHA 3RPUA 1BW5A 4J9VA 2VB6A 1XMQF 1U09A 3C7JA 1KONA 1VRTB 2M70A 1VF9A 3BH7B 4Y2MA 1KQFB 5DS7A 2WADA 1PYTA 4LF4F 4NCBA 2XSDC 2KVQE 3O2PE 4LR9A 2VE8A 2QA4I 4ZH4F 2FU4A 4YUDA 1RAHB 4UY8I 3HVTA 4C2MJ 3I87A 1KQGB 3T8RA 3ZMVA 2DH9A 5J2MB 4XPEA 3R1HA 2MPUA 3PM9A 2HI3A 1S9EB 3CDLA 1ZRCA 5E33A 5A76A 2BYCA 1XMBA 1APSA 3MFHA 2AJQA 2O9LA 1NSQA 3TVKA 8RUCA 2NS8A 2Z9OA 3I9V2 1EAYC 3KKFA 4IG0A 1NHAA 3D0SA 1P7IA 3M2RB 4PXCA 3R7BB 3CC2S 4HQEA 2OU2A 3IUOA 4PWDA 3DYAA 1FOKA 2NS7A 5C2GA 1X0PA 3KX2A 1VQ4I 4MKYA 4R79A 1J9IA 3DEEA 1QY7A 3RZOJ 2HBZB 1R89A 2M5WA 4P2MA 3JRDA 3OTBA 3ZTPA 5IT9K 4A4JA 4IUFA 1KN6A 3EXCX 1XMAA 5CPRB 3LPEA 1I3AA 1U4BA 2OF7A 4WFNQ 3UFCX 5ICGA 3O3KA 4U6PA 5F8HA 3OYAA 3HT0A 3B6AA 3W64A 2F8EX 3CC7I 2STTA 3I5BA 1VTNC 1WI3A 4C8KA 3DWLE 1HPZB 1EA3A 3OYDA 1KC8T 3SQNA 3S15J 4RU9A 2WW8A 3F9KA 1RT2B 1YO5C 3K70C 1N25A 5E5NA 2KVIA 2YQ1A 4FYXB 1RISA 4RAFA 3J81K 3I59B 5L1JA 3BGLA 1Z77A 3W8GA 2B63J 5KFMA 2J9CA 1SC3B 5DLFA 3BSCA 4IQ4A 3TO8A 4XRFA 4GRSA 4Y3CA 1BGXT 4P9FA 2LBFB 2IRXA 1WWHA 3HCXA 2DYSH 3QGGA 4JV5J 2MGQA 1RHMB 5D78A 3DOLA 4LBPA 4WCGA 5K7HA 1VQ7I 3GWCA 1W7PA 1OYYA 2AS5F 2K06A 4C11B 3CCUS 1QBJA 4F91B 1Z9CA 1NHUA 1RT4A 1D3YA 3AAFA 4C3KA 3R6LB 4RL1A 3QO9B 4D9JA 1Y0NA 1U45A 1SAXA 2DQLA 1UKUA 5LMNF 3C1DA 2EFQA 3CW2C 2E35A 4NCGB 3RBXA 3ZTRA 1YG2A 2BJ7A 1FOYA 1R5GA 1S7HA 1R8HA 1V3SA 4UOGA 3FHNA 4HDGA 4L6V3 1B8IA 2ROGA 2ZHOA 5L3BA 1FTRA 2APOA 2NNNA 3KDNA 1YIJS 1H73A 1N56A 3MAHA 3MMAA 1XIQA 1F4KA 4F3QA 2Y31A 3CCYA 4ANDA 2GX8A 3M30A 3DLBA 2UUBF 2H6BA 2ZBIA 3DTEA 1U78A 3B54A 1JLGA 4PYDA 5B0CA 2DA2A 3LP0A 3LAJA 2DCUB 2HLUA 2Z33A 4UV9A 4YEAA 4NEYA 2DXIA 3LP0B 4OYOA 1UETA 1FKOA 2X6YA 5BYSA 5ETVA 4EO6A 1LWCB 2PD1A 1SJ3P 3C2GA 2UUZA 2DO0A 4DI6A 2W01A 2JEIA 1I51B 3DLGA 4CGZA 2FGCA 1YI2S 4LFUA 3W1YC 1KU9A 4N41A 3PUBA 5C2CA 1UAWA 2DKOB 2F4FA 1WJDA 3LW5C 1IUFA 1YS6A 3M8RA 3EGZA 3FVYA 4ES1A 3VAHA 1B4AA 2NXCA 4Y2KA 1F43A 1CF7A 2E5NA 4CO1A 1U6BA 3PZPA 2KIQA 3UQSA 3JTGA 1BWEA 1V5GA 3P9KA 1L0OC 4ZPAA 4CCJA 3PW5A 1ZHFA 3JSMA 4UUTA 2LCWA 4DR7J 4LD5A 1EH6A 3G6EI 4H4KA 1QU3A 4TU9A 3DI6B 1SVLA 1OIAA 1X8DA 4KPYA 1USTA 2AGPA 2HYGD 1HNZJ 4NC6A 3CCLI 1M90T 4C7QA 2P4WA 2ZKZA 4DZDA 4KGKA 2MJNA 3MAAA 1VBKA 2CQNA 1U6FA 2XLJA 4HNUA 4A12A 3DDNA 3QBCA 1Y1VJ 2AF6A 3RAMA 2NVYJ 4BXUA 2W85A 3TX8A 1D5YA 3QWLA 1OSCA 2POKA 2HGMA 2ZZMA 5FDLA 1UVJA 2D3ZA 3V7SA 1NUEA 3NGUA 1H9GA 2EK6A 1ZREA 4V2FA 4U7BA 5A0YA 2OH2A 3CCUI 5FKMA 1F9EB 3GYHX 4L5IA 2M45A 4YHHJ 2DLLA 1NM2A 4GGGA 4OYPA 3QFHA 3TEHB 5D8LB 4EMDA 4OMYA 3CB4A 2WY8Q 4BBYA 1JLCA 2E71A 2MB0B 4XSZF 2LXUA 4MT1A 5DLGA 1EQ0A 2HWIA 1HARA 1SVDA 5A2QY 1IRZA 4W90B 3KLGA 2FF4A 2ATLA 2ZOGA 2M2BA 2UXNA 2BVZA 3BQ2A 2V4JB 3MF5A 4ED7A 4QWEA 5DO2A 1RTZA 1A9NB 4QYZJ 1S6QB 3QGPA 3HFKA 2HFNA 3K7AJ 3IRXA 3OIPA 1BD6A 3G1OA 4ZOSA 5CABA 2RS8A 2G7UA 2XI3A 3JTOA 3OXFA 3GCXP 2HS5A 4FE7A 3GTOJ 2VHGA 1KU2A 2ZE2A 2R5ZB 4HLBA 3OTCA 1FVSA 2AZ1A 3UNYA 3LA3A 3TVZA 4B1RA 1YW9A 3OLAA 2VQCA 2ZJ2A 4I7HA 4BAYA 1G59A 1YLFA 4JV1A 3FBFA 3NEUA 1VQKS 4LR8A 3DM2B 1PO6A 3KHGA 2DR8A 4N47A 1XGSA 3BGRB 3IGVA 4JI4J 4HH0A 2HHPA 2FC8A 1LW2A 5MAOA 4O3SA 3U02A 1P1TA 2OV7A 2CS3A 2Q0OA 2KLOA 4IRGA 2XF6A 2DR5A 1UJ8A 5GADJ 5KFWA 2IM3A 3D0IE 3SXLA 3E5QA 4WFBQ 2HQGA 4QPQA 2BOPA 1MBFA 3I9V9 4NZ7A 1ZZFA 2KRRA 3CCSS 1FK9B 2MZQA 1U6GA 5DM7F 4K4UA 4X4RA 4LMYA 5LRSA 4UUXA 3CDUA 3OYNA 3I4HX 1R7JA 2M8EA 5A8RA 4IRHA 3TQ1A 2YNIB 5HVFA 3W9HA 4P7TA 3WTYC 3NGKA 2W8LA 4XOPA 2PEHA 3RKXA 1BC6A 1NG6A 4O5VA 2JLGA 2U2FA 3DCFA 1VQSA 1G3WA 3GG0A 3TRGA 5L1KA 3R9LA 1NJYA 1C0WA 1FX2A 2IJNA 4ID5A 4ESFA 4J91A 3BPXA 1S1XA 3ZZPA 1VYAA 2OPSB 4RB1A 1S1WB 4UUWA 2VDHA 3OL7A 1DPRA 4B8XA 3VCDA 2XS7A 4J01A 2R7OA 2ZSIB 1ON1A 4CZZA 1QZYA 1MJAA 1GXTA 4RNMA 3SDGA 5E41A 3IG1A 2V6EA 3PX0A 3HHHA 2WONB 3AKZA 2IA6A 2L4AA 4UTGA 3CIZA 4C30A 1S9HA 2AYBA 4X1EA 1PILA 4IXAA 4KHPF 