1P9QC

Structure of a hypothetical protein af0491 from archaeoglobus fulgidus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
233
structure length
230
Chain Sequence
VSLDKAVIARLRKGGEEFEVLVDPYLARDLKEGKEVNFEDLLAAEEVFKDAKKGERASVDELRKIFGTDDVFEIARKIILEGEVQITAEQRREMLEAKRKQIINFISRNTIDPAPHPPSRIERALEEAKVHIDIFKSVEAQVKDIVKALKPILPLKFEEMEIAIKIPPEHTGRAISALYNFGGVTREEWQRDGSWICVMRIPSGMYGDLMDLLGKVAKGEALTKVLRRIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein AF0491
publication title The Shwachman-Bodian-Diamond syndrome protein family is involved in RNA metabolism.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 58
structure length 230
sequence length 233
ec nomenclature
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01172 SBDS Shwachman-Bodian-Diamond syndrome (SBDS) protein
C PF09377 SBDS_C SBDS protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.900 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1p9qC02
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1p9qC03
3.30.1250.10 Alpha Beta 2-Layer Sandwich Hypothetical 12.0 Kda Protein In Nam8-gar1 Intergenic Region; Chain: A; Ribosome maturation protein SBDS, N-terminal domain 1p9qC01
3OQ2A 1T95A 4QR0A 1ZM9A 2WBMA 4ZCIA 3ZZUA 1NYNA 4ES2A 4QR2A 1ZM4A 1VI7A 2I0XA 2E1RA 1N0VC 2IVYA 1DARA 3E3XA 2ZITA 4ES1A 3EXCX 2CVEA 3LH2S 3UI3A 2NPFA 2XEXA 1FNMA 4FN5A 4ZCKA 4MYTA 2BV3A 5G4DA 1U2RA 1ZPWX 4M1KA 4QR1A 4MAKA 2BM0A 3B8HA 2EFGA 2BM1A 4MYUA 3ZZTA 2I8EA 3B78A 1ELOA 3B82A 4ES3A 1P9QC 1N0UA 2J7KA 4ZCLA 2KDOA 1KTVA 3ZZ0A 4TNOA 4ZCMA 1ZM3A 1ZM2A 2L9NA
chains in the Genus database with same CATH superfamily
