1P9QC

Structure of a hypothetical protein af0491 from archaeoglobus fulgidus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
233
structure length
230
Chain Sequence
VSLDKAVIARLRKGGEEFEVLVDPYLARDLKEGKEVNFEDLLAAEEVFKDAKKGERASVDELRKIFGTDDVFEIARKIILEGEVQITAEQRREMLEAKRKQIINFISRNTIDPAPHPPSRIERALEEAKVHIDIFKSVEAQVKDIVKALKPILPLKFEEMEIAIKIPPEHTGRAISALYNFGGVTREEWQRDGSWICVMRIPSGMYGDLMDLLGKVAKGEALTKVLRRIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AF0491
publication title The Shwachman-Bodian-Diamond syndrome protein family is involved in RNA metabolism.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 58
structure length 230
sequence length 233
ec nomenclature
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01172 SBDS Shwachman-Bodian-Diamond syndrome (SBDS) protein
C PF09377 SBDS_C SBDS protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.900 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1p9qC02
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1p9qC03
3.30.1250.10 Alpha Beta 2-Layer Sandwich Hypothetical 12.0 Kda Protein In Nam8-gar1 Intergenic Region; Chain: A; Ribosome maturation protein SBDS, N-terminal domain 1p9qC01
4ES3A 4ZCLA 5G4DA 1DARA 3LH2S 4TNOA 3E3XA 3OQ2A 4ZCMA 3ZZUA 1ZM2A 2ZITA 1NYNA 1ZM4A 1VI7A 2IVYA 1N0VC 1T95A 3EXCX 4FN5A 2BM1A 4MYUA 3B8HA 1N0UA 1ZM3A 3B82A 4QR1A 3ZZTA 3ZZ0A 2EFGA 1U2RA 4M1KA 4ES1A 2BM0A 2J7KA 2WBMA 2NPFA 3B78A 1P9QC 3UI3A 4ES2A 2L9NA 1KTVA 2KDOA 2E1RA 1ZM9A 2CVEA 1FNMA 4ZCKA 4QR2A 4ZCIA 2I8EA 2XEXA 4MYTA 4QR0A 4MAKA 1ELOA 2BV3A 1ZPWX 2I0XA
chains in the Genus database with same CATH superfamily
2EV5A 1Z7LA 3C16A 3TVZA 1SQEA 4S04A 3L9ZA 4OWRB 2JFDA 1RWOB 2ME6A 4U67Q 3FK7A 4CZZA 3DPLC 1CJTA 3TDUC 3NS7B 4DGWB 3CCWA 1IRXA 1P9YA 3DLEA 3Q5FA 4R0JA 2YU9J 1N34J 1CULB 2L9VA 2DDAA 3FBBA 3UVJB 3WTUC 4HT5A 5L1KA 2HWIA 3FCVA 1X4PA 2LTPA 1XSVA 1L0OC 5IM0B 2EPIA 3IR7B 2DITA 4C11A 3AD7C 2W9CA 4II3A 1GK8A 4BDYA 5IT9Y 3I5AA 2C3MA 2R0QC 2WONB 2EA2A 4V19K 4ZOSA 3HRTA 3OXLA 1T11A 1WG1A 5ICGA 4EJOA 2J9CA 3UVJA 2M7SA 3GXOA 2XSJC 2AF6A 4FISA 1YS6A 1UVMA 3JREA 2ACMA 3SEOA 5IM0A 4IG0B 4XMYA 5KG7A 3LWMA 1UTAA 2DA6A 3RZOJ 1TL3A 4USKA 2C6YA 1DRZA 1UG0A 1W5TA 4IYQA 2IM2A 4WU3A 4PJ0C 2WONA 1FERA 3RYLA 4CLKA 2JRMA 3RTRA 1J27A 2CFOA 2B8QA 4JI4F 3K70D 1I94J 4Q4ZF 2FQ3A 3ZZ0A 3KMSA 2VOPA 2CQHA 3TW0A 2E60A 4FBTA 2ZUGA 5U47A 3E5UA 1YWXA 3R6SA 3RB4A 4NOHA 1SD4A 4IG0A 2NOJB 3PEHA 1J7KA 2JDJA 5KFMA 1JKHB 4R5PB 3F9KA 1LK5A 4DLEA 4J90A 1JHHA 2Y0SA 1ZG1A 4OZJA 2LY1A 4HVZA 3IRWP 1VBYA 3OW2R 2YWHA 3KIOA 2I0XA 2EC0A 3ZMZA 1ZZFA 4XSZF 1JKHA 4R5PA 4UB6C 3IAM9 1RISA 1LEAA 1NEEA 1U1PA 1BL0A 3J81K 3T5JA 4QTRA 1A31A 2HQGA 3BR1A 3VTIA 1F2GA 1T39A 4F3OA 1UAWA 5JLXA 4NYZA 4CM0A 3HJFA 3OSNA 3E6BA 2JA7J 4YHHJ 1YJNS 3A3NB 4X1EA 2JH3A 1BQXA 3H25A 4OYZA 5F64A 2B4OA 4ICLB 3J80Y 4DFJA 1KTQA 5EZGA 5B0AA 3WU0A 3VAIA 4ZCIA 3EGWB 2FGOA 1ETXA 4KHMA 3SFIA 3KK1A 2CQ4A 1XMOF 1PP7U 6FDRA 4ZLNA 1S8NA 2EFNA 1B4SA 1JLQA 1FRJA 4B3OB 4IRGA 3AL0B 1RA7A 4JOUA 1MSEC 4KUMA 1SJ1A 2LXIA 5FB2A 1VQ4I 2J0SD 5ETSA 1C1CB 2BJDA 4J01A 1SKRA 4L9NA 3QGIA 1SC7A 3HOYJ 1KU2A 2ETHA 1VYAA 3CMMA 3VAMA 2QGFB 4FPIA 4LREA 3UCUP 3EYYA 5DG7A 1HWUA 1MROA 3G4SS 2X3DA 1OPIA 4IRIA 5F0CA 1OFCX 2HOTA 1IJEB 5LRRA 5KFIA 5KG6A 4XTTA 3NS5A 1IXSB 2CRLA 4GGGA 4UVBA 3NWTA 4KT0C 3S1RJ 2ZHBA 1IR1A 4I6ZA 1SKWA 4CO4A 3GTJJ 1U0HB 3S7RA 1IKWB 5F8JA 4RBOA 3HGGA 1S72I 2R93J 1U1OA 4QWQA 4KKOB 3SXLA 1WJEA 1NPRA 2FEZA 4CLYA 5DO2A 2AQEA 1W0UA 1UAAA 3PM1A 3SSQA 2V8VA 5B0DA 5A8KB 4UNOA 2XAQA 3JTGA 5GAGU 2P9GA 3K4JA 2JQ7A 3MD2A 4NCGA 4LF6J 3D1QA 2V2ZA 2OHDA 3D5RC 2G7UA 2JL9A 3P7NA 1X1DA 4LFCF 1H9TA 4KKOA 5F8LA 3ZMTA 1N32F 1XNRJ 5FRNA 3ZTOA 2RKIB 3L00A 1U49A 5FKKA 1J2XA 1G8XA 4A3MJ 4YY3J 5A8KA 1XX5A 4KE5A 3GIJA 3I56I 3MKLA 5JHFA 5HLGA 2R7TA 1X4BA 2M3DA 2QA2A 4OHVA 3KTQA 2V8GA 2VPZB 2WY7Q 1NG6A 3HGYA 3BZKA 4IRCA 1HBXG 4NMLA 2ZM6F 1H6KX 2PJRA 3G82A 1Q16B 4BNCA 5LOQA 2AD9A 2O5RA 4LVNP 5EX0A 2OEMA 2FOKA 4ZN3A 2K5CA 3OR2A 3N05A 2OA4A 3P9KA 4HLXA 3V7CA 5IV3A 1R00A 4URSA 1K8AT 1HBMA 2DD8S 1EQMA 4CSWA 1BI2A 2QL5B 3W62A 2CNOB 3BWGA 2CJKA 1D8YA 2MKIA 1UVIA 4IOAF 4KV8B 2VFSA 1HHTP 2X7IA 1R8CA 5L3DA 3EGVA 4FE7A 4F4XA 1URRA 3WTWC 5E18F 1D0EA 3WX4A 2RQPA 1IN0A 2DGUA 3T1AA 5D4SA 5LHGA 1RSCA 4ECYA 5FKNA 2CDRB 1UFLA 4I7FB 3HBLA 2DCLA 2N8GA 4PABA 3EZ5A 4KV8A 3HEFA 4XOTA 3R4KA 1WC3A 1WDDA 1OPCA 2XV4S 3VAGA 1TT0A 2H3EB 3GE9A 3EZOA 1VQLI 2DIUA 1LQ9A 2APOA 2ILYA 4Y7NJ 5HJYA 1F1ZA 2HPMA 1LOUA 3A2KA 1O51A 2FLOA 4I99C 4KFBB 5MLCV 3AG4H 3QIDA 3CCLI 3WX8A 4ETSA 3W63A 1TKTB 5K8PA 1TZLA 2OGUA 4I7FA 2DK5A 1WZ2A 2FD2A 2I8DA 2FX0A 3CC2I 1MN7A 2B0GA 2MQOA 2KRRA 4LIUA 2UV1A 4KYZA 2X48A 3CCVI 1K61A 2WTFA 5H1SV 3LPYA 4WBFA 2RE1A 2L7KA 4J91A 3HKZN 5EF6A 3OHBA 4HT7A 3CUQA 2UXXA 1B3TA 2X1DA 3M2UB 4EFAC 1TKTA 2W2QP 1HI8A 1B0TA 2NXCA 1X9WA 3DDKA 4DL3A 1YI2I 2ACJA 4YFXF 4BHQA 1S5LC 1GXQA 4ITVA 3ILJA 5F1JA 3DRRB 4YG2F 2KZVA 3H9JA 2ZBCA 2QBYB 4CYUB 5HVGA 3FMRA 2LKXA 3HOUJ 5LMUF 5EEAA 4M5GA 5CHCB 3NNAA 4NE9C 3PHEA 4MKAA 1LUJB 2JLGA 1IBMF 3MOJB 5L3EA 2DOFA 1T2KA 4LR8A 3D66A 2VI6A 4RNNA 1U0JA 3UE2A 3PO2J 2VICA 