2GCFA 1V3ZA 2V2ZA 2L9VA 2E1NA 1NKEA 1T02A 4AIDA 4K4VA 5FFXA 1LQ1A 4WYLA 1OYWA 2HNDB 4WE1B 3L1PA 3AXKA 2VUGA 2V94A 1G8XA 1UJ6A 2KIFA 3GFIA 2HGNA 3ONQA 3OFGA 3G8QA 4ZJLA 4A3CJ 2FE3A 2RQ4A 1FP2A 1OO0B 4KE5A 1GUUA 3MKYB 3BJOA 3AFHA 4IF4A 4ZCIA 3WTWC 1RPWA 3RIRA 3ICLA 1Q7LB 3ZZZA 4X62J 1JLCB 5K5RA 5D3GA 4WJBA 2J5AA 3LSTA 1JQGA 4LF6J 3MPDA 3BR3A 4S05A 5CQGA 2UV8G 4QIWD 5FLVA 1RT5A 4DV6J 1VGYA 2BRLA 2CPFA 5LMUJ 2VICA 4K7QA 3SZTA 4EVIA 5J1NA 3EPIA 2NZ4A 4MQ9F 1JJ6C 4FBTA 3MEXA 1VQ7S 3SDEA 4JX4A 1X1PA 3W5YA 4F8RA 2E2HJ 3LFUA 4MYUA 3PJ9A 3LA2A 2O01C 1VHIA 1CJKA 3ECHA 4M3BA 4PFOA 4M5DB 2JVRA 5E3AA 1I94F 1Y39A 3N5FA 2VUMJ 2FD2A 3A4CA 3RTVA 2JA6J 2UUAJ 1NSKL 4J5OA 4DBQA 3I64A 1FT9A 2M30A 4CCOA 3CJKA 2RVCA 4M6XA 2HEOA 3H5XA 5B3SH 2I2YA 3HOVJ 2QENA 2YWFA 4XLHA 3FXLA 2O61A 2RAQA 2HNYA 3KEYA 1PKUA 2ZM6F 4ID5B 1KGSA 4BY7J 1Y5LB 3I0SB 3JRIA 1WG1A 1T05A 3W6VA 2NUUG 5K14A 2D9PA 4CH1A 1R1VA 3BDEA 2YY3A 2RNEA 2YPYA 3EVOA 4M6VA 3BF4A 3MCMA 2GOXB 3RKWA 1PP8F 5D0HA 1RXOB 2K3KA 2G1HA 2EI5A 2Y9HA 2CJXB 3JYTB 2V79A 1SVOA 5CYQA 4ED5A 2M8GX 1LKZA 3M8WA 3EDPA 3NAUA 3S6EA 3K17A 1B9MA 4Q8FA 2P6TA 2UZKA 2IDLA 4BDPA 2QQAA 2B9EA 2HU9A 2DNMA 1IXRC 5A6PA 5IS2A 2CQ2A 4AXJA 2FVRA 3VV2B 2ZXWH 3T5KA 1X4FA 4I6AA 4HF2A 2HZDA 1R36A 3A8JA 2Z56B 4DV1F 4O3NA 3CCTA 3OSPA 3O8GA 3MMAB 2CXEA 1PIEA 3KTQA 5J6XA 3CCQS 4N76A 2FQ3A 2XMWA 1WPKA 1N0UA 1PJ6A 1JXEA 5DQIA 1FOWA 3RSNA 3MMYB 2DJWA 1MN7A 4ENOA 2CNNB 3H90A 2C2NA 3TP0A 2A69F 4CICA 2JNJA 1EB0A 2GMJA 3BR1A 5LHGA 4N4NB 2CDRB 2U1AA 3NWTA 2XF7A 2WVBA 3POTB 1X9MA 3WC0A 1U6ZA 4Q0BB 4NPOA 3EZ5A 2R7FA 2V26A 2LY1A 3B82A 4NLPA 3CD6I 4HSRA 4LK1F 1U1OA 3CJTA 3QNWB 2Y8YA 3K4LA 3W66A 1W7PB 1KQ9A 4PAAA 4BWJA 2AZ3A 3RBDA 2WBMA 2ZZTA 3EVMA 4Y2CA 4I0WA 1RTJB 1SJQA 1YVFA 3CDHA 4BHPA 1ICEB 3KIOA 5LGNA 1LK5A 2DY9A 4CCHA 2Y9YA 2GIRA 2OIHA 5B0BA 3I59A 4R0EA 2OGUA 2K7LA 3KLNA 1H8AC 1XTZA 2W84A 3K1PA 3H5NA 1XNQF 3K1MA 3A1YG 4M95A 3D4JA 1W1WE 2RV8A 2DW4A 2HOSA 3WQPA 3HSDA 1J2XA 4RAGA 3PFIA 1RC9A 2OMLA 2J8SA 5CKTA 1DZ5A 4LSLA 2ISZA 1ZTRA 3CCJI 3Q8SB 3BN7A 3QRPA 1TKZA 2KKOA 2K40A 3AFGA 2ZE2B 3GF2A 3KP3A 4A0XA 2O8KA 2G0CA 2HEKA 2AHQA 4TQSA 2QKMB 1N77A 3GTMJ 3SCLE 3GTKJ 2MD5A 1WDDA 1JKPC 4I2QA 2EZHA 3SMZA 2HYJA 1A0OB 1TL3A 4BXFA 3QYBA 2KKHA 2QBYA 2FOWA 3KYCB 3EJMA 2HRUA 3H0GJ 5ETSA 4V19J 5KK1A 3M32A 1XDSA 4KJIA 3AOCA 1U3EM 1MWZA 3M32B 2KRHA 2LH9A 1UZDA 2CRLA 2UVVA 2NYIA 3C3LA 1AUDA 1NCLA 3FXJA 1IQZA 2VBWA 3B78A 1RT3B 2P5LC 2ESHA 2CFXA 3K89A 1KHVA 3I0TA 4FPIA 4XLCA 2DK5A 3IP4B 1NK5A 3DLLQ 4LLGF 5HL7Q 3LH2S 2XAFA 2CV2A 4B09A 3KG1A 1K6YA 2AP6A 2E5LJ 4B9MA 4OIXA 1TL8A 3MPYA 2DNPA 1PAEX 9RUBA 4B3MJ 3TO6A 2Z58B 4BWMA 3LQRA 2DH8A 2OQRA 3RU0A 4DR5F 4EV0A 3LGMA 1G3OA 1OYIA 2QL5B 1M1HA 3CGIA 4OIQF 2JSXA 2PJRB 3ZQFA 4E70A 5FDLB 3WE3A 1VQMS 3I71A 5F0CA 3LPYA 4WFZA 4FX0A 2W9CA 4EMSA 5KFOA 1FHTA 2AEJA 4NC8A 1Z2ZA 3BQ0A 1K4SA 1QJHA 2XNQA 4ZA1A 1JLGB 5E7OB 4M3EA 2GW8A 2HXOA 3CJTB 2R7VA 4DG1A 4RW7A 2F5CA 3MEEB 1W36C 3OYHA 4ENJA 3DI6A 1IDZA 3C15A 1ELOA 4A5MA 2JUGA 1T95A 4DUYF 3PX6A 3FHZA 3HHLB 3OFHA 2KO1A 4JX5A 1S1UA 2M0GB 7FD1A 4HL9A 4LIRA 2HQ5A 2LF8A 3J80Y 1T9VA 2W25A 4NI2B 3GJSB 3LTOA 3A2KA 1ZGWA 3VVTA 3C6UA 4MFDA 3H20A 2M0CA 2J76E 1Q79A 3DGPB 2XMMA 1U26A 2JA2A 1PGZA 3M2VB 3K8WA 4DPXA 1TKTB 2FBHA 3SXYA 2BA9A 1Q5VA 1S59A 3BS9A 4Q44A 5KG7A 4ECTA 1SVMA 2KHDA 3G4SI 4W1UA 2JSPA 4BEHA 2YTCA 3G82B 4EBCA 3BJYA 4E7JA 3W5ZA 4NYZA 1LFBA 4Z7YA 3TYTA 3KLIB 4BU2A 3ULQB 2CPIA 2BKNA 3UN2A 2DRBA 3PO2J 2R7ZJ 2UUCF 4XSXF 1B70B 1X31C 4OYAA 5KT2A 3HGGA 4D7MA 1WC0A 2R7TA 1YWXA 3J7ZT 4EM0B 3K58A 1X1AA 2FY8A 4RUAA 4UZBA 4L9TA 3BSOA 2EG1A 2J6SA 2YX7A 5F3ZA 4LF7F 1RA7A 3L2CA 1M5HA 2NRAC 1JUMA 1YHQI 4HI1A 4EQQA 2TCTA 3S3NA 5HJXA 2QYGA 1T03A 4X4TA 2JC0A 3MWBA 4ZCMA 4UOFA 1RKIA 4R5PB 4XKBA 4DV0F 3AD8C 4M1KA 1IBKF 1KLMA 2HDCA 2X1BA 2FB0A 4MH8A 1RWWB 