1S76D 1G6NA 2CZ9A 2LG4A 1HMVA 1RTIA 2AX0A 4DLEA 2KIMA 3F21A 1CQMA 3GU0A 1T11A 4C6AA 1S59A 2EWNA 4KN7X 2JPBA 3CCSI 2K2PA 1K0VA 3GONA 4WU3A 3IFEA 3MKYB 1B4AA 2VG6B 5F8GA 2W57A 3QRQA 4MH8A 4N56A 2C2ZB 1ZRFA 3CJTB 1ETOA 5HQMA 5FLMJ 3S8PA 4O4RA 2Y31A 3WE3A 5ETRA 3KCCA 5E8GA 3GSDA 1EQ0A 1Y5IB 1XGNA 5JJBA 2ASDA 3P96A 2P8TA 3CCJS 1NJIT 2OHDA 2WBRA 2BW3B 2IM2A 1KC8T 4EMDA 3AG2H 4NEYA 1OPZA 4LSNB 2V1XA 3W9IA 3NLCA 3AT1B 1NK4A 4PFOA 1DUXC 3PTWA 4CI0B 2X48A 4HW0A 2MXYA 4OMFG 2XMVA 5I4MA 2V1NA 3T0YA 2QF7A 2H27A 1IRFA 3IP4B 1G2HA 5A6WA 1FSHA 2QCOA 4EGYA 1H0MA 3MWMA 3TUJC 3F22A 2NXUA 3VYTB 4KGVB 1QE1B 3V81B 2KJWA 2MY8A 1OY8A 4IDKB 5ETNA 4OYMA 2QLBB 1WZ2A 4B3OB 2LEBA 2JEJA 3PR5B 4J9MA 5HNHA 1FKPB 3EQLF 2OU2A 4IXAA 3O44A 2F4VJ 2BY3A 1YI2I 1OY9A 3V6DA 1XC9A 2ZJPF 4DJBA 2K9SA 3KMSA 2DCEA 2M8EA 5D15A 2ISYA 3MUTP 3PIOF 5LMUJ 1FFWB 2DRDA 1GT8A 1WC1A 3CDAA 3L7OA 2NPFA 2C2OB 2TDXA 2H4YB 4DIQA 1E3OC 5JR3A 5HAOA 1PVEA 3EGVA 3FZ2A 3EVWA 2V94A 1F9EB 4P2MA 2HHHJ 3OJUA 2MPUA 2EPIA 3A01A 4FVMA 5I42B 2I9SA 3DPLC 4UT4A 2MG4A 4KH0B 1VQ5S 3LNQA 5ILSA 2AYMA 1LV5A 2UZKA 3FCVA 3L4BC 1H88C 2G0IA 4M5HA 4P96A 1XG1A 2M8HA 3ZRGA 1FJ7A 5EWFA 2KZMA 1WSVA 2Q43A 4A8MP 4ZVFA 1UHSA 2QYCA 4PG5A 1S99A 5CYVA 1XR6A 2JSXA 3QBCA 3BR0A 3HSGA 1VF9A 1XNQJ 3BTIA 9ATCB 2Z2ZA 1JLAA 3RTVA 1CPZA 3G1LA 3ZGKA 1ULRA 4ILMA 5C2CA 2BHYA 4OX9F 2N7CA 2Y1JA 4RM2A 1IBCB 1R4NB 2DOAA 5IT9K 1F6TA 1XSXA 1X2MA 3L2WA 3FJ2A 2R92J 1Z0XA 1ORKA 2GC8A 4LK1F 4OIRF 1QY7A 1M1GA 3GX4X 1FDNA 1WJDA 2HAFA 2V34A 3BGLA 4DV0J 2PEHA 2KLOA 3OR2B 2FC9A 3MGJA 2NAZA 1FFGB 2HQCA 5GADU 4RAYA 4F4AA 2AZ3A 3BO3A 1RAOA 4RBUA 4NCGA 3V2UC 4IG3A 3V6JA 1LWEB 3GP9A 1URRA 2W25A 5E3RA 2OUGA 4DL3A 1TWAJ 2PJPA 2NZ4A 3BR6A 4S04A 4BL0B 1U5TC 4IOAF 4UQGA 1R00A 4I67A 4BDPA 3TQNA 1VQOS 1SMTA 4N5SA 2XSJC 5CVVA 2L9SA 8RUCA 4MKYA 1TUVA 4Y00A 3G1OA 