4BC9A 4IEJA 1XQIA 1OYYA 4PJNA 3NGUA 4HNUA 2WC2A 3S8PA 1SQGA 2EC2A 2O01C 4I2QB 3FF5A 2ZXHA 1H73A 5M3FJ 3M9OB 3C15A 4K4TA 5D4RA 4ZTJA 4KH1B 5CABA 3NG8A 4A46A 2LECA 3RIRA 3JRFA 4R79A 2AZ3A 1YJ9S 5J2NB 2MZ1A 2N4CA 3D54A 1I3OB 4A8KA 4KGXB 3NAUA 1HC8A 1W5CC 3MMBB 2EJRA 4I2QA 4QYZJ 4M5DB 4P7VA 1CF7A 2VDIA 3EDPA 1YITI 1FY7A 1CC8A 2A1BA 1T38A 4ASNA 2GWRA 1HQUA 2CPFA 3PW0A 3JR9A 1U78A 1R58A 2VN2A 5J2NA 2KRCA 1IN6A 1QVGR 2ZXWH 3CJ4A 4QPQA 2JSXA 3UFCX 3HRUA 1Y39A 1VNDA 4JBAA 4PAAA 1S7EA 3BG3A 4M5DA 2K86A 2IMOA 2MLYA 1TWHJ 1WKMA 2BRLA 4LFBF 3NNHA 5HNHA 2O8XA 3K5PA 1R6YA 1P1TA 3C14B 4DV5J 3QO9B 5DG8A 2OI2A 4IVNA 4IFYA 2W8KA 2BX6A 4XK8C 1N54B 5C4JJ 3QZ7A 3RAXA 3JYTB 3DYAB 5IT9U 1BR1A 2AXTC 3K69A 4XKWA 5IYDJ 3FC9A 2DFEA 3H42A 4UOCA 1Y3JA 5KFJA 3BO2A 5HLIA 3KYLA 2UXCJ 1U4BA 2V9KA 1OPZA 4LITA 1S1XA 3C46A 3BT9A 1TL5A 1TKDA 1ZYRF 5EG0B 1E3OC 1PIEA 3QO9A 4JB8B 1WWXA 1RP5A 1NLKL 1OCRH 1GX5A 3JYTA 3DYAA 4DLGA 2FB0A 5IOZA 1D8JA 2ICWG 3EPIA 4Y2KA 1HPZA 1JLAB 2HOSA 1UJ6A 1EKSA 4B8XA 5IT4A 4DV6J 4ECVA 2H9ZA 2IVFB 1S6QB 1VHIA 4CO0A 5KFHA 1MSWD 2O61A 2ZBRA 3P45B 5EG0A 4KBIA 1Y11A 3MM5B 5ETMA 1OO0B 2Y1IA 3T8TA 3LSKA 2H51B 3BN7A 3TANA 2A2DA 3F44A 3LWFA 4MEYF 1FP2A 2ZH2A 1S1TB 1JLAA 2XCPA 4LUBA 3MVPA 2HHWA 3OS2A 1OCTC 1HMVA 2J6SA 5B66C 1S1UB 4AT1B 2KYXA 4DMZA 2PN6A 2R8IA 5IV4A 4B9MA 2CNNB 3N01A 2E1MB 1OS5A 3MM5A 2VPLA 1TW2A 2YNFA 2YH1A 3AXKA 1FJEB 3JXOA 1B9MA 4Y15A 5EGYA 2FVQA 2IA0A 1FVSA 1BA5A 3JTHA 2V8HA 1E3HA 3ML6A 2J9EA 4RB2C 3SZGA 2K02A 3GSDA 2FVRA 1TFWA 4BGDA 4FXVA 2L9NA 5GMDA 4E7LA 4CO1A 2ZHOA 3TO8A 4ZH4F 2HFVA 4F0HA 3EUAA 2XGEA 2KG0A 1Z9CA 4EJWA 3JSMA 5CVUA 3HLUA 1V5VA 5F8MA 4AL5A 4F7VA 4QJVA 4E4HA 3FZBA 2XC9A 2VL1A 1NSQA 3A8KA 3I0RA 1V3FA 1Z91A 2D41A 1DTQB 5KFDA 4FF2A 2IM1A 2K27A 3J80U 2VUGA 1GDTA 4RW6B 2R2TA 4LD5A 3N97A 2J9DE 3OYEA 3G6XA 4K7QA 5HMYA 4DR6J 2XUBA 3GFJA 5B0GA 3RAQA 3KLOA 4MIBA 2HVRA 1OCPA 2BV6A 4U96A 4EZ9A 1O8BA 1DTQA 3RRKA 1JKQC 1DJ0A 2JJ4D 5EDNA 1Q5YA 1RT4B 1TK0A 4WE1B 6FD1A 4OYOA 2LQ5A 4XLNF 4RW6A 5KFGA 4L3NA 3IWZA 4MK7A 2HQRA 4RM2A 2HEOA 2DDBA 2A18A 3ONQA 3JW4A 1U5TA 3ZQHA 3MFIA 3VGSA 4CYCA 3V8KA 1RT4A 4WE1A 3R7NB 4A8QA 1TQLA 4UUVA 2RS2A 1KVIA 2L9SA 5HVHA 3QGPA 2DVIA 1VLYA 5E0OA 3WGGA 1VZ0A 4H4OB 1M5OC 3FZVA 3EETA 2HIQA 2RGVA 2UUAF 2ADUA 3QPLA 4LBHA 1IG7A 1U8RA 5C7PA 5DLGA 3R7SB 2B51A 5BPIA 3QT5A 4CLZA 2XSFA 1R1UA 3BQYA 2V4QA 2CJYB 2FJVA 3HFKA 1DARA 2OFGX 2EKNA 1KYZA 1ZA1B 3IGNA 1VI7A 1N0VC 1TUGB 4HTIA 2WB1N 4B9NA 3VZHA 3MAQA 1RT1B 3W3SA 4Y2CA 2CG8A 2OPQB 2AJFE 5KG1A 2MD5A 3D3CJ 3NQOA 4LGWA 4AYBA 3MOZA 1W7WA 1BQNA 4CO8A 4XKVA 3EPZA 4D1QA 4F04B 2ZVIA 2V63A 1AFJA 3OTEA 4WTOB 4IRHA 1TTYA 5IOLA 4EBEA 4LBIA 2H6CA 1U2CA 3E8OA 1M1GA 2DGXA 1OSCA 4OI6A 1D5YA 3Q8VA 5BS6A 4DL6A 2K06A 2YKNB 2OPQA 2IYGA 1F0XA 5IWAF 3K6GA 4TNOA 2DA1A 2KZGA 4RA2A 3BN4A 2EXUA 3HULA 1I3AA 1OR7A 2NAZA 1PYOB 3BBCA 1IVZA 4JV2A 3M9AA 2VPRA 2DH8A 3AJ2A 1X19A 3VB2A 1MN9A 4BBRJ 4QLCU 4Q5VA 1Y10A 4G6QA 4MJKA 1FMWA 3CJ0A 1HNZJ 2LEAA 2IRUA 4FP9A 4FNHA 2BY3A 2YKNA 1UMQA 1T9VA 1HKTA 3MUMP 3FM5A 4RS8A 1NB2A 1RHRB 2CS3A 2XAGA 3T5LA 2MFZA 2BW3A 1MMDA 3KP6A 5F08A 4ZIWA 2IA2A 2F8MA 4LG3A 3CCEI 3DGPA 1R5GA 3R9LA 3BQ0A 3UQSA 5H9FJ 1LEBA 2MKJA 1I39A 2UUBF 1YG0A 1AHDP 3O6QA 1FWKA 3AKZA 3EDRB 3HC7A 4RGXA 3Q8RB 3EDQB 3MMAB 4C97A 1KC8T 2N7YA 2IGKA 3BGRB 2FJEB 4I4BA 4HW0A 1JLBA 1SH0A 3CDHA 4NLPA 1DQ8A 5FGMA 4DSEA 4GKKJ 4P52A 2ZC4A 3MURP 3NGDA 1VLOA 1CEZA 4HLYA 1XK8A 4OI0A 4ANJA 4USVA 1C0WA 2V1UA 4PG6A 3SQGA 1R7IA 3IUOA 3DKXA 1TWAJ 1FEHA 1DAXA 1ZRDA 4ENOA 3MMAA 4GKJJ 3JRBA 3BGRA 2BRKA 1OJLA 3H5UA 3TNVA 2UUTA 2I5JA 5E3OA 1HNWF 1KQSR 4QWAA 2Y1JA 4Y6IA 4KYWA 4JUZA 4J9PA 1TV6A 5EZHA 1R1VA 3PZPA 3E1SA 1VQ4S 3BO4A 3PG9A 2AJ1A 3BF4A 5HL7Q 2XWXA 1S7OA 4I7HA 2MGZB 1FESA 1HBUB 3HYIA 1LWEA 5I42A 4XLFA 5TISC 1NTCA 2AO9A 3PNIA 1OMSA 3HOVJ 2WADA 2FHKA 1JLFB 1RNLA 4NLVA 3L2VA 3MPYA 3V6DB 4L3KA 1MU2A 2XEXA 4J9QA 2X1EA 1J5OB 2CQDA 4LSLA 2LKPA 4L73A 1HBUA 4RWWA 3VYUB 5B7WA 1WWHA 3PFYA 3M8JA 1ZGWA 3OYIA 2A10A 5CKTA 4ZYAA 3JQMA 1MNDA 2BYVE 4RUBA 2LG4A 1WTFA 3HK2A 2XMKA 1JLFA 2ZJPF 1S72S 2JZ5A 4EO6A 3V6DA 1MSFC 4A3LJ 3CJ2A 1J5OA 4HI2A 3IM8A 1VIXA 1OWXA 3LL7A 2OUMA 2ZOFA 2RUSA 2E5GA 5J1RA 4XLHA 2UUCF 1QRYA 3D4JA 1F6TA 3O3LA 1WACA 3CESA 3R2DJ 2XPVA 3HHLC 2XC7A 4DUZF 1TL1B 3QU6A 2ZH3A 2ROGA 1RT2B 3QU3A 2HKOA 5IT0A 3GLLA 2CV2A 3S2DJ 1GHCA 4HYEA 2XCAA 2PGCA 3DV8A 1TVRA 3E6MA 3RAMA 4OX6A 2QE5A 2VKHA 2AJ4A 3W2AA 1J59A 2JUGA 3I56S 3GMGA 4ITSA 2NNNA 4FYVB 4JI4J 1TL1A 5HLFA 5IP9J 3CCUI 2G7HA 3CCRI 1RT2A 1AFIA 4D5CA 2PEXA 1P4AA 3I4NJ 1NZ8A 2IS1A 1VRTA 4RL1A 2XKOA 1UB9A 4KHRA 1DLOB 4QIGA 4M5NA 4M74A 2W7OA 1KDNA 2FGCA 4CLLA 2VBWA 2HQCA 2ZJ2A 5HODA 3NWSA 5F9NA 1A7GE 5DDOC 3WG9A 4MFBB 2PA3A 3QT7A 3DN9A 1QSLA 1QM9A 4ZJQA 2JZYA 3BR8A 1HWJA 1TL7B 1KLMA 3JSOA 2XROA 3VWBA 3CDUA 4JOMA 1HW2A 4KPCA 2GJFA 2HGMA 5DDQC 2AU0A 1WEXA 4NA1A 3D0GE 3FBNB 3FQLA 3BOQA 3I53A 3B4MA 3HKWA 2MQQA 1R0AB 4X4VA 5D4NA 2IGNA 4DV2F 3IM9A 5KFSA 3KYCB 3OQ2A 5LXRA 3NRBA 3TBIA 3DXBA 1RAEB 1TL7A 5E1XA 3L3CA 9ATCB 1VQLS 4LIVA 1JKOC 4IOBA 2XRLA 5AJ3F 3C2HA 3WBZA 5KT3A 2FUG9 1R0AA 2NQPA 3BROA 1PJ6A 4NEZA 4I56A 3OYHA 1BD6A 5IOYA 2GMJA 