1WC6A 1B72B 5B0EA 3ZOBA 2FVSA 1OCZH 4WXWA 5HN0A 2ID3A 4RW6A 2YWWA 3ZR8X 3S01A 2MQQA 2QLZA 1SUQB 4BUPA 1ZK8A 3L2WA 1IKVA 2YKOA 2YKMA 1XMOF 3HSRA 2DNHA 2LXIA 3RTRA 2ZC4A 2HMIB 4XORA 4KDPA 5HVQC 2LY9A 3P3DA 2I8EA 1GXUA 5GAHI 4X62F 2CPEA 5HLFB 5IT9U 4J37A 2BM0A 4G12A 2FXAA 3EYIA 1J2VA 3CJSA 1S57A 1FNNA 4U96A 4IKAA 1MROB 2LDYA 3GCWP 3H4BA 3LA0A 2UUWA 3BR5A 3DXSX 3AOAA 2JA8J 2O6GE 4RB2C 1S7IA 1EF4A 2OPRB 3IMQJ 1KOHA 1B72A 5F27A 3HHLC 2NVQJ 2L7MP 4F7ZA 1QZZA 2KP6A 5CHCB 4BKXA 1J5EJ 3HTUA 3TR5A 5DM6F 3V7RA 3PJRA 3MR5A 1YRUA 3DBRB 1IXKA 4UB6C 5GAGU 4DQQA 4DSJA 5IOLA 5FD6A 1D1BA 1RRJA 2RMLA 2HFUA 4OYXA 4LUBA 4TN2A 1L3TA 1Z0XA 3FFIB 4CI0B 4ZLPA 2JHEA 4OX9F 3LFKA 3A1YA 2VQLA 3BV8A 2E1MB 5DTDA 4NL5A 2ZVIA 3O2IA 3OSGA 1HW8A 2OFHX 4JI0F 3HSFA 2E5JA 5AE1A 3VZHA 1UTAA 3Q23A 1VQ4S 4XDDA 2RKHA 2OFGX 2JJ7A 1H89C 3HSEA 3B4DA 3VYSB 1RWVB 4XK8C 4X6AJ 3DLKA 2QIFA 5J4VA 2H5EA 4JI3F 3W62A 4NLDA 1HNVA 3CCZA 3EUNA 3RZAA 3KZIC 1QAXA 4PWDB 2DFEA 3OFEA 4RA2A 1SANA 3BDDA 2UXCJ 1BC7C 1WGXA 1GMUA 3TARA 1CBKA 3GLXA 3N79A 2RKIA 1N32F 1ZRDA 1YYVA 4ZHRA 3HRTA 1Q86T 1KZHA 1CJTB 2FJDB 2OZ6A 1S1XB 1H2TZ 1JIHA 3G73A 1FFGB 4M5MA 4ZDPA 2RQKA 2C2ZB 3ESWB 2LQ8A 4Y65A 1UCRA 1GXQA 2ZC3A 5HBMB 3PNVA 2AT1B 4B9TA 2J6UA 2VT3A 1MMLA 2VIHA 5F0HA 1Y3KA 4QWAA 4UUSB 2ME6A 2WSFC 1D5VA 4LFCJ 4RUCA 2W8KA 3CCSI 2BANB 2A2DA 1IKYB 3R61A 4LRAA 3CQZJ 3K59A 2R4FA 1JWWA 2F2EA 1CQTA 2X3DA 1MSEC 2DGTA 3HVAA 2FY1A 4M5JA 2YNIA 4OZ0A 2UUCJ 1IN6A 1Y56A 1TWFJ 5C3EJ 1IN8A 3MZYA 2LVSA 2WAQA 4AIHA 3PYGA 1JT6A 1RYRA 4Y2IA 2B7BB 2F5FA 2Y8WA 3M6UA 3K4BA 4JI5F 1ETQA 3FK4A 1CG2A 2CFOA 4QPOA 5HS8A 2JA7J 4IHTA 3G6ES 5F0WA 5GMEA 4Z7CA 3GO5A 2JEFA 1WHYA 2QLXA 5CYJA 2E29A 2E1OA 3J7Z5 2A6OA 4ILMA 1CC7A 5IXUA 1IUYA 1OJ4A 1DLOA 4DFKA 2DNOA 4A2UA 5A0YB 3R0JA 4IYQA 3OYEA 4CLKA 3ZZTA 1LB2A 3ISNC 5L8RC 4J7CA 4EU0A 2VBXA 2R2SA 2HGLA 2DOFA 2L4MA 2W7AA 2HAFA 4IOCQ 2CWKA 4IOBA 2GO8A 2LYVA 4RBOA 5KG4A 1LXNA 3IRXB 1LFWA 1NDKA 3ABKH 3CD7A 3COAC 3HLUA 3A4TA 3CC7S 2MLGA 3MOJB 1OR7A 4GKJF 2R7XA 3GYNA 4ZITA 2HNHA 4GFBA 2XS2A 1BLUA 1E6VA 4BYYA 4H54A 5G0RA 1VC0A 4PPZA 5LGUA 3DHWC 3OYLA 5K8PA 2WVCA 4KIGA 2CUZA 2Y0SA 5E79C 2HG4A 2HHTA 4DUZF 3K70D 4LGWA 2UV1A 4B3TJ 3VR1A 5HP1A 2I9SA 3BKTA 1D0YA 4H0EA 4G1QA 5L9XA 3KJFB 5J1PA 1CF7B 4LSLB 1T05B 1FD8A 4CDIA 4HRIA 2W4PA 2ZZNA 2WB1A 1HHQA 4HHHA 1NSAA 2D1HA 2RRBA 2JZYA 1Y9OA 2RJZA 5U47A 3C46A 2IT0A 2J7WA 2D2WA 2ADBA 2QV6A 1N88A 1BJAA 3CJ3A 1T6SA 1TZ0A 2V7FA 1XJWB 3PRBA 2W2MP 1F3FA 3H5UA 2FBKA 2FZCB 3TP3A 1Z1ZA 4ZDLA 4LF8J 1ZLJA 4LFBJ 1K1QA 1X19A 1O3SA 4DN0A 3WBZA 3BZQA 2ZJRF 1T9WA 4YFUA 3HP6A 2STWA 2Z2MA 2P7VB 4DU7A 3H7HB 3TDZC 2BMBA 5I42A 1IXSB 4NUBA 1OQ6A 4JUZA 1DTQB 2BGCA 3HK2A 3DQVC 2ZB9A 3U2RA 4UT4A 4ZIWA 3DMJA 2BBYA 2ESNA 2CA9A 1S5LC 5FKLA 3GQCA 3EPZA 4P7VA 2GHWA 1I5OB 1K44A 3M2UA 2LK2A 5L39A 1Y11A 4DR3F 2HWTA 3HRMA 3KLHB 4YP3A 2CMPA 2X9DA 2XHCA 2FX0A 1TKDA 5I3PA 3PW2A 3UWTA 2OTJS 4PWUA 5A2QU 3Q9VA 4F4WA 2D45A 1D0ZA 3QQAA 4YFXF 3M9OB 2ZFUA 2R8IA 1TELA 2V4RA 4CO8A 3WU2C 2IFXA 3PNTA 2Q8KA 5KT5A 4ESBA 4AXIA 3CZ6A 3K1NA 2H51B 3FF5A 1NO8A 2HK2A 3BPSP 2HVHA 1BE4A 1Q16B 1QGPA 2CQXA 4DL6A 2DGSA 4JK1X 3WGIA 2P7CB 2FNAA 4FS2A 3OLBA 3HTSB 1GV2A 2CSOA 3R1LA 1X9SA 1S0NA 2OO4A 3RKYA 3H2UB 1K6OA 4KFBA 4OHXA 1OPCA 4BGDA 5JHUA 3TP2A 2KXHA 1ZBTA 4WF9Q 1Q0NA 2YBVA 4O0NA 2BXZA 1T0TV 4K4SA 2XTJP 2B43A 5GVQA 4KA4A 4CIOA 3KLIA 2NLWA 4DYQA 3NMRA 4J9PA 4XRSG 5L3DA 2WVDA 2BM1A 2BZ2A 1ZR4A 4CYCB 1OY9A 1MWQA 1ETWA 3AAWB 2HNZA 3GJQB 3RKQA 4Z6YA 1X3ZB 1CJUB 1AW0A 4JV5F 2HQRA 2BRKA 2MXYA 4XL9A 3IBWA 3PKYA 4WK3A 5E3NA 3BYPA 5C25B 1S99A 2ZUAA 3S1TA 3U9GA 5LD2C 3TAMA 2ZH7A 3AL0C 1S10A 2KL4A 1GFWB 3BN4A 2XCPA 2MH9A 4NCGA 1G4CA 3NCRA 1RWOB 2RNGA 3ENAA 3HHLA 2WB1D 1QHHD 4UZCA 5F8MA 4M5NA 2MSSA 3QPLA 5IC4B 2L3MA 3S14J 2KRFA 4GDFA 4NMXA 4GXOA 4K5RA 1Z7UA 2HHHJ 3ECOA 1M5SA 