5IXUA 3M8PB 2IAJB 3G86A 4IQJA 3H0PA 4LFAF 2CUYA 4BS9A 3VYSB 3QT8A 1ZTTA 2EVZA 1NXIA 4N41A 3J7A1 4N8OA 4D0PA 3K5OA 2XI2A 3TDZC 2MKHA 4ICLB 2ME0A 3CQZJ 3DU5A 4USTA 5K9FA 2OV7A 2JZYA 2IM0A 5KT6A 2VJIA 3HUGA 3EDRB 3RGIA 4NCAA 4EV0A 1N5YB 4OHVA 2NXNA 1V5FA 2EV5A 5E2QA 3OTOF 1VRUA 3GFZA 1EIYB 2XGQA 1HKQA 3VZHA 2E44A 2NXEA 2LNBA 4KTQA 3B4MA 1ERDA 1HQCA 4UNOA 1U1KA 1VQPS 3WODF 4KNYA 3RZDJ 3I5CA 3QU3A 1RHMB 1Q8KA 3QZ8A 3K9TA 2C2RA 4LITA 5KFSA 1ZHFA 4GRIA 1BI2A 2W9BB 4WZMA 2BJEA 1LDDA 4W97A 2XWXA 5C2GA 5F9NA 4KQZA 2IC3A 4TYBA 2D1VA 5CZVA 3S1MJ 1X4HA 3DYAA 4EI2A 5LRRA 1UZDA 1WF1A 4OHYA 2CPYA 2MKYA 2Y3YA 4RW7A 3N28A 3WU1B 5IWAJ 4P71A 5C25B 5K20B 4NMXA 1Z4UA 2YWGA 4PXCA 4J00A 1XN7A 2VKEA 3R5BA 1GK8A 2FA5A 3RZOJ 1S9FA 3J81K 3H5SA 2ZZNA 1R7JA 2DQRA 3V6HA 2HNZA 2AQFA 1LUJB 2ZITA 1VFJA 4ZLPA 3DRXA 5ETOA 3OYBA 5E3QA 1BJAA 3MCNA 4K0KF 4YIIA 3DBRB 3K1PA 1X1PA 2GZOA 3G6XA 1XNRF 5E3AA 4L5JA 1RWXB 2FHOB 3GWZA 5DM7F 1DQ8A 5HDNA 2XAJA 3TZYA 3KKFA 4X4QA 2I1RA 4FF1A 4TLQA 3ITHB 4X64F 3CCRS 2KRBA 1BW5A 4Y4RA 4OZ1A 3THTA 4TY9A 6FD1A 5KFGA 4TV7A 2XVCA 3L2VA 2YPZA 4XONA 1S6PB 2OTJI 1NLKL 4ZCIA 1SCJB 1J9IA 1ZRCA 2O3DA 3DXSX 2GAGC 3NEUA 3DRRB 5KNLA 2MKIA 2CZ4A 3V42A 2G4BA 1JGSA 4E7HA 2UXDF 3LUYA 1MBHA 2MZSA 4RUBA 3CD6I 4GC6A 2E1MC 3B82A 4AD6A 1D8ZA 1GQEA 1LW2B 5KFRA 4PJLA 1WSRA 4IQ4A 3FKIJ 2CW0F 1OMSA 1KTQA 1RT6B 4F4WA 4LF6F 2AT1B 3CDUA 4RLQA 2OPPA 4LGWA 4LBIA 4BKXA 1HARA 3IG1A 4TQRA 2F4MB 2CJ9A 4A4JA 1YWXA 1FDDA 2NQPA 3BWGA 2CU7A 2GJIA 4P7TA 2E1PA 4TQSA 3DKDA 4HDUA 2CFXA 2VQEJ 4MFBB 1VQMS 2COBA 5HJXA 3COAC 4XIDA 5TISC 1RWMB 5KFYA 3HOZJ 4Q44A 2FLPA 4M95A 2M1BA 5JVGQ 2C2NA 5E3CA 4I98B 2ABYA 3BKTA 1CS4A 3CUNA 3C14B 2V68A 3C15B 4KT6A 3MCOA 3B6CA 1FJCA 4Q0BB 5EX3A 5L3GA 1A6QA 1TBXA 