3BCBA 3CCLS 1K4SA 1TFYA 1L5UA 2QLXA 2G1HA 4IH7A 4ZPWR 4QBUA 1U24A 5LD2C 3CC2S 3LSTA 4KMUX 4HHHA 1RXOB 1TAUA 3OOUA 3CCVS 3ENAA 2Z56B 4WJBA 2LU2A 2MXYA 5DYMA 3THPA 4RUAA 3G8TA 4EBCA 3RZDJ 4CA0A 4YIFA 1UVJA 3IAM2 4CCKA 2DMTA 4PXEA 4XRFA 1WNEA 5C24B 3CE8A 4FXDA 1PBAA 4AQYF 4EWTA 5J2QA 2W7AA 5KFLA 3J80K 4KO0B 3QGHA 2B5JB 1XS9A 3LSIA 5A8WA 4FYWB 2KU7A 4AM3A 2AKWB 1Q1VA 5J6XA 2AJ2A 2L2OA 2KPMA 2D1CA 3I71A 1QZYA 3GJQB 1RHKB 5ETNA 3KJNB 4HR2A 2VL8A 2V2VA 1D1BA 3D0HE 3TEDA 2V4RA 2XHKA 3OUYB 3CJQB 2C2OB 1FF2A 4F92B 2B5JA 2ISZA 4OI1A 2E1PA 2GXBA 4AL7A 3GG1A 1NYNA 4KJIA 2X4HA 2HXOA 4BL0B 1FBQA 2RVCA 3CDAA 2WB4A 1AYEA 3RBDA 4HNVA 5KAKA 2DA3A 3ITHB 2LQ8A 2GO8A 2NR0A 3S3MA 4OI2A 3UNYA 2N82B 3RUBL 5BYSA 3UR0A 3OUYA 3CJQA 2C2EA 3ZZUA 1HW8A 1REVA 3DRPA 4LFCJ 4WXWA 2IRYA 1U8BA 4IH6A 3DM2A 3DTKA 2F4VF 1N32J 5D15A 4CYDA 1UCNA 1Y6IA 3MGJA 2V9WA 4Y28C 2NVQJ 2WSCC 1I6HJ 1GVJA 5K5OA 3ITHA 2H8RA 3TW6A 4ON0A 3MCMA 3FBIB 3HHHA 3TAMB 2BOPA 2MBFA 2QL9B 2WY8Q 1ZOTA 2A6MA 1LDKB 3WGHA 2RAQA 4WZMA 4UV9A 3H2VE 2WTEA 3QGGA 2J5OA 2HVHA 2V1XA 3V7RA 2EG1A 3GJTB 4RDUA 3EGZA 4S0MA 2DIVA 4B3MF 3L2CA 5DCMB 2ESHA 1HBNB 3Q23A 3K89A 3KG4A 4LMYA 2MJUA 3TAMA 5KK1A 4XR6A 4PUOB 3IR6B 1RZMA 4A4JA 2YTCA 1VQ7I 2PLYA 3HVTB 2L9DA 2VZ9A 2Q3PA 3RKWA 2PMHA 4KFCA 1HBOA 4OZ3A 2EINH 2EWNA 5D78A 5HBMA 4DX8H 1YBAA 5M3MJ 2BE2A 2AXLA 3FRYA 2E7VA 3MD3A 2DGOA 2AYBA 3RR7A 3GJRB 5DCMA 1HBNA 2VDHA 1IN7A 4JV5F 2A2CA 3WC2A 1T08B 2IHR1 1MWQA 2OC6A 4HQEA 3NGRA 4FX0A 2DKOB 3C2GA 3HVTA 4JI6J 2ELKA 2L4MA 5DRKA 3ZC4A 1NDLA 2HAFA 3AODA 4MAKA 1R23A 3K17A 5J8FA 2OFHX 1MMSA 3ZMDA 3M32A 1D0XA 2YNGA 2CA9A 4EATA 2FJDB 4DCOB 1FRXA 4UUWA 2F6CA 2PMWA 1VFCA 3SIPB 4ZVRB 2HNYA 1G7CB 4NLTA 4MTPA 3RKYA 4NLRA 4EYHB 2K7LA 1B70B 2VA3A 3IRRA 1FI4A 2F9JA 2O0YA 1N6QB 2L7FP 3OTCA 2NVTJ 1BI1A 3KZIC 1RT3B 2QSWA 3VVTA 4IR9A 1TNSA 4B43A 2LDIA 4YOEA 2FHOB 4A3JJ 4WIQA 3PL8A 4PEOA 2IY5B 1SFXA 4DQRA 4LB6B 1KKHA 5H6RA 3AFHA 4HSTA 4HDGA 5LMUJ 3BJ6A 4HL9A 1RT3A 1IKVB 1JB0C 5IPAA 3BYRA 3CW2C 1IBMJ 2MG4A 4JI1F 2AHOB 4DF4A 3BQ1A 1QTMA 2BQRA 2CQBA 2NVUB 4NLDA 4XAKA 1HLVA 5F8IA 4KRWA 4DR4F 3C6UB 3MZHA 3B4DA 3D6TB 3AG2H 3DCFA 1O57A 4WP9A 5E3NA 4QIWN 2XF6A 2HQAA 1IKVA 1PSDA 5KFOA 3M2VB 2EVZA 2BOLA 2Y0SN 1MLAA 2KHDA 4QSHA 2O03A 1E6VB 2A5WA 4NC7A 1QSYA 4TXSA 1O3RA 5D8HB 1PC5A 4U7CA 3UPFA 1NHUA 3FX3A 4XDCA 4A0XA 1YJWI 3AOAA 4ZPVR 4K5RA 2BW2A 3PO4A 4ILMA 4WF9Q 3RBXA 5KOWA 1ON2A 3K5OA 2KQRA 2QYCA 4ZCMA 4LLGF 2P8IA 1QVUA 3CJRB 2NS0A 4NI2B 4A6DA 1E6VA 5C25B 1XMQF 4JX5A 1R4MB 3TOBA 4XICA 3I4MJ 2B4PA 2XHWA 1BHNA 3M8EA 3D3BJ 4DNCA 2XZTB 5HNFA 4J9LA 2ZEJA 5M5WJ 4GVBB 2VU5A 4BXUA 3TUPA 2W57A 1ZAOA 3KK2B 3NMRA 4OZ2A 3EXCX 3HOTA 4C2UA 2BANB 1NO8A 4LFBJ 5C25A 3F8BA 1ZTTA 3JTOA 1R4NB 3IN5A 4F36A 2IYIA 3A1YA 3ZMVA 1U3EM 4M73A 4PYAA 2D69A 3F22A 4FVCA 3GYGA 4F0MA 4GVBA 2ZKTA 3K4NA 5FLXY 1UHSA 3K1MA 3KK2A 1CQNA 3MPWA 2H1LA 3GTMJ 2AP6A 4X2BA 1YLFA 2BR0A 3WDOA 2V4JA 3FDSA 1I5ZA 1NSPA 2B9YA 3R8YA 1S1VA 4I2OA 3DHWC 1AXQA 5CVRA 1WG5A 1U1NA 3KG0A 5K8OA 2ZFHA 3AG3H 4WIIA 4UTGA 3D1HA 1RT6B 2MD0A 1SJRA 4K2JA 3VCDA 1WVRA 3OYBA 3OHAA 2HGNA 1S6PB 4Z2YA 1TZ0A 2HYJA 3BTCA 4HA8A 5DG9A 1CC7A 3CO0P 3MPVA 2YKOA 4AWXB 4LR9A 3D28A 3DOMB 2K1RA 2QSHX 2M87A 3VODA 2NXNA 1V3ZA 5D4PA 1HW5A 1IRFA 2OMOA 1X1BA 1IN8A 4HKQA 3RTVA 3B82A 1DQUA 1FNNA 1Y0HA 4NYPA 1Q1KA 3OD2A 4DPOA 4OX8A 3OJSA 3BZQA 1QHHD 3RBZA 3DRYA 4LK1F 2V8DA 1XR6A 1Y5LB 3DOMA 2E44A 2LF7A 4HAMA 5H9EK 3ENWA 5CCLA 2QSFX 1E3PA 2QLBB 2FTRA 2FY1A 1U02A 2HBRB 1V6HA 4B3RF 4RNMA 3HFVA 3U21A 3AQPA 2KFNA 4Q2MA 2BY1A 2HWTA 1F36A 2Z9OA 4QU7A 1D5VA 3RG6A 2MHEA 3CCES 3QRRA 1FJGJ 3BSOA 2FVCA 1U1QA 1EF4A 1NUEA 2BHYA 1HR0F 1RBAA 4WK3A 3S6EA 1RU2A 1XB4A 2YU3A 2M88A 5DDPC 2H4YB 1W36C 2BDPA 3R5CA 3QIPB 1DPUA 2H1YA 3CMEI 3GWCA 4KMFA 1UELB 3ABKH 2HI3A 3QQAA 2K9QA 3DFEA 4HACB 3ZNJ1 5IFMA 3BB5A 1FTRA 2FLNA 5JMNA 5K20B 3S14J 4QPOA 1OYWA 3SEQA 2HZTA 3I5UA 4EK2A 4P5OA 4NXNF 3LSPA 2CUEA 3M1VB 2QENA 5EWEA 3GFYA 3RJPA 2YXLA 4OIRF 1VC6A 3H3VK 1F9NA 2GVDB 1HA1A 3QIPA 2LXUA 3OPKA 1D1AA 4B9SA 3PX0A 4ZITA 3V4GA 3CD6I 1MMLA 2IAJA 1L3UA 2E66A 5B09A 3ERMA 1WJAA 2HKXA 2OSQA 4I6AA 3CDBA 5H6QA 2YVSA 2Y9YA 1AROP 1CS4B 3OWTA 1SC4B 1FWPA 1QHGA 1RC9A 3H4DA 2XAFA 3GZNB 4JBCA 2XB2D 2XI2A 2A3SA 2GVDA 2H54B 1IGNA 3T1BA 3QPHA 4JI7F 3BS9A 2ZH7A 2RN7A 4UY8T 3MR6A 1XWLA 1J0RA 5DZ6A 2UUAJ 1LKXA 4M95A 4J19A 5E8GA 2K9SA 2VIHA 3LP0A 4ED1A 3HOZJ 1ITPA 3EE3A 2GAHC 1FT9A 3M8SA 2BUNA 3X1LB 5GVQA 2LOOA 3AD8C 2GAUA 2CJ9A 4I02A 5LXYA 1RHMB 1R8AA 2X85A 4DZJA 2BACA 2LR8A 4OYBA 2EFQA 1N78A 2FHJA 4GYGA 2EWHA 3ZZOA 4JI0F 1EP4B 1JJ6C 1Z0XA 4JV1A 5JUMA 2VF3A 1UW9A 3R0AA 1F60B 4ANDA 3LGMA 1FMVA 1TK5A 2WK4A 4URQU 5L8RC 2H5EA 1HI1A 2ZFUA 1NRKA 1UEKA 2HYIB 5KFVA 3NP5A 4LF2A 4GDFA 2XAHA 3FHNA 1B8IB 1M5KC 1BC6A 3A4CA 4HQMA 1TUVA 5KFAA 2DQRA 1YDLA 4A12A 3IA0A 1SANA 4KJZA 2BJ1A 2A69F 3CCRS 4RKUC 2JK3A 4YEAA 3EUNA 3G71I 3KLIB 4PK4A 2JC1A 3HSRA 3ZQGA 3JQJA 2BBEA 1U8WA 1FVQA 3KNGA 4B3SJ 2QT7A 3RBEA 3FIWA 2J0QD 2DRBA 5CLSA 1B8IA 1VI0A 2VKRA 1Y00A 3DWLE 5B0EA 1TWGJ 2DT9A 2E2JJ 1JXLA 3PHTA 3CTAA 3M07A 3KLIA 4OIPF 3AOCA 2PI5A 3HHNB 5B0BA 3HKZA 2PSZA 1RETA 2K4BA 4BY7J 1OCCH 3A1YG 3CDEA 