2B51A 4C11A 2HKEA 3JRAA 5F8NA 3UDCA 6FDRA 2KFDA 2V34A 3BSAA 1RTDB 1JLEB 5CQEA 1YBTA 1LWEB 1UG0A 1RAGB 3OS2A 2GWRA 3NMAA 1BQMA 2IPOB 3D66A 2UUBJ 4DV5F 2FUG2 3R0AA 3MEKA 2RQCA 1XSXA 2H6CA 3HVTB 2BR0A 4TQRA 5LGTA 4KH0B 4F52A 4JYAJ 1BOAA 2L7FP 3KE2A 3ZXWA 4I76A 2AO9A 2QGUA 5JMNA 1FRMA 2Q1LA 2YNHA 2AGQA 1U8RA 5TRDA 2ZXJA 2JQ7A 4I68A 4X66F 4MGRA 4I02A 1H0MA 1KSPA 2GLOA 1X4BA 4CCKA 4DPUA 4DR2F 3F44A 2JVGA 1JGSA 4WXOA 3BG5A 2Z1DA 1LWFB 4L75A 3MECB 1TU0B 4XKWA 2JTVA 4DMZA 3CJNA 3DXBA 4WPAA 4O4GB 4UNOA 3FXMA 5FGMA 1O4XA 2JPCA 4LF6F 3JQJA 4N56A 5J1RA 1F6TA 2C2MB 4IVNA 3ZMTA 2D74B 3TW7A 2XY7A 3VWSA 3GU0A 3Q0AA 3CJQA 1NH7A 4RBTA 2I5JB 3QIPB 2O0YA 4B17A 4YN3B 5ETPA 2KIUA 2PI5A 2CIMA 2LREA 1MKMA 2HAIA 1LV5A 3KP2A 2DT9A 4EBDA 3PM1A 2UVUA 5BYQA 1R8CA 5ETRA 2RDJA 1EJ9A 3EUHC 4OMFG 3BO2A 1V54H 1W25A 2CVEA 3D1HA 5GTHC 2WOMA 3JAMY 2E5IA 2VOPA 2NVTJ 3PXGa 1MJ9A 4LF2A 4M5KA 1BI2A 2LY2A 3KLFA 1VRUA 1FRKA 3GTPJ 4ICLA 4M9ZA 3O1LA 4RW9A 5AIPA 5BS6A 4Y17A 2VG6A 1RABB 1RTDA 1YW8A 2W57A 3CCMI 1VQLI 2BUNA 2HTSA 2HWVA 2L01A 5HQ8A 4RMNA 1GTHA 4CYUB 4G1IA 3D2WA 4ECWA 4ED4A 3GMEA 3TZWA 4AYBA 5BOXA 3UDEA 1V5VA 1BI1A 4IFYB 3L7PA 4B02A 2LKXA 2WSEC 5L3FA 4C4WA 2ECBA 3VEPA 2AEFA 5M2UA 2YKAA 3OS0A 2MQOA 4JI0J 2MLYA 2XGQA 5M5WJ 3MM8A 1YRXA 2F5DA 3K4CA 3HKWA 3GE9A 1RKWA 3F6VA 3IR6B 1FIAA 2JK3A 3DRSB 5HBMA 4EZ6A 5IP9J 5C4XJ 2V2KA 2DPDA 1HBOB 2DGWA 5T7LB 3E5UA 2GHVC 4WXHA 1K7AA 4DX8H 4K0KF 2QN6B 2FC9A 4I0BA 4DX7A 2DTRA 1T98A 2DXEA 3EDRB 2E9ZA 4UVAA 1BMQB 3PCOB 4UB8C 1PUFA 2B4UA 4LOCA 1R1UA 5DUKA 2J7UA 1S77D 3HG9A 2LU1A 3RAQA 3BDPA 4LVOP 4ZPDA 2GA1A 3CCES 2BE7D 4EYIB 2M4KA 2VOOA 5IPAA 1JLFB 1AXQA 1XMOJ 4O4GA 4IO1A 2VPWB 1FX7A 4RWXA 3CCJS 2W1BA 1P27B 3N6MA 3JYTA 1XNQJ 2IIHA 1KQKA 3C8YA 1F3VA 1ZGAA 3SSRA 4ELVA 1JTXA 1PYSB 4UQTA 3FMRA 5KOXA 2EJRA 2MY8A 1JKQC 1OCPA 4FE4A 1B1BA 1AZSB 4K5SA 3RBEA 2M34A 3HOUJ 2CG8A 2EVZA 3GPAA 5CCMA 3E97A 4KTQA 2VF3A 1WSRA 1J5OA 3HXLA 4F4AA 4I2PA 3GB0A 5HLGA 3DHXA 4NLQA 3KK3B 4L9NA 2FQQB 1I6XA 5BYRA 3QPSA 3M2UB 4I6YA 3ZO7A 1GMWA 4B3SF 1JUSA 1T11A 2YNGB 3HULA 4C0HA 1AA7A 3F23A 4CLSA 4CM0A 2VD3A 1WJ9A 3ZC4A 1R6RA 2D3UA 4K4WA 1IRXA 1SI9A 3DOLB 3IAM2 7AT1B 3HZEA 1SL1A 1ZAVA 5M2RA 4J9KA 3W5XA 3FCVA 2DHXA 3HMJG 4PYAA 2E36A 1ZRFA 1LWXA 2IS2A 1SIZA 3RW6A 3ZTOA 4RLEA 3J81Z 1D3WA 4JI7J 3LNQA 2QFJA 4F0KA 2KHMA 3Q8PB 1P6RA 3JSMB 3AB2B 2J0WA 1FTZA 4O3MA 2PEBA 3F0CA 1WCMJ 3O6BB 5FLXU 1WACA 2DT6A 1X58A 1O51A 4FDFA 3CE8A 1KLMB 3BQYA 4RW8B 3MR6A 2C2KB 4KT0C 1MBHA 4OYZA 1U2FA 5D3GB 4XKVA 3N5BA 4C0BA 1Q1VA 3MVPA 1FNOA 2IYIA 1Z4UA 3OL9A 2P8TA 4AD6A 4L72B 1KNZA 4B3SJ 1YLXA 4B3OA 4ZVEA 2DRDA 2L9DA 4PR6A 4ZK7M 2HFZA 4ZTJA 1TT5B 4YQWA 3TAQA 1SQEA 2W9AA 2YX4A 3EUHA 1RUNA 4OI4A 1RHKB 4USWA 2D9OA 3E2EA 5IYDJ 2BACA 2CADA 1G2EA 4S04A 1MBGA 3UI3A 1O3RA 2HNDA 1NRKA 2LKSA 2G9WA 3EICA 3UR0A 1RESA 3HOYJ 1BR2A 3T5JA 5E3LA 1VQ6I 1ZR2A 4ZVOB 4EGLA 2ZNZA 4DL7A 1R6VA 3G82A 1WF0A 2GQQA 3EXYA 2WVFA 5EG0B 2JRTA 4M3DA 1PYOB 5FRMA 2LP0A 4IRDA 1DPUA 1D9DA 2KXNB 4BDZA 3GTGJ 2I38A 2XZTB 5J40A 1W0TA 3BLYA 1X1CA 1NK2P 2E5GA 2Q6CA 1R0CB 3HL2A 1GVJA 1N52B 5AXMA 1VJWA 1EV7A 3V8LA 5JVGF 3IH2A 3GP9A 2ZHBA 4P52A 4D5FA 4HT7A 3ZQLA 4M71A 3QT8A 4LIUA 3OL4A 1P2FA 4RW7B 3CJ8A 4F02A 3EZOA 2DCEA 2RH3A 5HS9A 3JB9k 2VJVA 3D54A 3DLJA 2C22A 2R7WA 4YS2A 1ON2A 3HJVA 1OCCH 4LRCA 5LMNJ 3JCUC 2Z4PA 2KJVA 2D7SA 2WB1N 1CQNA 4A69C 1A31A 3GBGA 2LKZA 2M9KA 4E7LA 1RZMA 1TUWA 3JW4A 1GT0C 5K8MA 4HNTA 4H4OB 1IKWB 5E3PA 4PXDA 1G3YA 1TWAJ 1TL5A 2C2RA 4LF7J 3T9NA 3M8QA 2NREA 1NJWA 2OI2A 3HKZN 3JTHA 1YRNB 3C2HA 2WV0A 1Y1WJ 1H7XA 3RJPA 2CJAA 1T9XA 4C3MA 4K8RA 2LECA 1SKRA 4KMFA 1VFCA 1XBWA 4G1QB 4P72A 2ZFHA 4CH0S 3C16A 2J6TA 4FETA 2ZOFA 3LSJA 1ITYA 1RAJA 2HQCA 2QQ8A 2DNNA 1GK8A 1VQ9I 3K6GA 3S8PA 4KH1B 1TFWA 5IQ6A 4ZYHA 4GKKJ 1VFJA 3AY0A 2L7ZA 1G6NA 2RDDA 2CV0A 3T1AA 1KFSA 3QIPA 