4OYIA 3GXOA 3O3LA 4P1WA 2ZOGA 1TL8A 1MLAA 4BEHB 4ENOA 2YNGB 4B3MF 2DNQA 1HI0P 2QSFA 3GR1A 4LB6B 3S01A 4X0GA 6PAXA 2HFUA 1F1ZA 1SKSA 2LVSA 2HS5A 3VV2B 3DPUA 3OS1A 3QGPA 1EJ7L 1SEUA 4S05A 2FGCA 2BJ1A 1QVTA 3M1VA 4JI6J 3RW6A 1PC4A 2B8PA 4K4VA 3GTQJ 2G2ZA 2V2KA 2GXAA 2YS9A 2I8EA 3CTRA 4X4PA 2H1KA 3NMRA 4NYOA 2XS7A 2JUCA 4B3AA 1F5CA 1BC6A 4G6QA 4H4KC 1S7AA 5CKTA 3D6TB 3FKJA 4L9VA 3DRSA 1E2XA 4CLFA 3TO9A 2ALZA 4PG8A 4KHPJ 1YIOA 3TVZA 1DDNA 1TL3B 4U0WA 3FBFA 2MZQA 3ZOBA 3ZN0A 1Q79A 5ILUA 1RYSA 4PWDB 3TQ1A 3J7YU 3I3LA 2ROGA 3ABUA 3G6VA 2DMPA 1NTCA 3H25A 3T8RA 4B43A 1TT5B 1YW9A 4CM2A 3H5YA 1L3UA 3I9V2 3TVKA 4G7ZF 2X9DA 3O8WA 5A8WB 4FYDA 2C2MB 5ETSA 5CJ9A 1HQUA 2BM1A 4PEOA 3JSYA 1MH4A 2NLWA 4BBSJ 1VK3A 3WX4A 1ZM9A 3I0RA 4ZVHA 3QYBA 4YY3J 1Z1DA 4DXLA 1VLOA 2Q79A 2O5RA 4ZDPA 4EJWA 1ZPWX 2G13A 1FDAA 1AKHA 3C6UA 2KU7A 4DCJB 2PJRA 3K7RA 1NRKA 4J9RA 2DTZA 3HMJG 3TA2A 1Z2ZA 5EWGA 3GV8B 1RWVB 3CJNA 3I96A 3QWUA 4Y2KA 1SQEA 1VOMA 3TYTA 4PXDA 2F4VF 3F0CA 1WJAA 5M5WJ 3AH6A 3D4JA 2SXLA 4CLWA 2KT3A 4PKDB 1SV5A 2LKZA 3MR2A 3CCEI 3OXFA 1W26A 1XQIA 3Q8YA 1JKPC 3TQEA 3MAAB 3W2AA 4G1QA 5E3LA 1F9FA 4QTRA 3THPA 2YWKA 4RUHA 5DUKA 2W9CB 4A8SA 2LRDA 3KLGB 4QIGA 3WC0A 2XAUA 2V9VA 3MEKA 3DBHB 1IO2A 1X4CA 1BI1A 4J9SA 2DRBA 2XGDA 2KZGA 2F4OB 1FK9A 4ZS6A 2G0CA 3TANA 2WW4A 3NWGA 3HD2A 1N25A 4LQ3A 1F43A 3R1HA 5D8HB 2FVRA 3QJLA 3NGKA 5FFXA 3KG0A 4OYOA 3B6BA 3LMMA 3TOQA 3KHGA 1AU7A 2BXZA 5BOXA 4QLCU 1XMOJ 1NK3P 4K59A 3P8BB 4AIKA 4A8YA 3VEPA 4EJUA 5AJ3J 4PWUA 4DV3F 4V19X 1R1VA 2OTLI 1HWIA 3KLIA 2HLUA 4DR1J 2DB1A 4A3DJ 3GMGA 1XNQF 3QRPA 4F92B 4DPYA 2L48A 3T8TA 5B5EC 2XROA 4JV0A 5DQHA 4AL5A 2BABA 1N52B 4LIRA 2HVEA 1JXLA 3H20A 2AW0A 2OSRA 4UZBA 3RBEA 2DXEA 3O3KA 3LSPA 2Z9OA 4IJAA 1KKHA 2DPUA 