2D45A 4CH7A 2Q43A 5F1RA 3EMTA 2UUBJ 4DR7J 4ER8A 4B47A 1XMKA 2CQIA 4OX9J 4GRSA 4F2RA 3KDOA 1S76D 4DX5A 4J9KA 3F6VA 2E5LF 4E7JA 1GV2A 2KT5A 3M4OJ 1RLDA 4HYKA 2DO0A 5DETA 1YJRA 2OJ3A 3JQKA 1NMEB 2R9LA 1M5SA 1LE8B 3KHGA 3ECHA 3K1PA 1U6ZA 1IUJA 2KG1A 3KCCA 4BE2A 5J1PA 3J81Y 4LB5A 2IPOB 4M71A 3IS9B 4IR1A 1FIPA 5AONA 3WU1B 3LFUA 1EB0A 1DBDA 1HA8A 5D8KB 4JQFA 5IS2A 2KB2A 4J5OA 5FKLA 2ELJA 2KL4A 2V1DA 1VRUA 4ES1A 6AT1B 1HNWJ 3DDNA 1M1HA 2DMPA 3S1NJ 1G3SA 1T8IA 1LE8A 3GTKJ 3S2WA 1IWAA 5AE3A 1UVLA 5HMWA 5J47A 1C1BA 1Q7YT 4PZVA 1G6NA 4O23A 2HZVA 1GV5A 2YNHB 4WFXA 2QF7A 2OKQA 3IS9A 4OYIA 3MEKA 1JI8A 4JYKA 3VYTB 2VA2A 3A03A 1USSA 3TEHB 3HSDA 1AT1B 2CVEA 1A36A 4NA3A 3TRGA 4WFZA 1RTHB 3KP3A 2VBZA 4X0GA 3FXRA 3GR1A 2MZRA 3QP6A 4NRUA 4RLQA 3PO3J 3UN3A 1GAOA 1L3SA 3HUGB 3KLGB 2VJVA 3SI8A 4M3BA 2VASA 2J5PA 1RWVB 1WHYA 5ETKA 4ECUA 4E7HA 1AWCA 1IF1A 3NWGA 2RQ4A 2KDOA 1LWCB 2JEFA 1JLCB 2OAZA 2MZJA 4XN0A 3P6YC 1KU7A 2Z5UA 1GMVA 3G86A 2F63A 3GZ5A 2Z0GA 4E98A 3HUGA 3AJ1A 2UUZA 2RH3A 2UUCJ 2KIMA 3HOSA 2DLLA 4USWA 1WC4A 5CPRB 5GMEA 3NY0A 2LEPA 4DUZJ 4E0DA 3CTRA 3JAMZ 1KONA 4DCPB 1TKZA 2JC0A 2F48A 5GADI 1IV6A 1YZ7A 2D3O1 2F5DA 1I50J 3PM9A 2NREA 2Z1DA 2E19A 5A6PA 1HFEL 1SC1B 1B4AA 1VDHA 3E0JB 2VKEA 1H0MA 4WCEQ 3MCZA 4O0IA 1J75A 5L46A 1Y9OA 4Y4RA 3BKFA 1Y3KA 1TQPA 2CQCA 2P2CB 5L38A 4PFPA 4YB7A 4A93J 3KUEA 4OHYA 4DZPA 2KM8C 5DZ7A 3N5FA 1H2VZ 2ZWPA 3RKQA 1ETOA 4AD9A 4ZYHA 4LF5J 2DR7A 4AUKA 5FRMA 2GC8A 2XSJB 2ZJPQ 2CVIA 3GYNA 2DXIA 4FVMA 4RB1A 2OBPA 2GOXB 4U9RA 3JRGA 3KYDB 2Z58B 2LMDA 4X4RA 4I0AA 1S59A 4TQRA 3OFGA 3NXZA 1VQ7S 1K1SA 2ASJA 4KN7X 1F9EB 4AFFA 1N36J 2P5LC 4OZ0A 1QAXA 2GXGA 2PMZD 1KRPA 5ETRA 1AKHB 1WHVA 2UUWA 5CYJA 2YKQA 2JPCA 1YJVA 4E6KG 2HURA 4F4ZA 3KP7A 1YZ6A 2F7VA 5EWGA 4F4WA 2ISYA 4A6EA 4Y65A 5KT5A 5ILUA 3AL0C 3GIIA 2OPRB 1F2HA 3CSKA 1RKJA 2DA4A 4KT5C 3TOQA 2Q1ZB 1ZM3A 3SV4A 4C0HA 3KZYA 3MMJA 3C66A 4GVLA 1H7WA 3QLHB 2KTQA 1PC4A 1H89C 2XYGB 5GAEJ 3JTPA 1TP7A 4A3KJ 4QWCA 1G3OA 4U87A 1GMWA 4NC6A 5HLHA 2HVDA 2HDCA 3U7JA 5AJ3J 3Q0UA 2WWYA 1Q82T 1DURA 3MCSA 3GFLA 1G6BA 4F91B 1MG7A 5HATA 2OPRA 4IRDA 4CNZA 3VEPA 3LP2B 4ECTA 5DDRC 2G13A 5FKOA 4EJUA 2XULA 3PNTA 1APSA 2BV3A 3R60A 1PAEX 4OZLA 2V6AA 3D5MA 2DY9A 3S2HJ 2DNOA 3BQ2A 3HIFA 4UUSA 3DRSA 2A07F 3GU0A 3VSKA 3O1LA 4K59A 3DMJA 5A6WA 2H5JB 2V79A 3L9FA 2ZH1A 4NYOA 2DCUB 2CQQA 1S5ZA 4WP3A 2WOMB 5ETPA 4LF8J 2CIMA 2P9EA 4C8YA 3HVAA 4NLXA 2FLPA 2H09A 4RNFA 5D77A 5CA5A 2FNAA 2Q8KA 1GLNA 4X4QA 1ZREA 3MKYB 4QU6A 2CUYA 1T9TA 4FPRA 3ILOA 1ACIA 2TDXA 2VV5A 1WUUA 1YIJI 2A5YB 4I6WA 4LFAF 3EVWA 2DR5A 2E7XA 2FUG2 4C9YA 1FNXH 1K73T 2B56A 3BBFA 4E7KA 2WOMA 2CQKA 3OR2C 1YRNB 4IQJA 3WHIA 4P2SA 2VT3A 5LJ3Y 1KHVA 1B1BA 3CC4I 1H9GA 5H20A 3FBCA 2RF2B 5AT1B 3K8WA 3O2PE 2ZE2B 3UCGA 1Q1HA 4IZZA 3FFIB 4RAYA 3V8JA 3Q86A 3W2VA 3HG9A 2YWKA 1NHAA 3C8YA 4E7SA 1S9EB 4XIUA 2X0LA 2Y9ZA 2C28A 4TV7A 1YRNA 3EGNA 3R5AA 1BBYA 2YX4A 1YJWS 5CXTA 3RJMB 2R7RA 2F4VJ 2RF2A 4K2XA 3IH3A 4YIIA 4Q8FA 2ZE2A 1RWWB 3AQOA 2NXJA 2OJED 2R7SA 4A3DJ 5D0EA 2HHSA 3Q2SC 3IGVA 3HSFA 2JVRA 5DTDA 3BPVA 5DM6Q 2KZZA 3ZPLA 1RWPB 2GQCA 3IRQA 3LA0A 2EBGA 4DFMA 1X4DA 1NKEA 1KVKA 2I8EA 1FD2A 4DR3J 2QC3A 1Z7UA 1HNIB 3FMQA 3F41A 4N4NB 5TRDA 1YIOA 1YBTA 4B3MJ 2QQ9A 2DYAA 1NB7A 2QO3A 3LP1A 3V42A 4OI3A 3R2CJ 4OJHA 2BGCA 5KT6A 4KB7A 4D9JA 1Z1DA 1RAGB 2EZHA 1MH4A 2CV1A 3DBLB 3TP0A 2HNDB 3RW7A 3CUQC 3GCMA 2Y1RI 5A76A 2W2OP 2ZVSA 4CCMA 2RNJA 2MLGA 4JI3F 5J1EA 3O5TB 5EDWA 1GMUA 4X4PA 4JV5J 1P7JA 4ZVOB 2D3UA 1FBUA 5EGOB 4F67A 2HNDA 4M9XA 4LSZB 1I6XA 1BOBA 3HHLD 4K4UA 5CQEA 1KBRA 3GV5B 2HLTA 2ZSIB 1P7IA 3ZTQA 2RIJA 2MKSA 4RW4B 2WVFA 5AIQA 4ANEA 1U1LA 2R3SA 2YBVA 5LLQA 2CNKB 5F8GA 5IQQA 3WZ0A 4C8ZA 2ZMEA 2KFYA 1GEHA 1C0UB 4LT6A 5E20A 3AA9A 3K5NA 3P49B 1JUPA 1QE1A 1F5CA 5FDLB 4AU7A 3F23A 3GBGA 4NLSA 2DCEA 3J7AN 1IM6A 2MSSA 2C22A 5J1UA 3UD3P 1SKUB 1NH3A 4N8NA 5FD5A 1Y4ZB 3H3UA 1LK7A 1S97A 1UWAA 5KFFA 1X9MA 3T0YA 1TP4A 1LDDA 1GNKA 2LP4A 3NGKA 3M1CA 1LEOA 2R2SA 2CPZA 3SDEB 4PJLA 4CLTA 4A3BJ 5AE1A 2DFFA 3K4LA 2STTA 4IOCF 4MQ9F 2IJLA 1PAUB 2F4OB 4MK9A 3CCZA 2P6TA 1P6TA 2CQXA 3ZZRA 2HNZB 3DLLF 3LQQA 3DEUA 2CQ7A 2GO9A 1U6FA 4KY3A 5L3FA 2LBFB 1OY8A 4DU7A 4JI1J 1ZM4A 4DYQA 5LFAA 1D9DA 4G94A 1FRIA 1ZAWA 2XY7A 3SDEA 2HNHA 3VHQA 3SZPA 2I5UA 3K2AA 2MSTA 4MIWA 4DR4J 3AAWB 4OU0A 4XNFA 1RQ0A 4HNTA 2MYFA 3CMES 1JJHA 4MFDA 5KFBA 2J7WA 4P55A 1FEXA 3F73A 1AUSL 1R31A 1WI8A 4A5NA 4C8OA 2LBFA 4C98A 2IBDA 2OZUA 5GADU 2XQCA 3W5XA 2ERRA 1MWZA 2IA6A 3VYRB 2B63J 3OL3A 3ZO7A 3BYPA 2QMXA 4BWMA 1HL6A 1YQAA 2H94A 2OF7A 2QLJB 1PO6A 2Z2LA 1F9FA 3R27A 1N8RT 1KQ8A 3BH7B 3CD6S 2YPZA 3U1KA 4F50A 2ECBA 3L7WA 2O9LA 1TKXB 3QAEA 2CH0A 4CQ1A 4LRFA 2O7OA 3I0SB 1XMQJ 1JTXA 1Y56A 1XR5A 4MTEA 4TY8A 2DOEA 2IFXA 4DR5J 2RNEA 2DNPA 1HWLA 2LH9A 3QYFA 4C3IJ 1TU0B 2QTWA 2KISA 3FMSA 4ANCA 4ZP8A 3TA2A 1R0CB 3OVAA 4F4YA 2MQNA 1T9XA 4G8XA 2KXFA 3CUNA 3KMQA 2X1CA 1PYTA 2QYGA 3PQKA 2NXEA 1PYSB 1G3YA 3VYSB 1VISA 4RGUA 2B43A 1HXDA 4RBTA 2QLFB 1SFUA 1HQCA 3K5LA 3NBPB 5JVGF 1RTDB 4QPXA 1E6YB 3V5RA 3M3YJ 1RZ4A 2XRNA 2F5VA 2AW0A 5B08A 3TP3A 5GP9A 3CJNA 1S4FA 5G0RB 4ENJA 1ZM9A 1NBEB 4QWBA 4DR6F 1V5IB 4P75A 1Z21A 4MK8A 5DJBA 