4DNCA 1B0PA 3KP7A 4OZ3A 5DZ6A 3THVA 4LF5F 3A03A 4RU2A 2LRDA 1H7WA 4DV7J 2CNKB 2VE9A 1NG7A 3M2RA 1TUVA 2WCXA 1F5BA 5KFGA 5GMDA 2BJ3A 4YRVA 4G94A 1VQPI 3I54A 1OKRA 1MBJA 5ETNA 5M5YJ 2ZJQF 5F04A 3BQZA 4JBAA 4FN5A 2XRLA 5KFKA 4C97A 2F4MB 4Q8EA 3CCQI 3HM5A 4DBRA 3NOCA 3SI8A 1FO1A 4Q43A 4G1PA 1Q95G 3HIFA 4P73A 4YEJA 3D5MA 2EZKA 5D5VB 1Y00A 3DRPA 2F63A 1N54B 3MR3A 3C6TB 1K0TA 4NEZA 4F55A 3GSIA 2CZVC 2LA6A 3FZVA 5HROA 3NG8A 5IQQA 2KHCA 3QPTA 5E1WA 3GONA 2GMLA 1KDNA 2O3FA 5CVUA 5LXYA 2EFNA 4PGHA 4CP5A 1NKCA 3G4SS 3EVWA 2OSQA 4WZQA 3CJRA 1GX6A 1JTYA 2DAOA 5KFJA 4YR2A 3H5RA 1IKYA 4OAZA 3RI4A 1R4NB 1S7EA 2DHSA 4C8NA 3CD0A 3PEHA 3EGVA 4X4NA 2Q43A 2VQFJ 3PSFA 4KICA 2YQ3A 3BTIA 1WI6A 3QJLA 1HNWJ 4GYIA 3IV5A 1EETA 3M07A 4U7DA 4B4CA 1JI8A 2PGCA 2FHKA 1F60B 2HRTA 2R2UA 2Y30A 3TEGA 3I53A 3QATA 1WKJA 3WTSC 2ASDA 5BNGA 3ZZOA 3O3LA 3TVYA 3OTOF 1WSUA 2DGXA 4W97A 1Q53A 1K4TA 1JHFA 2VKDA 4XICA 1VQ6S 4CNYA 3MAJA 3GR0A 3R6SA 1CJTA 3HO1A 2B4PA 2ZJPF 1CJUA 3ZMUA 4ECRA 5HMXA 3KCCA 3RBZA 1VS3A 1MMNA 3K10A 4OX7A 2VPRA 3UVJB 3K4KA 5CD4H 2X4HA 4ECSA 3FJ2A 3S1MJ 2L02A 5KG1A 3MKZA 1FXDA 2P81A 1ZM3A 2K7JA 4R8UB 1IKXA 3QJPA 3S1RJ 1B7FA 4DS5A 1CS4B 3M1VB 2OPQB 5E8GA 2DNKA 1Q78A 3QT6A 1IM4A 3MCNA 1ZETA 1BR1A 2MA3A 2XROA 2EKNA 1YJRA 3HC7A 1FKOB 5FJ8J 2E2IJ 4F50A 1EHWA 4GMKA 3MPVA 2EPFA 1XG1A 1V3FA 2XSFA 4F4XA 1Q82T 2Y3YA 3KLEA 2OSRA 4LFCF 2IJRA 4NOHA 2BJ8A 5M3FJ 2EA2A 3H59A 4DFMA 3GV8B 2KXFA 1NK4A 1RWXB 2V63A 3OTEA 1S6UA 2AJ1A 1GHCA 1KU3A 3HPOA 4OJ1A 1RI7A 3TWZA 3H5SA 2LG4A 1KVJA 3SFZA 1T2KA 2HPUA 1MLAA 1U02A 3TBIA 5FD1A 1Q1HA 1HL6A 2DMTA 1VBYA 3DP7A 2C28A 2DHAA 2OZUA 4DF4A 5GTIC 2DEJA 4RS8A 2QRRA 5D0EA 1VISA 3CJKB 4EEYA 4QR0A 2PT0A 1N36F 3NBPA 3CMAS 5GAHJ 1UWAA 4DX5A 2IW5A 3CJRB 4OV6A 3I55I 3KK1A 2VG5B 4FASD 1DTQA 4JV2A 1BN5A 1KVKA 4FYDA 4OHZA 2Q6BA 3ABMH 5BXIA 3HD2A 4OI0A 4RW6B 2IM0A 3TA0A 2ICWG 2V8VA 1NK6A 1OFCX 2DPIA 2VG6B 3ABLH 1A35A 4JI2F 3QAHA 2ELHA 5IYCJ 2FSWA 3N01A 1VQPS 3PIOF 4TVAB 3VAIA 3SHFA 2EBEA 4UF4A 1IQTA 1SEUA 1S79A 3MM6B 5AT1B 2LXFA 2IAIA 3K4JA 5SZTA 1HBMB 3PNYA 3QOEA 4LF5J 3WGHA 3S1QJ 4U7UK 4YFNF 1UJ4A 4OZ2A 1XC5A 1D8YA 1EH7A 1SH2A 4DR5J 1G1XA 4CTAA 3ZTSA 1J09A 4BQQA 1BQNB 1BIAA 4PZVA 5TJJA 3E6MA 3OVAA 4UOHA 4DUYJ 2W00A 4ILLA 1H72C 2RRNA 4UV8A 3GYGA 2YKNA 2LYCA 1NKBA 1E6VB 1WHWA 4M9SA 2XC9A 1PC5A 4OHVA 5EDNA 5KAIC 2AQEA 2IS4A 2MLXA 3F8BA 1YTYA 4TYBA 3M9AA 2VIXA 2BHZA 1E0EA 2OBPA 3AQOA 3CJQB 3OPKA 3ELHA 3MEGA 1X4PA 2IAJB 1WELA 4OYBA 5EGOB 3HB9A 3GX4X 4HI2A 2IA1A 4U9RA 3HYIA 1LPQA 2RN7A 1XWLA 3BZ6A 2YU9J 2RD5C 2XSJC 2EC0A 5J4YA 1N5YB 2XB0X 3FEXB 1S29A 2ZJRQ 5I3UA 5J2MA 4PUSA 3VQTA 2G2YA 1URNA 1U0HB 4QBUA 3PHEA 2QA2A 1U47A 1DRZA 2M5YA 2O3DA 1B7YB 2XYHB 1YIOA 1TK0A 4O6JA 4HOBA 1F5CA 3BSNA 2E19A 2BE5F 1S4FA 1XMKA 5AXKA 3IRWP 4LRFA 4IPAA 3JRFA 4G3IA 3A12A 1HW2A 3NEKA 2VKVA 2DGUA 2R7RA 3ZZRA 2DA7A 3HSZA 4HEA2 2B4OA 2CQDA 1KS2A 3BR8A 4YG2F 5CYMA 2MC4A 1UHMA 2ELJA 1XR5A 1QA6A 2KPMA 4Q48A 3TZXA 1OCOH 2X85A 5D6EA 2RAEA 3Q89A 2EFGA 2COLA 3EWGA 5CYMB 2G2OA 4Z37A 1UFKA 3GWZA 2CQIA 4XLEA 5DGAA 3TQNA 2PO4A 4PRFA 1AROP 1H88C 5D5UB 1BQXA 4V2GA 3I55S 4FKYA 4WTYA 2VKHA 4LT6A 1BC8C 2WAQN 1OPIA 4MAKA 3DXJF 2V0NA 2BJ1A 2OPPB 1YJNS 5TISC 1Z05A 1FT8A 4A47A 4WWCA 1HWUA 5CZXA 2ISYA 4NA1A 1BUXA 4ZLJA 4P9SA 1FDAA 4CLLA 1D09B 2XUBA 4OI2A 1R8BA 1E3HA 4Y52J 1SD5A 2DK8A 5KOWA 2V1UA 3ZZ0A 5FKOA 2NS1B 5ICFA 5LL6d 4ZLNA 3EYYA 3MKLA 4AE5A 3QSIA 1XN7A 2R93J 3EYZA 3AT1B 4HR2A 4URQU 3GLJA 2BVMA 2LOOA 1IJFB 1RDRA 1RT3A 1DQ8A 4DV3F 2UUTA 2KG1A 2GVDA 3KUEA 2O8XA 2ACYA 2PFDA 5IT0A 1EP4A 1TL1B 3NAHA 1UJ5A 1RWPB 4Y15A 1ETXA 5D6GA 2K9SA 1LJ9A 2L9RA 1KTVA 4IQMA 3F41A 4RUBA 1OS5A 1WJCA 2X1EA 1R0BG 1IAWA 5LJ5Y 2AYGA 2RDPA 2VDIA 3CJ2A 1SL2A 1S1TB 2IP2A 4NRTA 2BQ3A 2ZEJA 2NR0A 1BWVA 4QYRA 3ZZYA 4RLFA 4HW0A 4E98A 5DCMB 3TL4X 3FFIA 2RILA 4GCVA 