4A5NA 3V4IB 1VBYA 5A2QZ 1NB2A 2B9YA 4IYQA 2MW8A 4NXMJ 3E97A 3AD7C 3DCFA 4DR5J 1DJ0A 1HF0A 4KA4A 4CO0A 3F8NA 2D3ZA 5FRMA 1SI9A 3IV5A 3FX3A 3ISPA 4NHJA 3E6BA 3JSMB 2VKVA 3MEGA 2B5JB 1T3NA 2DMQA 2L01A 3DKWA 4FF2A 5F8JA 1BOBA 4GXOA 3TA0A 3RPQA 3TZZA 4JK1X 2LY1A 2FB0A 3TI0A 3KWMA 4EM0B 1TUGB 3VF0B 1YOVB 3WU0A 2ELJA 2BW2A 1ULYA 4JBCA 3CDLA 5HBMB 4KT5C 2FLLA 1S4FA 3PEHA 5FROA 1PYTA 3EPZA 1WI8A 4BWJA 3RDIA 5B1BH 1R49A 2DT5A 2DJWA 4B9MA 1QM9A 2XKOA 4RGSA 4DSKA 2I5JB 3H98A 1IBMJ 1M5PC 3IRRA 1QAXA 2NVXJ 3DU6A 1R0CB 2MGQA 4NYPA 4FYWB 3VVTA 1WEXA 4GRSA 5CA5A 3BQZA 3O6BB 1T56A 2XB0X 2RHSB 1X4PA 1Y8QB 1A6LA 1LWFB 4IUFA 3M1CA 2HOTA 4NA1A 1ITPA 1TQIA 4HACA 4XN3A 1FD8A 4O3MA 1K47A 1SJ4P 2DNNA 4PZJA 1Q4RA 1KQ9A 1ZG3A 2W4PA 2VG5B 1NB7A 3OVBA 1S6QB 2JEIA 1YJWI 2YNFA 2EZLA 2FX0A 2QL5B 5AT1B 2CQDA 2K3KA 3IMQJ 2DQLA 2EA4A 2UUCJ 2E5ZA 4WXHA 4IH6A 2EIKH 1X5OA 5SZTA 3M2UB 4EEFG 1Y3KA 3DCAA 4B3RJ 2BYCA 2QLWA 4Y3CA 2UUAJ 3KUGA 2M8GX 2PDAA 3NS5A 3HHHA 3H2UB 3G6YA 2VJ5A 2J7UA 2NVQJ 3A12A 1CC8A 2CPFA 1YRNB 4D1QA 4IRIA 1MIJA 2Y0MA 1IUFA 3GQCA 5GPAA 4AIHA 2QSFX 5T7LB 3I54A 3TAMA 1B0VA 5CCLA 2F2EA 5IWAF 2FZCB 2RQKA 4NLRA 1HKTA 2E2JJ 1SJFA 2VFSA 1TR0A 2A3SA 2LCWA 3N79A 1NJZA 1U8BA 1DP3A 4GVBB 1HMVB 1RTIB 2F5VA 5JLXA 1XSDA 3GJRB 1MJ9A 2XMKA 1RHQB 5FGMA 3T1YJ 1Q16B 3SDEA 4R8UB 7AT1B 1K6YA 3D6HB 3JAMY 3MOZA 4K2EA 2XS2A 2ASJA 4LFUA 3MWBA 1FKOA 2ZKTA 1YRXA 3TO6A 3JREA 2KFNA 1SJQA 5IV3A 1D8YA 1LK5A 4CDIA 4WFXA 3H90A 4BBYA 3BSAA 1JXVA 4ESBA 2HOEA 2UXCF 2V4QA 1BL0A 4Z37A 2UP1A 2QT7A 4FS1A 1HC8A 2ATLA 5ETPA 4EYHB 3GZ7A 4WIQA 3VGSA 2ZCWA 2QFIA 1TV6A 1HHTP 4NLYA 2VJVA 1U8SA 3CCMS 3QRRA 2XTJP 5FIIA 2CQ1A 4LRCA 2K85A 1VQ6I 2CKWA 5KFLA 1KU3A 2ROPA 3U21A 1XB4A 1XGSA 1HBUA 1NUEA 2V67A 4ZVSB 1OCRH 