1HD1A 3GVAA 3P5JA 4K4WA 1XCBA 3NBPA 2W7NA 2CQPA 5E3CA 2QGUA 1Y1WJ 2QCOA 1NSAA 3QT6A 1RTDA 2JX2A 1LV5A 1E6YA 1USTA 2JEIA 3WTZA 1NG7A 3GUDA 5J4YA 2E1MC 4BHPA 1M5VC 2QVOA 5K1YA 3ROUA 5G0RA 1IKXB 3LSGA 1IXRC 4ZZDA 4WWSA 2QQAA 3H59A 3IKVA 1U47A 2BA9A 2W7PA 3KLVA 3MTKA 2HOEA 4FNIA 5C42B 4ID5B 1RB0A 1UA1A 1QTNB 3MPDA 2BVLA 3QAUA 4H4KA 2CPJA 1T3NA 3K4CA 5HVFA 2UV8G 3HHGA 3G71S 2WAQD 2D3OR 2PEHA 2V9VA 5BXIA 2L4AA 1JXEA 3F56A 4HRIA 4QCLA 2ZZMA 1Z3XA 1FXDA 1ZELA 4N77A 3BDPA 2WA0A 4F7ZA 1VJQA 2HBYB 1YW9A 1DTTB 3O8WA 2GXAA 3Q24A 3Q3SA 4DL5A 1RUSA 4B09A 2F65A 2J6UA 3WE3A 2IW5A 4ESBA 5FFXA 3CUOA 4TU9A 5L3BA 3CIMA 4UQTA 2WB1D 4B3RJ 3CEDA 3EICA 3BR5A 1QGPA 2VLAA 4ZPBA 4RWXA 1SXLA 1GX6A 3H90A 2FF4A 2W00A 1B72A 4C6AA 4Y00A 2DJWA 1RACB 5DQGA 1VQOI 2R7ZJ 1HR0J 3PFIA 3QP5A 2LLKA 5E7OB 4W4MA 1PGZA 4ECZA 3NWRA 4E7IA 4EM1A 3MMCA 2L9RA 5HS7A 2CWXA 3JRCA 1QBJA 4YMEA 2DJIA 2OCEA 1ORKA 1RR8C 1HI0P 5K5MA 3GSIA 4WF2A 1S3JA 4OX7A 2GIZA 1TUWA 5D5VB 2UZKA 1MMGA 1GXTA 1FIAA 2H6BA 4NXNJ 3W5ZA 2OU2A 3A3OB 5TGTA 2DGTA 2OIHA 1VK8A 3IC7A 1S0OA 1VQPS 2JA2A 1LWFB 4L0YB 3OYCA 3HF5A 2B4UA 2ZO4A 1OY6A 4ZKAA 5THWA 1T8EA 2IVMA 4QR2A 4C2TA 3WQPA 3M6VA 3AB4B 1H0HB 3K1NA 3C3LA 1JNRB 4DBQA 1EH7A 4M9ZA 5HROA 1WKJA 3C6TA 3PSFA 1UG2A 2BE9B 3BG5A 5CYQB 2KZMA 5A0YA 3F72A 4CXFA 4G7ZF 1BQMB 2HHTA 1LWFA 5D4OA 2IIHA 3BKTA 3GEZA 3IR5B 3GP9A 2XYHB 4ZDNA 1LDJA 1KOOA 1RT5B 1PJRA 2YKAA 3K59A 1OR7C 1V3SA 2M8EA 2E71A 2CZVC 5IP7J 3G1LA 4M63A 3NGTA 2N7CA 2LY9A 2EZKA 4BCAA 4D7NA 1R5ID 4E70A 2R8HA 3IRXB 1QJHA 4PWDB 1WDTA 1TNTA 2BM0A 1URNA 1RAIB 4EZ6A 1BQMA 3BGUA 4Z7CA 4LQ9A 5EN1A 3IBWA 4M5MA 3PUBA 2R7FA 3D6FB 3CF5Q 3WTYC 4A3EJ 3TGNA 4ZLPA 5J40A 4Q45A 1U9NA 3OIOA 1X5PA 2ZJQF 1WGXA 4YUDA 5JVTA 3CCJI 2IC3B 3IRXA 1N5YB 3ZQLA 5HQ8A 2BJ8A 2KP6A 4DUYF 4EEFG 1RYRA 2NVXJ 4MLOA 2KHCA 4LJMA 3OLBA 4OINF 1XC9A 4PQUB 2UXDF 2AGQA 4B4CA 2V6EA 3ULHA 4CCNA 4ALZA 4KTQA 2NYHA 4X4NA 1S77D 1Q53A 3KP2A 4YFUA 2UVRA 3CJ5A 1OKRA 2IC3A 1WSRA 2CQ3A 3DEWA 3GYXB 1LNQA 4ED6A 1N5YA 2XMTA 1FYLA 4A2UA 1TW3A 5JFRA 4F25A 4X64F 1ZTWA 1BJAA 4OV1A 2FBHA 9ANTA 4PQUA 3ZQQA 5IT3A 1WF2A 3M8FA 1IQZA 3K58A 2NNYA 3R5GA 2BY2A 4BDPA 1T33A 1RBOB 2W2NP 2VJ4A 1IKYB 2B8PA 2DTRA 2HZCA 1NK7A 2XS7A 2W4SA 3RI4A 4KGVB 1Z77A 4MIAA 4QYZK 4DR1F 3TJ9A 4M3DA 1OIAA 5EHHA 3GF2A 5E3MA 5E1WA 4A8SA 4M5JA 1IXCA 3D67A 2GHVC 1YX5A 2BJEA 4OLOA 1PYVA 1TQMA 3BJOA 2JOQA 3HD1A 1ITYA 1MMNA 3BR0A 2DHAA 1WELA 1HCRA 4ECXA 2F4FA 2X6YA 2VPYB 4PR6A 2DXEA 3SDGA 3TAQA 1CULA 1W7PB 2J76E 3IHUA 4JK1X 1ON1A 4KH0B 3GIRA 4MGRA 4Q43A 3S3OA 1VMBA 2HLUA 1DP3A 5I3UB 5IYBJ 2YWGA 1ZGJA 2E5LJ 4FBUA 3EVMA 1XSDA 5IP6A 2IA1A 3TZXA 3OIPA 1X4CA 3E6CC 4ZK7M 1O6XA 2C2DA 3BSNA 2XLIA 3N6MA 2VBYA 3D9BA 1W7PA 3SFUA 3JSYA 3ZNUA 1ZRFA 2E9ZA 4K4VA 5I3UA 3DKDA 2W4CA 1MGTA 2KIQA 1NXIA 3DOKB 1I1GA 1PDNC 4XRSA 1ZAVA 3L4BC 2V9PA 2B6AB 1SKSA 1RT7B 4LG0B 2K3PA 2E36A 2RNGA 4USUA 1QZZA 3NGSA 1G4CA 2KKOA 3COAC 3PYDA 1N4LA 1Q86T 1S6UA 1MJBA 4IKAA 2ROEA 1P2FA 3D0IE 2NPFA 5KG0A 3HCXA 2B7CB 4ZCKA 5FJ4A 2HTSA 4BE0A 3KG1A 2VQGA 3RPQA 3OYAA 3DOKA 3RDIA 5ILVA 1IBKF 3F8NA 2KIFA 4B44A 4L5EA 3M8WA 3ENQA 3I5CA 4O3QA 5K8MA 1JJ8C 4OZNA 5B0CA 2VODA 3R6GB 3R5DA 1AA1B 2BOAA 4H0EA 3W8PA 2L48A 2ZOMA 1UEUA 4DIQA 3B78A 1YIJS 3G8SA 2ZDPA 2GMHA 3PJXA 1UETA 2KDZA 5T14A 1X1AA 4CT8A 4IHSA 2CQ1A 3OL9A 2Y31A 4KIBA 4QQBA 3QSIA 3SCKE 3I55S 3CC4S 3GZ6A 1A35A 1W36D 1FTZA 4LK0F 5KG5A 1OISA 3TR5A 1P92A 4LVOP 1GT8A 1RABB 3W64A 2H65B 2WHOA 1O7FA 3CQZJ 3A02A 1VJWA 5LMNF 3B6BA 3PTWA 2CQGA 2IJNA 4PPDA 4B48A 2PE8A 5LEJA 4ICLA 2FJAB 4G1IA 3KLEB 4C0OC 5CD4H 5L1LA 3OYGA 2X9DA 4I0WA 3P8BB 4W98A 3KPHA 4KGMA 3D68A 3MHYA 1X31C 1BR2A 2AYGA 5E17F 3ADAC 5EYRA 4ABZA 2EA4A 1NHVA 2E5JA 2JWNA 3GB0A 4B3OA 1NPPA 1KGSA 4NMXA 2EPFA 2DNGA 3ZMUA 2B4VA 4IX7A 3HHLB 1OCZH 3R5JB 1X0PA 2TCTA 3LA3A 1C1CA 1PILA 5GPCA 4KGKA 1NK2P 2RDPA 3FK4A 3U1DA 1BMQB 4CLFA 3HT0A 3WIUA 4A3GJ 2D74B 4DG1B 3PDNA 1HNVB 4DV7J 2GVZB 4R1HA 4ZVGA 1POGA 3ESWB 4NZ7A 1PKUA 4A48A 2HFZA 3V7SA 5HDGA 2NSBA 2CFXA 2P9CA 4OIXA 1W2IA 1XGNA 4M6YA 2LK2A 2CJJA 4I67A 1B7FA 1D3YA 3M6XA 4NLGA 1KNZA 2LD5A 2F4IA 4Q8EA 1U0HA 1VC0A 1IKWA 2AX0A 4DZDA 4ZVUB 4NB5A 5E3RA 2YWFA 5LGTA 1BIAA 2QFIA 3H36A 3VR1A 1K0TA 2BXZA 5I4MA 2ADBA 4IQ4A 1F43A 2VG7B 1GXPA 4O0NA 3HFZB 1UHMA 2JSCA 4K4YA 3Q89A 1RI7A 4P7TA 3M30B 3BQZA 1SPBP 1HD0A 4BJ6C 4AL6A 1WH5A 1XR7A 4F02A 4O4RA 1MBKA 1ZN2A 3GCWP 3CD5A 3I64A 2P7VB 1KWMA 2B9SA 3E01B 2VG7A 2IVYA 1RIOH 1JUSA 3IXQA 2RJZA 2RKIA 1NSKL 3LQVA 1LXNA 4RMNA 1NAQA 4BHCA 1M1KT 1TC3C 3TX0A 4RX6A 1N75A 2DRAA 4MH8A 3ETOA 4ED0A 1EETB 3P9CA 1U26A 1FKPB 2RHQB 5HSPA 5DUIA 3E01A 4GCVA 3IV5A 3IH4A 2OPSB 5LHHA 1S57A 5DS9A 2NSCA 3UDVA 3H8YA 4DQ2A 2RREA 4L18B 1FFGB 2XHCA 2YPYA 2ZC3A 3G2XA 4LFAJ 1N5VA 4JI6F 4OHXA 3P5TL 4MMOA 4G6DA 2WBRA 3FNNA 1X4EA 2OPSA 4LF7F 2HRUA 2VQHA 2ZNYA 3H0DA 1FOXA 1YK9A 3MI7X 1K1QA 4PGHA 5CYVA 2GIRA 2ZD1B 2VONA 1KA8A 2BMBA 4F0KA 3WTSC 3MQ0A 4IQMA 1A04A 2E5ZA 1HWIA 2VQCA 3FMBA 4RO0A 4GO5X 2KYZA 1P8GA 5H9FK 4DV4J 4A8MP 1MBHA 5ETVA 3HHKA 2I38A 1C4CA 3KUHA 5H9EJ 3MD1A 3CDLA 2QA4G 5CVVA 2FRHA 4KFBA 4ETZA 2BXYA 2MKCA 3MM7B 4GRIA 4BYYA 3L2WA 1X4GA 2G0EA 3PACA 2DO7A 2KRFA 5HVQC 1D09B 