4DQIA 3GIRA 4CT9A 3Q9SA 2VFRA 3SQGB 2DIUA 1SJRA 2A6TA 2VQFF 4A6EA 2QJ3A 1N33F 3RRGA 4LRBA 1KWMA 2GJ2A 3AJ2A 3RW7A 3K5OA 3MOZA 3H3UA 1VQMI 2QYOA 5JR3A 3M05A 4HDHA 2EA4A 1SD7A 2ZNYA 3R97A 4PJ0C 2KG0A 4RBVA 3CTRA 1QNTA 1WTBA 1TP4A 5L38A 2MSYA 1XC9A 4QWBA 4YDDB 1ETOA 4CLFA 2RRAA 2V67A 3H40A 4TLRA 4DHVA 1WDTA 5D5XB 3VHQA 1U24A 2X1FA 2IXSA 2LEBA 2XMAA 3EM1A 3W6JB 3ETOA 1DFDA 2B0GA 3MD2A 1IN5A 1MG7A 1GEHA 4H4MA 3PW0A 5DETA 2ZH1A 2XGXA 4WFYA 1ZTTA 2UVRA 2XNRA 1HD1A 4HF1A 2XAHA 4O4RA 1YE9A 1JB0C 2V9PA 2UXCF 5AJ3F 3HPHA 1XNRF 2ZJPQ 1LKXA 1UMQA 3MR7A 3H4DA 3LL7A 4FBUA 1HQEA 1SUQA 5M5XJ 3OL6A 4P1WA 1VHFA 3CTAA 4X64F 1YJ9I 3EMTA 4OHWA 3POTA 1IGNA 5H9FK 3EUKL 4A48A 2QF7A 2GIZA 3E01B 3AJ1A 4YB6A 4M3FA 3UE2A 4N8NA 5CCLA 1IXCA 4NASA 5J8CA 1VQNI 1U5TB 4BL0B 4HTIA 1APLC 2QX0A 2V8PA 3L9FA 4XKCA 4TY8A 1YZ6A 1B4SA 1TL7A 4HTJA 1M1KT 1USSA 2I6WA 4U0VA 3CCMS 3WODF 2L41A 4Q47A 2HK3A 1HYSB 2X6WA 1UAAA 4OI3A 3ZGKA 2C3YA 4FYWB 5F8IA 3GZ5A 3NWSA 2K1RB 2OD4A 4ETZA 5E3RA 3BB5A 3G3ZA 3KNGA 2Q1ZB 4ED8A 1TBXA 3DOKB 3I58A 4A8MP 4EM1A 1FESA 1GTEA 2RF2A 3OVSA 5D0RA 2MTLA 4PABA 3UD4P 1HI0P 3G8TA 3LP2B 5DGBA 2O7OA 1PJRA 1T7PA 3FSYA 4FNIA 1GMWD 1Y8RB 3N05A 5DDGA 2XI2A 2CPZA 3DOKA 2GAUA 1WSVA 2QFIA 3V6JA 3S93A 4RB0A 4RX6A 3AXMA 2GMHA 2H5IB 2KFYA 2VL1A 5ETLA 2NXNA 3L00A 3D67A 2YKPA 2Z2YB 2R2RA 1JLQB 3HHDA 3LAPA 2QC3A 1ZA2B 2MHEA 1LE8B 3GTLJ 1TL7B 4F4YA 1STZA 1SD4A 3HOSA 4DCOB 2QL7B 2F40A 2QG9B 5GADU 5L1LA 1ZTWA 3PQKA 5IYBJ 2XMTA 3C18A 3C2PA 2IRYA 3W8PA 4MLOA 5GAEI 5BR8F 2K27A 5KFUA 4JI7F 1ZZNA 4M8LA 4JYKA 3DOMA 2A10A 3WE2A 1HLVA 1UPPA 3SFGA 2H1LA 5B66C 2WZ1A 3PX4A 2L0KA 3MEEA 2ASJA 2N4CA 5AIQA 3BO4A 1SXLA 5HATA 2JFDA 4E0DA 5LSRA 1GXLA 4ZP7A 2CQ3A 4B9NA 4PG4A 5JVTA 1U8BA 3R7NB 3OYFA 3L2VA 3A8EA 5DM6Q 2UU9F 1FERA 4HPQA 3M1CA 1ONVA 4HAMA 3S2HJ 4M72A 2YPZA 4X4QA 4IO9Q 2HSEB 3MN2A 3N9UC 3DKYA 4F25A 3H2LA 4GVBB 4JI3J 2ABYA 4NLGA 5DD4A 3D9BA 5J1YA 5EX0A 4ZJQA 1WRJA 5LXRA 1IUJA 1REGX 2GAGC 4YR3A 4MYTA 1I6HJ 4ICLB 4QCLA 4X4OA 3BQ1A 4X4UA 1IF1A 4AUKA 1OQYA 1JKHB 2IPQX 4I1TA 4MNUA 1UVKA 2MH2A 3G2XA 2XC7A 2DR9A 3FBNB 3RYLA 4B08A 5DQGA 2VG7A 1F2HA 1N5SA 3IBCB 1A6QA 1XQIA 2A61A 1U0JA 4UUVA 5KCMA 2IAJA 3C66A 4ON0A 1U49A 5EEGA 3B4MA 4LQ3A 2IRUA 2Z2ZA 1S49A 1HCRA 3QZ8A 3SFIA 4I2QB 4BLGA 3PYFA 5CVIA 1V3RA 1S9EA 2BX6A 1XPXA 1R27B 2RC4A 1PYVA 3CD6S 3R4KA 3MECA 3OVBA 1ZOTA 4AC0A 2XGCA 1KFDA 1M5OC 3FQLA 2JC1A 4YMEA 2KT3A 5C24A 4A3FJ 2JEJA 5IT9Y 3MUMP 5HDKA 4NYPA 2NAZA 3MZIA 4FCYA 3NXZA 2FZGB 2ZITA 3OW2R 2IM2A 4IOAQ 3CC2I 5ILUA 4I67A 2VG7B 1N6QA 4A8KA 2EB7A 4A3KJ 1U7LA 2WSCC 2A6MA 5JI6A 3FCWA 1P7JA 5KFVA 3CNQP 3HVRA 2JN6A 4H4OA 3BJ6A 4OYMA 3CDWA 4FVCA 1WNEA 1ORKA 1KA8A 3ITHB 3P8BB 1RE1B 3T5XA 4FP9A 5HDGA 3CP2A 3DDKA 2ZDPA 2Y48A 1MJBA 1PVEA 1MZBA 4CXFA 4DR6F 4AYBN 4DPYA 4D1QA 3T9ZA 2A0FB 4F92B 2XZDB 3QP5A 3OV7A 2B9XA 3NBPB 2DPUA 2DDAA 2IVFB 5CLSA 3OR1C 3LUYA 3A01A 4EJVA 4QW9A 5KFQA 1B3TA 2DA6A 3S3OA 1MMAA 1VMBA 2KQRA 3A0HC 2KFNA 3BGRA 5JLXA 1JXLA 2XY6A 3CUQB 4U87A 2K02A 2F4OB 5DEQA 3L4BC 4M5LA 2XPVA 4K50A 2MZTA 2P9CA 1XR6A 5EG0A 1URRA 3ZFVA 3KK2B 2NCKL 2V9WA 1HMVB 2XLKA 1VI0A 2BKOA 3FKIJ 4GVBA 2JVHA 4I7FA 4W4MA 1AOYA 1PP7U 3G71I 3TANA 5LLQA 2BE2B 1FWKA 2IRFG 3KP4A 3SFUA 3I56S 1NDLA 2KT0A 1YITS 3GTQJ 4PJJA 2D1VA 2I1RA 1BI3A 4JB8B 3Q83A 2EXUA 4G7ZF 5IT9Z 2HDWA 5K5QA 1S6QA 2XPWA 5ITHA 1DU0A 4Q7AA 3W61A 4WU2A 1RR7A 2WC2A 2QTWA 5KT4A 4DV6F 2VKEA 1NK9A 4CO5A 1FC3A 5L9NA 3KLGB 1X5PA 2EPIA 3RUBL 2UZAA 5HSPA 1O7FA 2V1DA 4RW4B 1R3NA 3AHPA 2YWGA 4K4YA 1Z3YA 1SPBP 2AYMA 5D4NA 1RT1B 4IR9A 1VC6A 9ANTA 1SKSA 3M2VA 2IA2A 5JLWA 3JSYA 4ESJA 1IBCB 2CDQA 1YBUA 2AHOB 5AJ3J 4MO7A 2DA5A 1CEZA 1M5VC 2QSGX 2COBA 3V2UC 4A3DJ 2HBQB 2CO5A 4QU6A 3DEWA 4USTA 1U2CA 3NS6A 3R5BA 1SH0A 3JR9A 4DSIA 4J19A 2MW8A 2NPFA 4KR0B 1H2VZ 1LNQA 2GO9A 1ZM4A 2OMOA 4LLNA 3E6BA 1UVIA 1D8ZA 