4A3MJ 3D6MB 1KFSA 4ZA1A 2LH9A 1HR0F 2NVYJ 1KFDA 4WU2A 2DXDA 3FVYA 2MH9A 3WHCA 1KN6A 3R8YA 1ZGJA 1WVRA 4XKVA 2HQ3A 1W7PB 3CCLI 4KJZA 2E5HA 4XDCA 3PY8A 1XD7A 1VQYA 2IRXA 4M9ZA 3S17J 3CNQP 1ZYQA 4YEAA 1FI4A 3VYRB 2ZOFA 3E3XA 1IM6A 3R5DA 3TJAA 3WTYC 4QIWD 3KP7A 2UUBJ 1S7HA 4XKWA 2R4GA 3R5CA 2D2WA 4HQMA 1F9NA 3BCBA 3K5NA 4F4YA 4C3KA 3GFLA 5LHHA 3DM2A 3C2PA 4NDLA 5DYMA 2I10A 4R25A 3F8FA 4F04B 1A36A 4QYZK 4BC9A 3IL2A 3QP6A 4KGKA 3RAXA 2JZ5A 3DKYA 3A01B 3FK7A 5KG0A 2A2CA 1FXLA 5F0HA 2FLOA 1A31A 2DR5A 2KN4A 4M5JA 1WACA 5JVTA 4F52A 2V5HG 1G2EA 1MDMB 4F4XA 5KG4A 5E17F 1TK5A 3IBFB 3PFYA 2BZTA 2OFGX 3F72A 3KEYA 3VB2A 2M5YA 2DI3A 5CAAA 1C0TA 4MTEA 1D0YA 3T3FA 4A93J 1L3TA 4ENMA 3CUQC 2HGCA 2RREA 1T7PA 2B43A 5DZ6A 1JLAB 3UCGA 3HSJA 3CCQI 5M3FJ 1U45A 5HODA 2ZSHB 5H9FJ 4OJ3A 2HURA 5J47A 3ET6B 3JAMZ 4ZZDA 3L2CA 1IJFB 1H38A 1IBLF 2RQQA 5KFJA 5DCMA 3LSTA 2W9AA 1HNVA 2D3OR 3SMZA 3Q2TC 2NS7A 4HDHA 4II3A 2R93J 4NCGB 2OPTA 1XDUA 4IG3B 3OL8A 1WRJA 2UUTA 5IZHA 4F0MA 4W90B 1NSKL 4PJNA 5CZXA 5F0UA 2J6TA 4V2FA 1O0PA 5GAHJ 1LB2A 1UA0A 4ZYHA 3AL0B 5KT2A 4ZPCA 1WI3A 4K5SA 4UOCA 1LW0A 2M4MA 1CBKA 4D5CA 4HSRA 4IRGA 4NRTA 4YY3F 3CJKB 2ZMEC 3OOPA 3ZQIA 3T5KA 2VUMJ 4LF9F 4HOBA 2ZM6J 3NEKA 1FKAF 1SJ1A 4HVZA 2MSSA 3AFHA 2RNGA 3Q8UA 2FLNA 4FNIA 4ZHRB 4KB7A 2YNHB 4M6VA 2UU9F 3BDEA 3HSDA 3KP2A 3VZIA 4ZJOA 4UVAA 4EJOA 3ZO7A 1CQNA 3PCOB 3K70C 1N6QA 1KQFB 2BJDA 2D41A 4ZN3A 1HNIA 2NXNB 1UWBA 1HLVA 1VRUB 3QIPB 2C1EB 5CYQA 2HYIB 5K14A 4K4TA 3OTDA 2AMCB 4DBQA 2GGPA 2HS4A 3CJ5A 4NQWA 1X5PA 5JVGF 4GMKA 2DA5A 2RQMA 2MQMA 4LG0B 2XLIA 3BEGB 4EATA 2UUWA 3JRHA 4P75A 4ZDLA 4OWRB 2FBHA 2IYIA 1J2XA 2WAFA 1KLNA 3OYEA 2FVPA 1WD6A 4H4MA 2IC3B 1RT7B 4NLSA 5KFUA 4XLPF 3RYPA 1H73A 2IT0A 4O3RA 1ZR4A 1JX4A 4RW7B 