2XAUA 1FFWB 4UT4A 2XMAA 3CJTB 3J7A1 2EFOA 2Q6BA 2DA7A 2KI2A 2RILA 2VG5B 3W6JB 2XMWA 3M9MB 4J9RA 3K2YA 1FDBA 3FKBA 5DCFA 4YN3B 2X1GA 5C2CA 4P10A 3A0HC 3MM7A 4KGZB 4A5MA 3FGVA 3M2UA 3CCSS 1T0TV 2Q0OA 1UWBB 4P2XA 4Y17A 1JX4A 2XVCA 1VQ9I 8RUCA 3V6JA 4DX7A 3JRDA 2WCXA 4OL8A 1VTNC 3CJTA 4ENMA 2Q66A 3W6VA 3DRRA 3CLQA 1FRLA 2QBYA 4CYUA 1S9FA 3E3XA 3OV7A 5DM7Q 4LRDA 3DCAA 3HMJG 3Q9VA 3ET6B 2CW7A 3RB0A 2Y0SD 5J2PB 1U45A 5LSRA 1JK9B 1FDDA 1NKCA 4DN9A 4ES2A 4JI3J 2Z2SB 1IBCB 4LF4J 3H0PA 1JHFA 2DNLA 2ALYB 4UZCA 1Z67A 3BTLA 3RCOA 2DOAA 4M5IA 5K5RA 4ENKA 1RPWA 5ETOA 1FO1A 3AT1B 4TKTA 3GO5A 2OQRA 1YJNI 2RVJA 3HZGA 4A69C 3ET6A 2DBBA 1RU1A 2UXBJ 4Z2XA 3FXUA 4ZJOA 4EGLA 1GXLA 2HK2A 2IGOA 4B3XA 3N4MA 2HDDA 1CGPA 3CDWA 3AFGA 4PXBA 2PT0A 1N56A 3DBRB 1RADB 3MEGB 1V5FA 1T6SA 2NRAC 2GCFA 5BPDA 3DLAA 2R8GA 2Y48A 5JLWA 2ZKUA 3TJAA 4N0BA 4NC8A 3MMBA 3F0NA 2XO6A 3I87A 1WEZA 1X3ZB 4XORA 2K9LA 3M8YA 1BW5A 3D5LA 3TOAA 1S4EA 4ZPTR 2IMWP 3H5SA 2XMMA 4DFKA 5JXSA 3IKTA 3VV2B 3ASNH 2OZ6A 5BYRA 1PUEE 1Y8RB 2LRDA 4EO8A 2MZQA 4AUXA 2CW8A 4B9LA 4YDXA 3FK6A 5GPAA 4ES3A 4YIRX 1KLNA 4NXMF 4CCJA 4J00A 3DXJF 4PZJA 3ZGKA 1F1BB 2ZITA 3KFWX 1D0ZA 2C3PA 2MQMA 3TZWA 1VQOS 4F2SA 1U2RA 2FIUA 2HHVA 3CP8A 1SVDA 3C14A 1ULRA 4PG8A 1SIWB 5HI7A 1KN6A 2HQ5A 1TAQA 2PFBA 2XI3A 5KFYA 3GTYX 5LBQA 2Z4PA 5CVIA 3GTGJ 2CRGA 3FXQA 4BEHB 2VB6A 4FYYB 3DLGB 4MNUA 2DPIA 4JX4A 3TO9A 2MC3A 1YRTA 1TBXA 1LXJA 1R49A 3LSHA 2KJBA 4F8RA 4ZPDA 3ZN0A 3EUHA 2V4JC 3HSEA 2M4MA 5AXMA 1U0SA 1QUVA 4N9IA 2MQPA 4FYXB 5J2MB 1V54H 2K9NA 2HMIB 4PWUA 3R1LA 2E2IJ 1RUNA 2HWHA 4HHJA 2ASDA 3H92A 1S6QA 1X2MA 4IOCQ 3R3TA 4BXXJ 3CP2A 1IC8A 2F5GA 1FX2A 4TQSA 3IBCB 3DLLQ 2VKVA 1K44A 4LLLA 2QYOA 2HYGD 1WHWA 3FEXB 2RQCA 1S1TA 5J2MA 1X4AA 5M2UA 3J7AO 2HMIA 1S1UA 2MZTA 1FJGF 1RK8A 2OV7A 3HRSA 3VFZA 1N33F 1RRJA 4DU8A 1S9GB 1FJCA 2LA6A 1XNQF 2CAJA 2VPXB 3ABLH 3KJVB 2ZH9A 2FSWA 1QAJA 5FIIA 2CPHA 1A6QA 4P6QA 5C44J 3TDZC 2PX9A 1LFPA 4ESJA 4RW9B 2J7KA 1JGGA 3K9TA 2CO5A 2CW0F 3LMMA 3RPUA 4WXDA 1JT6A 3UDEA 5LSOA 1DP7P 1S9GA 5GAEI 3PYFA 7FD1A 1XTAA 3T1YF 1FX7A 3P96A 2VFVA 2GW8A 3CCJS 2LU1A 2OUGA 2XNQA 1TK8A 2HAIA 3Q8UA 5L9XA 2IJRA 8AT1B 2DNYA 4J9SA 5HK4A 3ZTSA 3OV8A 5J4VA 3D1NI 2GA7A 2R92J 4EMSA 2Y75A 2R8KA 2V0NA 4ED2A 1NPKA 3EYIA 1FJ7A 4DV3F 4YRVA 1SUQB 2UVWA 2WVEA 2CWKA 4Q48A 1ZYQA 2K3IA 3LO3A 3UDLA 4CCOA 4OJ1A 4HV5A 2GA1A 4W97A 3C3WA 3L7PA 5JVGQ 3FJ2A 2EW9A 4CRJA 1D9FA 4PSXA 2D3ZA 3KHHA 2BW7A 3PNVA 3DLKB 4MYUA 1PUFB 2KXHA 2KRHA 3ZZTA 4ELVA 2DODA 1IDYA 4ERDA 3QQCD 5HQMA 2XGPA 4RBUA 1FT8A 4IRKA 1SUQA 2YY3A 1FX4A 5RUBA 3SQNA 5F41A 1SJ4P 1MBFA 5D6FA 4HX8A 1G1XA 1WORA 3DTEA 1YX3A 3X3UA 3NARA 3C19A 4M6VA 4C3HJ 1N25A 2KN4A 1XBWA 2U1AA 1R9TJ 1FNOA 2CJXB 3GFZA 4H4OA 2GQQA 3WHCA 4D3HA 4EJVA 3QYYA 3DLKA 1PUFA 3K0JA 1NK4A 4W1UA 1RAJA 2CSOA 3CCMI 3N6NA 1R6VA 2V50A 2XPWA 1NK3P 1IUFA 2STWA 4PJJA 5DQIA 3TKYA 3K5MA 4CGZA 4BU2A 1ZH5A 4NA2A 2VC1A 2C42A 2I2YA 4C2MA 2VOOA 3DOLB 1RT1A 2ASYA 3I9V2 2L7MP 1T0FA 4PGGA 1AW0A 3QWUA 3K4BA 1ZARA 2HPUA 2XWYA 1Q7LB 4PG4A 3L2RA 5ICEA 4TVAB 5AXLA 4H4MB 4C0BA 2XB5A 1WJFA 2QLWA 3S17J 4C3KA 3J7YJ 2IDEA 3H0GJ 2P8TA 4OIOF 1KP6A 1Y5NB 1DU6A 3OIQA 4A3FJ 1YHQI 2D5VA 3W6KB 2WRMA 2JPBA 4E7ZA 2HHUA 4WX9A 2X1BA 3NCQA 2Z57B 2HVZA 4B3SF 3W3CA 2M8HA 1YJUA 3EZUA 4IG3B 1MNEA 4BAYA 1Y8QB 3MKZA 4H4MA 1AUDA 1V9OA 3N4WA 3LSMA 1N0UA 2K9MA 2VC0A 3T8RA 2QMWA 3VAHA 4IO1A 2DFIA 2NUHA 3OLAA 2RD5C 1G59A 1R71A 2W01A 1P4XA 4JYAF 3TJ8A 1FWLA 3ZZPA 2BHZA 5E3PA 4DR7F 3F21A 3C2PA 4EI2A 4OX9F 1ZPVA 5T7LB 3MUVP 3TO6A 1Z05A 4RW8B 2X6WA 1ZAXA 3R97A 2W9AA 1KQ9A 4BKXA 1I6JA 1WI9A 4RW7B 2QJ3A 2NLWA 4Q7AA 2IDLA 1G3WA 1VQ6I 3CF2A 2DT7B 2GV1A 2M9HA 3G73A 1I5OB 1QLNA 5DS7A 2BE7D 2GJIA 5K7HA 1YFHA 5D5XB 1V3RA 3HO1A 3WG7H 4YFNF 2ALZA 3R6LB 1FRKA 5LJ5Y 3HJVA 4WWCA 1VQ5I 1ICEB 5T7LA 5KTQA 4RW8A 4EV0A 1UFWA 4WPAA 4IO9F 4WP8A 1FC3A 3E3VA 2CJBA 4DUYJ 4RW7A 4B1RA 1VRQC 2QV6A 1WSUA 3LGNA 1VCTA 2FJ1A 2HSEB 2UXDJ 5M2PA 1OQYA 3DU6A 2EZLA 2OMLA 1B0VA 4J7CA 2HHQA 3JRAA 5H2FC 3AG1H 2QN6B 3QNWB 4FE4A 5F0HA 4BY1J 1B6AA 2XZDB 5D6EA 1XGSA 4KNYA 4USMA 2HFUA 3TVKA 2AQ4A 3EXYA 2XGXA 3B02A 3TUJC 3BJAA 2BM1A 2DI3A 4X64J 1DUXC 2JA8J 3FBEA 3THTA 4I01A 1RBLA 2GX8A 4AE5A 4C9DA 4A8FA 3OR1B 4PWWA 4FS1A 1X3WB 4BH9A 3CXCR 4DQQA 3BZ6A 4O4GB 3HVWA 3T6JA 4GMKA 2MGZA 1ZM2A 2DNKA 1QU3A 3QJPA 3S1MJ 2ZJQQ 1CJVB 3P9IA 5F9LA 2JVHA 1WC5A 4DR1J 2GNKA 1Q78A 2POKA 2MQLA 2DNMA 3TX8A 3FEZA 1X9SA 1MJ9A 3OR1A 1NK8A 4K4SA 3HHDA 1NJWA 2B9XA 4YR0A 4ZYDA 3SZ2A 5GAHJ 1FBSA 2UWMA 1R5HA 3MUTP 4DL4A 2P0WA 1XJWB 3MAJA 1CJVA 2WW4A 3G87A 3Q0WA 5EX3A 2KXNB 4OI4A 2GFFA 4TLQA 2NS8A 5DDGA 1U25A 1V5EA 2PQ8A 1T9WA 3DI6B 5AXNA 1X5OA 3ZZYA 3LA7A 4WZQA 3K4MA 3ILIA 1NHKL 5E79C 4IKFA 5IQ6A 2YNIB 3PX4A 3MZYA 2FY8A 3BGOP 4JP0A 2KO1A 3UI3A 2DISA 1E17A 1H2TZ 4QWEA 3OMYA 3IAS9 3GG0A 1HWKA 3W9HA 3OYNA 3WC0A 2XGDA 3G9CA 3NEKA 3DI6A 3C16B 4HDVA 3IFEA 4LF5F 2CPDA 2NPIA 4CWBA 1NU4A 1U8SA 3A13A 4OJGA 1CJTB 4DWIA 3QATA 1HHQA 1NDKA 1G2HA 4USTA 3BG7A 5SZTA 4NPOA 4WXHA 3CVKA 3KLFB 1EIYB 3V6HA 2M0MA 1B64A 2P6SA 2IRFG 1N36F 1XDSA 1S6OA 3I54A 1UPPA 1IBKJ 1DLOA 2ZZNA 3GONA 4O6JA 1K6YA 1WOSA 1GT0C 1D8KA 1SVLA 1LWXA 1R3NA 2DGWA 