4QU7A 2UXBF 3L7UA 3EZUA 1RUOA 4JOMA 2BY1A 1D8KA 4QJVA 5FLMJ 3KLHA 2QSFX 4HKQA 5D8HB 5A8KB 1RETA 4YB1P 2YUSA 5F0UA 3LQVA 1N34F 1KBRA 4E2FB 4ED2A 2CJ9A 2HOAA 3SSQA 2EIKH 4G8XA 5HLFA 3HEFA 2Z30B 2DK2A 2DR7A 2ZH6A 2ERRA 4IQJA 1OLTA 2BY0A 5K5MA 1HNXF 1I94J 2KZGA 2BY3A 3CDAA 2NOJB 4C6AA 2O1PA 1ACMB 5CVJA 3EPGA 3UW1A 2MZ1A 4ELUA 3PEJA 2MSTA 3ISZA 4EUVA 1FKPA 1NPPA 1WJBA 2P5VA 5EGYA 4M6YA 2EKYA 4MIMA 1DDNA 3OTDA 2Y0SN 4MFEA 1T3NA 4FXDA 5DQHA 4FISA 4IG3A 3WIVA 3CJ5A 2WY7Q 3EQLF 1H9TA 5IY5H 2QWWA 5HNHA 4RNOA 1Y5IB 4RW4A 1WHXA 3R2CJ 2DDBA 1SC1B 2IS6A 3KUHA 2PMZD 5KFCA 4PQUA 3OYJA 4U0WA 3KG0A 4DEZA 5G0RB 2F5VA 4J9LA 2V2VA 2V2QA 1JGGA 1WJAA 3F21A 3JTPA 3ILLA 1PDNC 2FLOA 1NH3A 1RACB 4USVA 5B0FA 4CLTA 1DURA 2RQQA 1N32J 4C48A 3RPUD 5H2FC 2OELA 3AOBA 5LOQA 4ZLLA 1BHNA 5JVGQ 3L2RA 1QE1B 1FRJA 1M0SA 4F36A 4YB7A 2ALZA 1S6PB 3D5LA 1SBRA 4GO7X 1JLAA 1Y10A 2W7NA 3ENQA 3MR2A 1FSEA 3UKGA 4R8UA 1AFIA 2LR8A 1W5CC 4A8QA 3T6JA 2KM8C 4URGA 3MTJA 1ZPVA 2MBFA 3FRYA 1N5QA 3JSOA 2DEIA 1WKKA 3IG1B 3HF5A 4ID8A 1TKZB 2IGMA 3NL0A 3MPWA 5D4SA 3Q8UA 4O3QA 3W2VA 1TKTA 2Y75A 2GGPA 4RGSA 4ZVQB 4EGYA 1SAUA 3CUOA 2IMOA 3DRSA 4ZYAA 4IHYA 3MEDB 1QSYA 2AJ2A 2WAEA 3CT9A 3OBIA 5FLXY 5HMWA 3S2WA 3Q3SA 1IBKJ 4A5NA 4AL7A 5DCMA 5F1RA 4I98B 1QAJA 3A01B 4WIIA 2X51A 1W5TA 3GUDA 2VLAA 1VNDA 2VXDA 3M7GA 1VCTA 2OPPA 1FY7A 4A8YA 3I5AA 1MW7A 2XWXA 4DQRA 1WORA 3A13A 3MFKA 1HOMA 1VOMA 2LMIA 5JHFA 2HVQA 1L3SA 5EWGA 1VQ8S 3ENWA 3DFEA 1WC3A 4ED1A 2OTLS 3MM7B 4ZZDA 3D1NI 3HFZB 4D5CA 1VK8A 2J5PA 2DQRA 3C14B 2R0QC 2N7CA 1K0VA 3WHIA 2BEOA 3CF5F 2CRGA 4B43A 4AL6A 1D9FA 3HOTA 4NCAA 4FHTA 2COMA 1YS7A 1TL4A 4CO4A 2MKIA 2GVDB 1Q4RA 1GAOA 2F4VF 1EARA 2LC2A 3P9IA 1LDJA 2ASLA 1RSCA 1S8NA 2ZVSA 5KFPA 2VBZA 5C42A 3KHLA 5I3UB 2VC1A 4DOZA 3P96A 1IO2A 3HVWA 2VN2A 5DJBA 1N5YA 2WOMB 2MKKA 2CU7A 4BJ6C 4KHRA 4A3BJ 3R5CA 4QSHA 1C2PA 3D6TB 5B09A 2FVPA 1YJTA 2Y0SD 5KT6A 1W4MA 3GEZA 3TUIC 3T6BA 2B5JA 3WC2A 1YX3A 4QZVB 4N9HA 1G2HA 1JLAB 4KUMA 5L46A 4X65J 1RT6A 2DVIA 1BM9A 4HLXA 1UVLA 3VODA 2W2OP 3VGVA 1H3DA 4I2OA 3OTOJ 1ZAXA 3M1EA 2ADCA 2XGEA 2MMYA 4BC9A 4XNFA 3I9ZA 2QBYB 2XSJB 2HFVA 1SH3A 5D0GA 4KT6A 4AQYF 2RVJA 2HHXA 2HHVA 4IQXA 3V8JA 5CYQB 4X65F 2H54B 2V4JA 3M4XA 4A0YA 4BNCA 1LXJA 4FNHA 4DV0J 2G0JA 2ZH8A 4DL0C 2FOKA 4M9XA 5IT3A 3D0HE 5FIIA 2ELKA 1JKHA 5KFSA 3GZ7A 4N77A 4N4OB 2CVIA 3FDYA 5CD4A 1VRTA 4KYZA 1P4XA 1D1UA 3GCMA 2KZZA 1TNTA 2HNYB 2ZMEC 4IFVA 1N34J 3GFHA 2CJJA 4LQ9A 4DR2J 3J7A1 4ES3A 3H35A 4OHYA 3CVKA 5I3QA 2H4WB 2HYIB 2GZWA 1VR6A 1FBSA 2H8RA 3KK1B 2VKRA 2M2EA 2VJJA 2XKPA 2H94A 5CVRA 1T33A 3V42A 4M94A 3PJWA 2DFHA 4Q45A 1LWEA 3BP8A 3ZMZA 1O8BA 3DTIA 1YKWA 3VGUA 2W2QP 1ZELA 1YDLA 4USUA 3IAS9 4USHA 3KMQA 2P5KA 2X1CA 3ZQQA 4A8XA 2IJFA 4BE1A 1HQCA 1W7WA 4PPDA 5B0DA 2WA0A 3QOPA 4OZ1A 4ZTFA 2WRMA 3V6HA 3F8NA 1S3JA 5CAAA 3DN9A 3SDEB 4I64A 3DOMB 1BI0A 2AMCB 3M3YJ 3B8HA 4RZRA 1S6OA 3E6DA 2V9VA 2MABA 2A3SA 3TQEA 3FM3A 4BHQA 2A6HF 2E9RX 4AUXA 4BE2A 1YJ9S 1R6YA 3PSIA 1EJ7L 1J5YA 4XN0A 1HF0A 2XY5A 1CPZA 2NNYA 1KRPA 3VYUB 4EK2A 1HIYA 2EG2A 4XLAA 3R5JB 3UCUP 2HHWA 2NYHA 2ADUA 4LREA 2B6AA 2JH3A 3TJ8A 1NDCA 5KFBA 4OI1A 1FYKA 2OJ3A 1IC8A 3S1NJ 3OYMA 2OCEA 3S2DJ 2HGCA 2TRTA 4NXMF 1Z1DA 4KFBB 3GXOA 1TVRA 1KQ0A 2GNKA 2RF2B 2D69A 2XAUA 3BWGA 3G86A 2OEMA 3KP5A 2Q66A 2XHWA 4DV2J 2KIMA 2DOEA 5HK4A 2H27A 4CLWA 5C4JJ 1C1BB 1C0TB 2GJFA 4XRMA 3SV4A 2FLPA 3PO5A 4I09A 2LQ5A 3KK2A 4CRJA 1B8IB 1IM6A 1F5TA 2KM8B 1T8EA 3GFYA 1JT0A 5GPAA 2UWMA 4WP8A 1V4RA 1JJ4A 3BGOP 3IWNC 4A8OA 1FRIA 3LP1A 4OWRB 1YJUA 3B73A 1YQAA 4LSZB 3TMOA 4ED0A 3H36A 2LU2A 2DMPA 2I5UA 2HXIA 2GM4A 2OHDA 2ETHA 4F2RA 5EWEA 4L5EA 4I01A 4IR1A 3OL3A 3CLOA 5HLTA 3KWMA 3MMBB 4M5DA 1U25A 3OUYB 5J1EB 3CMEI 1NTCA 2BDPA 2ECCA 2OD5A 2DITA 4OZLA 3F73A 5A8RB 3JRHA 3FIWA 3VDXA 3NCQA 4HHUA 4QW8A 1EH8A 1FD2A 2CQGA 3VQSA 2M0MA 1HNZF 5RUBA 