4C11B 4MFBA 2W9CB 4K4XA 4FKXA 3HXMA 2F5FA 3KLFA 2XNRA 3V2UC 5GAEU 1ZRCA 1STZA 2HQFA 4J9UE 3SDBA 3FXLA 4ED7A 3KEOA 1ERDA 2KKHA 2JT1A 3BCAA 4QR1A 2FU4A 4PDKA 1X2NA 3N5BA 1IQTA 2LYCA 4U8YA 1TL3B 4DHVA 3WHBA 1BLUA 2XY6A 1C0TB 1IR0A 1X5TA 3DKWA 1NDPA 3K0LA 4IF4A 3POTB 2AX1A 2MKYA 3GR0A 3O6BB 1J5EJ 2ZWOA 1QY7A 2W48A 1BC7C 3RRGA 2OD5A 1VQKI 4NHJA 3ENVA 5LMNJ 4TU8A 4HDHA 2HQDA 2UZAA 3TP2A 2OPTA 2G9OA 4X84A 2AGPA 3EM1A 2CNLB 1DPRA 3PW5A 1C0TA 1VQYA 4AYBD 4M94A 4YR3A 2JHEA 3T6BA 2V68A 4CCLA 1HSJA 3POTA 2MC4A 1YI2S 1NJZA 4M5LA 5CQGA 3R1HA 4LF8F 4UQGA 1NK0A 3CDIA 4O3PA 5JI6A 4NQWB 4AVPA 1SEUA 1O3QA 2MLKA 1FDNA 4R8HA 3LF0A 2DR8A 2KJCA 1GUUA 1D0YA 1NJXA 1AZSB 4EEYA 5DM6F 8ATCB 1VQ9S 2DYSH 2G2OA 3RYPA 5C24A 5D5WB 1EV7A 5KFZA 1E0EA 3QZ8A 2R5YB 2ZUAA 4NQWA 4L0ZB 4AXJA 2JN6A 1KQGB 4UW2A 4V2GA 4KO0A 3IH2A 3VSLA 1W0TA 1D1CA 3GFHA 1H8AC 3W8GA 4KN4X 3SFZA 2GHWA 3VDXA 1CSJA 5HN0A 1LFBA 2YX7A 2Z2ZA 1AZSA 4N56A 3VZIA 3NCRA 4IHYA 1LKZA 4HOBA 2BABA 2KM8B 4U0YA 4BJTA 4BQNA 2R5YA 1HW1A 3KK1B 2WAFA 5E8IA 1OJ4A 1DU0A 2OELA 3HDSA 2LF8A 3UN5A 4UXNA 3F8FA 1JLQB 3RB6A 4ZPAA 1CG2A 1M0SA 4NZ0A 4DYCA 5E5NA 5F0WA 2MHNA 1A9NB 1YITS 3CNQP 4KR0B 7FDRA 4MTDA 1T9YA 4DZ6A 4PJMA 3TI0A 2DK2A 3U1LA 1X4OA 1U1KA 5A2QU 1UMJA 2YS9A 1MNMC 2L5QA 3Q8PB 1UZHA 4DR3F 2HFHA 1BM9A 1YS7A 1MROB 1S12A 1H74A 1S79A 2CZ9A 2CU7A 2DMQA 4FT8A 3OL4A 4LF9F 5HS8A 3SV3A 2AJQA 1UA0A 2FMYA 3K7AJ 3IWXA 5KCMA 2Y69H 3MWBA 1QVTA 3MM6B 4CH1A 3I5BA 2FMLA 3A4TA 2P81A 2BQUA 1ZPWX 3FCHA 1Q8KA 4N9HA 3I31A 4LRBA 2PBIA 3Q9SA 1XCVA 3PYGA 4PUOA 1BOAA 5A2QZ 1RYSA 3DPTA 5M5YJ 4XPEA 3VPRA 2V7FA 3QT8A 2WBMA 3VQTA 4NCGB 4DS5A 3MM6A 1SIZA 3GTLJ 2VPWB 3X2QH 1ACMB 2DO4A 2BKOA 2BBYA 3GPAA 1T9UA 5F8HA 5K7FA 2CUJA 3ELHA 4LF7J 5ETQA 2ZKZA 2VHGA 3W5YA 3PX6A 2B9EA 1W5SA 2PMZN 1MIJA 4AXIA 3UWTA 2DGSA 2F9DA 2RKHA 2XASA 4D0PA 2IP2A 4ZLLA 1WOOA 4A8XA 4BACA 2PJRB 2ATCB 3OS0A 3G82B 3DHXA 3SSSA 3HSJA 2HZAA 2NYIA 4GXOA 3ICLA 5IZHA 1KFDA 2GAGC 3S32A 2GQ2A 3OR2B 5CVJA 2X3GA 4HEA9 4NCBA 3JRIA 2V1NA 1HBMB 3GFMA 3NL0A 3CJ3A 3ISZA 4NUBA 1IXKA 3R61A 3IP0A 2WSFC 1UFMA 1R8PA 1N5QA 2RT3A 2G0CA 3RQ4A 2H27A 2ZMEC 3FXMA 1N6QA 3ZCOA 2CJAA 4PG5A 1SL0A 3MZIA 4X4SA 2C3UA 2ZHAA 4HF1A 3QRFF 3OSGA 3PIOF 2H4WB 5BR8J 3OL7A 4ECQA 2HFSA 3JAMY 1FYMA 3LANA 2HHHF 3QAHA 3SBMA 1QO0D 2FE3A 2QWWA 3SSRA 5C3EJ 2CGPA 2YKPA 3O8GA 3MXHP 3QPIA 2QKLB 1LVKA 1FCAA 4I1TA 1AA7A 3KHRA 3FUYA 3ZP5A 3BPDA 2MLXA 4MYTA 2EV6A 2MKKA 1KU3A 1YJ7A 4P1WA 2WSEC 1Q79A 3T9ZA 4CLUA 1JTYA 4Y0FA 4BDZA 4U0VA 1MBEA 4ED5A 3EJMA 3LALA 2IBKA 2N3LA 2UP1A 4NBQA 3QJLA 3CPWR 3C6UA 2MEWA 4LQ3A 3S3NA 4JI5F 2CXEA 1BW6A 5FJ8J 1XD7A 3IWFA 3MAAB 3SYTA 3M2VA 1BJZA 1FOYA 2K2PA 5B3SH 2BVZA 4JP8A 3CUQB 1EJ9A 1F5BA 2M2EA 1ZLKA 2VXZA 2PI4A 4ATNA 3ISNC 2Y30A 2OCCH 1ROFA 3PW4A 1M1EB 3FSIA 1EA3A 4DR5F 3G1OA 4C2MJ 5KAFC 1RGVA 5JHUA 2AV5A 4OZ1A 4X62J 1FNMA 2VD3A 2HWVA 3PCOB 2X6XA 5EWFA 3DDIA 4L75A 4ILLA 3MAAA 2DYRH 4K0KF 5KFWA 3SZTA 1Y0UA 2M8DB 3CJRA 1J9IA 4NI2A 3BJYA 1BY9A 1FTTA 2HVEA 3F0CA 3DQVC 4RGSA 2R3VA 3KKFA 3O8HA 2RMLA 2G0JA 4P9UA 5F3TA 4D5FA 4DJAA 3T9NA 5J1NA 2ZH5A 1BC8C 3H3ZA 2Y2ZA 3IP4B 2PDAA 3N6LA 4NXMJ 3HX9A 3T41A 2BANA 2D7SA 4HV6A 1RAHB 4X4UA 3QPTA 3C15B 3I59B 3WTVC 3CCMS 2A6HF 1WQ2A 4IHWA 3JSRA 3HP6A 3PFEA 4XQFA 4OHZA 4DL0C 3LAKA 2C2MB 1NJYA 2QL7B 1Y1VJ 2IS6A 4BBYA 1TWFJ 2DPJA 3FXOA 4BXFA 4KA4A 3DGVA 3I9ZA 4HG2A 4R25A 1GXUA 3I82A 1CF7B 3SYZA 1ULYA 2ZJRF 2X1AA 3I59A 4YR2A 5GTHC 2D1VA 2RAEA 3ZR8X 3G2BA 2M45A 1RAOA 1GH8A 1T03B 4UY85 1HQUB 2GIVA 4O3OA 2RU3A 1RT6A 4B9UA 4LIRA 1O3SA 2DAOA 1RESA 2L0KA 1SH3A 3TQ1A 1YHQS 2J8AA 1S6PA 2WVBA 2MPUA 2O66A 2D9OA 4G6TB 1U9OA 3OY9A 4PUSA 6PAXA 1N5TA 2MSYA 1R7JA 2LEBA 2CDQA 3H9GA 4ZA1A 4RM3A 5AXKA 1T03A 2RQQA 3FDYA 2KL8A 5T41A 4RGRA 4IFYB 4V19J 1WD6A 3REOA 2BZTA 1EARA 4YQWA 3ZRGA 4IPAA 2ZBPA 1KU9A 3VAJA 1N33J 4I2PB 4GYIA 4O3NA 4H4KC 5IY5H 1XNQJ 4TYBA 3PR5B 4KC5A 3H5XA 1VGYA 5DEQA 1S1XB 2RDDA 3H98A 4N76A 1PBUA 3BTJA 3H1CA 3PQJA 3FSXA 3DBHB 2CPYA 3L7UA 1E2XA 3GTOJ 1BIBA 4U7BA 1FJLA 2RQKA 2W1OA 1VQ6S 1HPZB 2Y9HA 2HTJA 3ECOA 1IBLF 1HHSA 4I2PA 3FMWA 4HDUA 3GMEA 3I58A 3UDCA 3AAFA 1SFEA 4EVIA 3LSRA 3T1YJ 4B3TF 3JRHA 2V69A 4Z7YA 1S0NA 2MYSA 4KQZA 1VQ5S 1F4KA 4DQPA 4UF4A 2DT6A 2E1AA 3M7GA 2E35A 2M3AA 1ETWA 3CF5F 1A6LA 4UHTA 1RUOA 2HHPA 2PD1A 4X65F 1YKWA 4I64A 1QNTA 1KZHA 1RWKB 2CMPA 3V6KA 2LKZA 1XSXA 4HACA 2C3YA 2LYVA 3R5BA 1I27A 2RU9A 1HMVB 4I98B 2K7KA 1L3LA 4BS9A 2YPRA 3TW7A 4WFBQ 2MABA 2M4KA 2Z2MA 1UZCA 3SJMA 2R7VA 4U7UK 3K10A 2LREA 3PXGa 3M1VA 2YNFB 2GZWA 3W2WB 4DV3J 4OV6A 2EG2A 1A6IA 5IT9Z 1VHFA 5GADJ 4CDGA 1XN9A 2PA8D 2J0WA 4F4KA 2QKMB 4J9NA 1MZBA 3S01A 1IWGA 2EI5A 1QVFR 3HXLA 2GGPB 4M6XA 4WFNQ 4CDIA 2DK8A 1CS4A 1WTBA 2JRSA 2A3JA 2DY1A 1LJ9A 4DL2A 5CZVA 4DR2J 5LHIA 2HBQB 4I69A 2XSDC 3JSMB 4L5IA 3W2WA 1B7YB 2C1EB 2L02A 4HHUA 3CULA 4IHVA 2OEJA 2KT2A 3E6DA 4LSNB 2IAIA 1XTZA 3B8HA 4M5KA 3I0RB 1QA6A 1NJIT 2R5ZB 1TMMA 2W2PP 2D2WA 1B99A 4DV0J 4NLOA 2GGPA 4XN3A 2OPPB 3SHFA 1W25A 3WTXC 3I4HX 3GLXA 2BYCA 2CG4A 1MKMA 3OTBA 2KHMA 1UEVA 3ZOBA 4LSNA 2O8KA 4UVAA 2VQFF 5A2QK 4UVCA 1QDUB 1K7AA 2F2EA 3IG1B 2R5ZA 3H5RA 4LJZF 3HVRA 2OD4A 2R7XA 4P96A 4FDFA 2OPPA 1MDMB 1EP4A 3FCWA 4UOGA 5HDKA 1YQHA 3AA8A 1RAAB 3PW2A 3MR7A 1ODDA 4UOHA 3E2EA 2BXJA 2ZH8A 1IW7F 1R27B 2EK1A 2V94A 3Q22A 1U5TB 3IG1A 3CCUS 1HDPA 3EX7B 2DHSA 3UD4P 4CYCB 1HF0A 3PRVA 1JNZB 1CQTA 4TY9A 5B1AH 5K8NA 4CICA 2DA2A 2QZ8A 1MDMA 2VH7A 4HX4A 1ENHA 2FZCB 2NZCA 4ECRA 5KOXA 1Z4UA 3PYEA 2LSOA 3GLJA 2N3OA 2DHGA 3TQEA 2UVVA 4C8LA 3GWZA 3J80Z 2GJ2A 2ADCA 3VQSA 1FSHA 3G6YA 2KT0A 2G9WA 4GC6A 1R89A 4USJC 4HBLA 3T19A 3HL2A 4NDLA 1FK9B 2IXSA 4DOZA 1ZKGA 1WI6A 3TA0A 2WAQN 5ICFA 4JYAJ 2LA4A 1TTHB 2NS1B 2LLZA 1GTEA 3BKUA 4RUHA 3OFFA 2OP5A 2OH2A 5DQHA 1J09A 3M9NB 2R7QA 2LNBA 1BQNB 3BLYA 3LUYA 5I3PA 3NLCA 4U7UD 3MKWB 4ELUA 1UCRA 3C1DA 1EZZB 2AYMA 1FSEA 2FBKA 3UCZP 1SV5B 2O3FA 1FK9A 3A8JA 4U88A 1SJFA 1KQ0A 2GHPA 4FF3A 4X6AJ 2U2FA 5K14B 2HKEA 1VBXA 3HRMA 3S15J 2F1FA 2HU9A 3RQIA 4ZP9A 3ASOH 4W90B 2R7DA 1DFDA 4OAZA 5BMZA 3V4MA 1VQKS 1SV5A 5E3AA 3HPGA 2W25A 4FETA 1S49A 3UR3C 4FX4A 4FF4A 1IN5A 2AEJA 2ZNZA 3MZ8A 3PO5A 5K14A 1M5PC 3L95X 2SXLA 2E29A 1SD5A 3CD0A 4CHUA 1ZETA 1D8ZA 4MIMA 5SUHA 3BEGB 4WXCA 3VOEA 2R4GA 2BW3B 2K4JA 2ID3A 2YQ3A 1SVOA 1LVAA 4XLPF 1KD1T 1DY3A 1ZR4A 3JAMU 2B7BB 2LVWA 3DGPB 2XB0X 4ZLJA 4D7MA 4DFPA 4CO2A 2V2KA 1CQMA 4W92B 2YNHA 2NUUG 2XY5A 4QIFA 5LGNA 1XGOA 3H4BA 3DEEA 4TU7A 3KXDA 1G4DA 2CPXA 4IFVB 2VKZG 1JLBB 3DLHA 1KEKA 3AH6A 3IC1A 4IO9Q 3TZZA 4WYWA 1RWUA 4IH5A 2A6TA 1RTHA 2OO4A 3UW1A 4YS2A 4QW8A 3SQGB 3KLGA 1X3UA 5KG3A 4EGYA 4XL9A 5HS9A 1C4AA 1LW2B 3WTTC 2H1KA 1LWCA 1JLCA 4IFVA 4OYAA 1HNXJ 5FD1A 1I51B 3G6VA 2DGQA 3CD7A 4I6YA 4OZ5A 3JCUC 4ETXA 2I5JB 5ED4A 4A8OA 4DL7A 4OIQF 1TWCJ 1IUYA 3BG9A 2AYEA 4RLFA 1JJ2R 4U0WA 1Q95G 2OAUA 1TV6B 2RB7A 1ZLJA 5LGUA 2Y0MA 2IS4A 3IMQJ 3FXJA 1TT5B 1LW2A 3VGUA 1N48A 3BO3A 3HPOA 2JSPA 1UJ8A 2AGOA 1R22A 3GJSB 4K8RA 1XPXA 1LWEB 5I42B 4DW6A 5B0FA 1Q8BA 4ECWA 2EIJH 4YEJA 5GTIC 2W9BB 2WZ1A 2BEOA 4HX7A 3PEJA 3MR3A 1FLIA 3IBFB 3EVOA 3U27A 1NZAA 1P9QC 2QQBA 4DCJB 5KFTA 4O5VA 2VJ5A 1MU2B 4ZN1A 2GZOA 1O4XA 2GBYA 4LSLB 1EH8A 2HS0A 4DI6A 1Q81T 3ZMSA 4OMZA 4P9FA 2OLWA 4DXLA 1HYSB 4NZ6A 4PSWA 3T1HF 4DV7F 1Y0NA 1FRMA 1RR7A 1JJ4A 2W9BA 2XSJA 1EAYC 3VALA 1SMYF 4G7HF 1R6RA 4TYAA 3LH2S 3LW5C 2JEJA 2QEXI 4ZVFA 1TLHB 2MB0B 2EILH 3ZFVA 5LM7E 1HYSA 2L3DA 3TL4X 5D3GB 4P9SA 2W1BA 1ETQA 3CO7C 3RSNA 1AKHA 4ZVHA 3IAS2 2FZKB 1BI0A 4BJ5C 3MEEB 2XS2A 1B9NA 3WU2C 1TVRB 3D5SC 1X7VA 2V2QA 3OYMA 3H20A 3ZZZA 4AIKA 4LF1A 1S6LA 3GFXA 3OYFA 3KOAA 1GFWB 2O3DA 1N5SA 5D3GA 2LVSA 3GTQJ 5HLFB 4IDKB 3QLHA 1LB2A 1ELOA 4ID8A 1RAFB 3E5QA 2FHJD 5EUHA 1VRTB 3MEEA 2HFNA 1S0MA 4Y2AA 1O3TA 3W7BA 2COBA 1WOPA 4TN2A 4AIHA 2QA4I 3LP2A 2E2HJ 4JI2F 2VQEF 2YQ0A 1RDRA 3KK3B 1SC3B 3BR2A 1PJ5A 4IDKA 4KHPF 4DPTA 3PJWA 3BDEA 5KFEA 1KLMB 1RE1B 5KNLA 2OTJI 5IT9K 3RZAA 2C2NA 4XM3A 1JLGB 1VBKA 2ILZA 3MEXA 4USHA 1FRHA 2HDWA 1F3VA 4ZVPB 2R8JA 3KK3A 3Q8QB 4ZDOA 2IPQX 3CCQI 1BXNA 4MEXF 4D3GA 3T3FA 2LKSA 1KYWA 1D3WA 1RHJB 1TQIA 2HGCA 2EEYA 3BSAA 4DX6A 1TR0A 3G96A 1K79A 1WEYA 1JLGA 1VIOA 5D6GA 2I10A 2AZ1A 4PYDA 4OOIA 2PEBA 4X4OA 4LFUA 3OL8A 3AB2B 5BYQA 2DW4A 1FXRA 1WJ9A 5DM7F 3L1PA 1UZDA 3MTJA 2P5KA 1OMIA 2VKDA 4X4TA 3J7YI 1SB6A 3KWMA 4DV4F 3OFHA 3HKZD 2IGMA 3ULQB 2E34A 3LGHA 1HKAA 1FOKA 1T02A 4DV1F 2JWTA 4O3RA 1S1WB 1VFJA 4OMYA 3FFIA 3BDDA 2I6WA 1VOMA 5ETLA 5HDNA 4P2MA 2XM3A 2GMLA 1S9EA 3BR6A 1FPQA 2W85A 4HSRA 1XMOJ 2FQ4A 2UU9F 4ZP7A 2BY0A 1DHMA 1YRUA 3NOCA 2Y8YA 2M5YA 2AWZA 4OQJA 4YB6A 5J2QB 5ETTA 4Q47A 3MR5A 1QAYA 1S1WA 2LQJA 2EQRA 4L6V3 5A8WB 2IT0A 2RRBA 2MY8A 4X66F 3V4IB 2F8HA 2W4DA 5JR3A 4LF9J 2J5AA 3BZCA 4C30A 3E5XA 2M7BA 3VVUA 1HQEB 2O1PA 3KUGA 3HM9A 3QYBA 3HOXJ 1WPKA 4M8LA 2CQNA 3BGFA 3AD9C 2J0XA 4KIFA 4F55A 3LOUA 1HNIA 2XDVA 3T5XA 3AOBA 4G3IA 2C2KB 4ZS6A 3NAIA 3KEQA 4B9TA 4LF4F 1XIQA 3V4IA 1SAUA 1R8BA 3LFKA 2L54A 1FTCA 1HQEA 2JLFA 1APLC 3MEDB 1JQGA 1WC1A 4BQAA 3MPUB 3QFHA 2O6GE 3V8LA 3ERED 5HANA 1WJCA 1MMAA 1REVB 2UXBF 2F40A 3DRPB 5KAIC 4ZVTB 4N7TA 1X0FA 2FJXA 4MFEA 3LQRA 3DM2B 3BH6B 3M8QB 5J3LA 2Y3YA 3MFHA 1ZGAA 2VFTA 2NCKL 4NRTA 4N5SA 3DXSX 2XPUA 2MMYA 3E97A 2PO4A 2A05A 2DNRA 5EGOA 3MEDA 4RU9A 3C7JA 2GS8A 1A0OB 2DNNA 3GTPJ 3I96A 3LWLA 2DT5A 1WF0A 3TUIC 2XTJP 3H2UB 3FBFA 3EQLF 5GAGJ 5DGBA 1DGRM 3M8QA 2BJ7A 1EJ7L 3E7LA 3PV8A 4RW4A 4DYRA 1GQEA 4JI8F 1MBGA 2LDYA 1SVMA 4EUVA 2MJNA 1C0UA 3MDFA 4I68A 2ZZTA 4ZDPA 4OFZA 1SJ3P 4CCHA 1SI9A 2IJFA 2Z30B 3KJQB 3P5BP 4BWJA 4LMZA 5FDLA 2COMA 3PUFA 4Y13A 2VJUA 1S7IA 4RUCA 4EYIB 2ZM6J 1HBOB 3PVXA 2D1HA 5HBMB 2G2ZA 2E5IA 2RRNA 2BE2B 2BVMA 2Q6CA 4BS2A 3D6HB 1VQ8I 1RJJA 1HIYA 4XSXF 2F8EX 3M8RA 4G1PA 1EKEA 3J7Z5 3DRXA 1Y7PA 2CKWA 5GAHI 3S1QJ 4UUTA 4JX6A 1ZA2B 2HHHJ 4ZYEA 4S0HB 2KLOA 2HG4A 2X1FA 3O44A 2DNHA 4RAGA 2XMUA 2COLA 2XMVA 1YG2A 2DHHA 4QIEA 1PCAA 2R2UA 1ZG5A 1KVJA 2HRYA 1K78B 3C18A 3W9IA 3TEGA 3GIMA 3JSPA 2MW8A 2HNZA 5G4DA 1KHWA 1X4FA 3M32B 2YNGB 2B0LA 1U6BA 3QRPA 3RRHA 3PJ9A 3ABMH 3L09A 1EH6A 4N47A 1RWXB 2Y0BB 3DKYA 2JUCA 4HEA2 2UVUA 3FSYA 2HNYB 1K78A 2MQ8A 4KITB 3L2QA 4IHTA 1IJFB 2CADA 1GVDA 1NNDA 1REGX 4A8WA 1IN4A 4JI5J 3FM3A 3JAMK 2AEFA 1H72C 2M0GB 3RYRA 2VJIA 4PPZA 4XKBA 2M0CA 4KPYA 3BBBA 1P4WA 3WE2A 2IM0A 3PIOQ 2BKNA 4XKCA 3CCYA 4OYMA 2CUZA 2MZSA 2C2ZB 5HMZA 4M3EA 1F3FA 3KNAA 1T7PA 1YJTA 3GFIA