3CC4I 4ER8A 1QPMA 4DG1B 3N4WA 4ECUA 1PJ7A 5ICCA 1F9NA 3SZGA 1E3OC 4B3XA 4G7HF 3SCKE 5E1ZB 3THPA 3QRQA 1OQ3A 3JSRA 1RT2A 2E7XA 2G7HA 1XERA 3IWXA 1A7GE 4JI2J 5IP6A 3V8KA 3NP5A 2CUYA 2W9CB 3Q2TC 4LIVA 2K1RA 3DC2A 2IY5B 3HFVA 1MIJA 3R3TA 3TAPA 2AJ0A 2MLZA 3M9MB 3GLLA 3CCEI 4FF1A 3BZKA 3SQGA 3WTXC 1EKEA 3GJRB 2CQPA 3FK7A 1AKHA 2K9NA 3RCOA 1LEOA 2QA4G 4HYEA 1NDPA 2ZXHA 1FWZA 4CZCA 2PI4A 5HJYA 2ZBPA 5K8OA 3V6DA 1V5FA 2BJ9A 3RGIA 1C1CA 4GKKF 4FZVA 2ZXIA 3D28A 2EV6A 3K2AA 2EK1A 4U8YA 1GNKA 2MKJA 3N6NA 5DDQC 4X66J 1X3UA 1E2XA 5EZGA 3SV3A 3IHUA 3R6GB 4O3RA 5ILSA 1FWPA 3RRHA 3KETA 2C2DA 3OXGA 4OYWA 1FPQA 1QO0D 3HRSA 5H9EJ 2F7VA 1A6LA 4QIEA 3CCLS 1QSLA 4LF9F 1ZGJA 4GO5X 1MBKA 3WTVC 2JUCA 2CQKA 2E66A 1DGRM 2V6CA 4PDKA 3QP6A 3L7OA 2EBGA 2HHSA 3K5MA 1NK7A 2NZCA 3IKVA 2VPXB 5CVVA 3TNVA 2FJAB 3UNGC 4OAYA 3K0LA 4RKUC 4KYWA 4HLYA 4DUTA 5EEAA 5ILVA 4NB5A 1GX5A 5LMUF 3AL0B 3G1LA 4DSEA 2Q2EA 3NNHA 1F2GA 2P8IA 2X3GA 3GTJJ 5K9FA 2OC6A 1CVJA 4FQGA 3JTNA 2A5YB 3KPHA 3G2BA 4OX8A 1DUXC 5MLCV 5AXNA 4KGZB 1FYMA 2HFSA 2XSJA 3M8YA 2C1EB 1HKSA 4USIA 2HS4A 2HS3A 3H3VK 1H74A 4Q5VA 1T8IA 2ILZA 2VKZG 4A3GJ 1WZ2A 4CT8A 3CSKA 4NXMJ 3OOUA 1IRFA 1U1KA 3F8MA 1IDYA 4NA3A 5M2PA 3SEZA 5KAFC 3V4IA 3NARA 3DBLB 1CSJA 1SV5B 5K7ZA 4C3IJ 2E60A 1FRHA 1IRGA 3OR2A 4KKOB 1OMIA 3NGDA 1LDKB 3PDNA 4ZVPB 2A5WA 2VPLA 4PXEA 2XMKA 4ZN1A 3KUGA 5CH7B 1W5SA 3ADAC 1IBLJ 2LFVA 5CXTA 5DG7A 3KJQB 2HIQA 2EW9A 4MMOA 4DR1F 3IWLA 1U2WA 5F0FA 4KHPJ 3J80K 2VU5A 3G87A 5HMZA 4L73A 3G6VA 3PUFA 4KC5A 5KT7A 2DA4A 4ABZA 2DD8S 1GMVA 2NXUA 2K3PA 3CESA 2CWXA 1U9OA 2KZVA 3NLCA 2XLIA 4L3NA 3U1DA 8ATCB 3MDFA 3AG2H 3E0JB 5T14A 4IDKA 1F1ZA 3K5NA 4A8FA 2H09A 1OR7C 4LLLA 3JRCA 4PG6A 1W36D 2QEXI 1JUPA 3VOEA 3IAS2 3OR2B 4KKOA 4J9SA 3TUZC 1EKRA 2HVSA 4CWBA 2EV0A 5EJCA 1RBOB 4PEOA 3BYRA 2DHHA 4PG8A 3W63A 3VSLA 3X1LB 1FA0A 1FDBA 1R31A 2QA4S 1X3WB 3Q2SC 5K20B 1TKXB 1R4MB 1V55H 4LRDA 4DF8A 1TW2A 2H1YA 1QLNA 2OTJI 1X0FA 2Z16A 2GVZB 5ETMA 5HQLA 2DXDA 2YS9A 2F65A 4P10A 2DO7A 1K83J 4Z2YA 3I32A 2QLFB 3REOA 4ANJA 4K2EA 2AU0A 4EFAC 3BY6A 3K7RA 3PO3J 3IN5A 3QYYA 3HKZA 1HQUA 4BS2A 3CDEA 4OINF 2WB4A 4ANEA 4V19X 2OAUA 4ZVGA 3T8TA 4ANCA 3DLEB 3CJ4A 4UY85 4HEA9 5J2QB 1NPRA 1HBNB 4Z2XA 1YHQS 2R9LA 1X4EA 4DWIA 3FMQA 2C2OB 3FDSA 3OJUA 2LMDA 3G71S 4ERDA 3KJVB 1RAAB 3ELKA 1BW6A 1QUPA 3Q8QB 4F0MA 2H9ZA 2X1DA 1N48A 4A8SA 3DLEA 1IKVB 2DO4A 4DZPA 1TFYA 1D8JA 4N8OA 4F3MA 1O3TA 1R71A 4OIPF 4A3LJ 3CUQC 4G9YA 4IHVA 1OY8A 3M8PA 2G2ZA 4YY3J 2YKNB 2MZRA 2DT5A 1YJNI 2K9MA 5CA5A 3T3FA 3WIUA 3PR5B 4DUZJ 5CJ9A 3KK3A 1ETVA 4AM3A 1BY9A 4CTAB 2OAZA 3TGNA 1QPIA 1H2UX 5KFIA 3LSRA 5ETTA 1NAQA 1FZPB 2PMWA 4GKJJ 3QODA 1HKQA 1X2NA 4S0HB 1ERDA 2M52A 1AYEA 1VIOA 2DHGA 1NZ8A 2TDXA 4KIAA 1TK8A 4LSNA 1YK9A 2F5EA 4U7CA 1QD1A 2MQNA 3BG6A 5EDWA 3MXHP 1PUFB 4KB7A 3NQOA 1UEUA 3FK6A 2FHMA 2PBIA 2ZUGA 5KFDA 1HW1A 2OKQA 2M8HA 4WP3A 1FXRA 4DQSA 4KBIA 2QEXS 1GDTA 1TAQA 4CA0A 3I5UA 3VSKA 2FVCA 4QIWN 4E7HA 4DSFA 2HWHA 2YNGA 4ATNA 1MD0A 1RU1A 1F9FA 1S9GA 2KDZA 3DV8A 4IKFA 3E1SA 2JFKA 4ITVA 5EHHA 4ED3A 3LSPA 2NSBA 4NLWA 5JFRA 2SXLA 2C3UA 2YNFA 1WJEA 1HQUB 4ELTA 1RCOB 2BW2A 2ROEA 4KO0A 1QHGA 3RQ4A 1U9NA 4FYVB 2PN6A 5F64A 2LD5A 3U27A 5IWAF 4XIUA 1NK8A 3MFIA 4DX6A 3GZ6A 3CUQA 1VLYA 3L2QA 4K4XA 3BCBA 1HSTA 4YY3F 3NKYA 2YKQA 2MEWA 2V4QA 1UB9A 4A3EJ 3QRFF 2PFFB 1Z3XA 1Y3JA 3RB3A 1X4GA 3GV7B 4ZP6A 3GFXA 1ETKA 4X4SA 2XZWA 3NY0A 2AGOA 4WYWA 1DTTB 5LHHA 2WTEA 4J9UE 5E3CA 4D3HA 2M7AA 3ZQIA 1FNMA 2ZSHB 3BPVA 2YH0A 1YOVB 2H4YB 2NUHA 5D4PA 5E1XA 1TWGJ 1VRUB 3CD5A 1DAXA 4WTOB 2RQMA 3AB4B 4BY1J 5E2QA 4C8OA 2ZJQQ 3WHCA 2DH7A 1ZG1A 2R2TA 1KHWA 2E1CA 3CO7C 2M7BA 1Q8LA 3OYBA 2VA3A 4GVLA 3HGYA 3T1HJ 1K1SA 3SQOP 4KHMA 1AFJA 4KV8A 5BPIA 4Q2LA 4YHHF 1RWKB 1I1SA 3T1YJ 3KLFB 4ZPTR 1ITPA 2MHNA 3S7RA 4O3PA 5E20A 1ZS6A 2BQRA 3GJTB 4BJTA 2H3EB 5KFTA 4NA2A 2FJVA