3O5TB 2FJXA 4E7IA 2ASLA 1YE9A 1UFMA 5LRSA 2GM4A 3K4LA 4GKKJ 1UVKA 1DFDA 4I0BA 3E8OA 3I9V9 1TAUA 3H3ZA 2V1UA 3I32A 5D0EA 4OYWA 2R7SA 1RTHA 2IPOB 4A3GJ 3OSNA 1TQLA 2CZVC 3W8PA 2UXBF 2HNZB 5AJ3F 2ZH2A 1Z7LA 1A0OB 1Q8LA 2H54B 5CVRA 4CYUA 3CSKA 2XC9A 5LOQA 2WONA 1XX5A 2JFKA 1SVMA 1H2VZ 1HDPA 1HBMA 3OS2A 2XASA 1P92A 3QQAA 3RBXA 3O6QA 4KRWA 3N4WA 4XLAA 4GYIA 2H5JB 1IKVA 3NWSA 4E6KG 3D3CJ 1RKJA 3BJYA 1I6XA 3DQVC 4XKBA 4NXMF 2E36A 3MCSA 2DRAA 4DR5F 1UVMA 5BQTA 3L9FA 3D67A 4Q48A 3KX2A 2MLXA 4PAAA 4OHXA 3P9IA 4B47A 1RSCA 4OJGA 3TUZC 4CLLA 1R6VA 1WDTA 1KU7A 2FZGB 3HOXJ 2W7OA 1D1AA 1JLGA 5ETLA 2DK2A 4TU7A 1O7LA 1YJ9S 4XLCA 4MIWA 5E7OB 4I6AA 2V9WA 1HSJA 4YEJA 1U5TB 1UJ8A 4QBUA 1VISA 1PJ5A 2DHHA 2KXHA 2XB5A 1USSA 2XSJB 5IT0A 2FHJA 2M7AA 2BBEA 3HRMA 2V79A 2KHDA 1S49A 2YKAA 2LMIA 1YJVA 3BZQA 2EJRA 1H98A 1TELA 1VQMI 2WVEA 2JRSA 1L0OC 3KK3A 1N8RT 5EF6A 4J9VA 5DO2A 2VIXA 3AXMA 2FYXA 3QAUA 4RW9B 1ZQ3P 4QWQA 4LFCJ 3G1MA 2ZH4A 3QOPA 7FDRA 5HMWA 2DN0A 5L1LA 3CCZA 4QPOA 3VAGA 1GLNA 2CPIA 4LBHA 4PSXA 2Y8YA 3AG3H 4WXWA 1RWKB 5IP7J 1BUXA 4L3NA 3AJ1A 1HKAA 4YMEA 3RJMB 2E1CA 3POTA 2BOPA 5FLVA 3FK6A 1J75A 4DV7F 3H4DA 1IC8A 2B63J 3ELKA 3KLHA 3H3UA 2UUCF 2LBFB 1RUOA 1YG0A 2NREA 3NWTA 4A3CJ 1GV5A 4B3RF 5J8FA 2RMLA 4C3MA 1WELA 4J9PA 3PVXA 3PW7A 4YN3B 3NP5A 3ASNH 4EZ6A 4LF5J 2HKOA 3C19A 1QZZA 3M1VB 2W85A 1YITS 2BANA 2W00A 5JHFA 1QUPA 4DCOB 1ZAWA 2OJED 1CJKA 2GBYA 2X6XA 1FZPB 1D1CA 3ECHA 4IQXA 3BDPA 3ABLH 2Q3PA 1Z2LA 2FQ3A 3B73A 2QMUB 2RDIA 5HATA 2FVQA 1QTNB 3PO3J 4BQAA 2VFTA 1XMQJ 3MPUB 1ZKGA 3PYEA 3DRSB 2PEBA 3KJNB 4RU9A 4F2RA 4DV1J 3M8EA 3T6JA 1EHWA 3KXDA 4ZPAA 3GLJA 5IQQA 4UOGA 2LREA 1XTAA 5A8KA 1ZGAA 4C8KA 3BYPA 4DU8A 1I6JA 3IWLA 4YR2A 4HAMA 3K5PA 4WFAQ 3TOAA 2JEGA 2PEXA 4JI1J 5A2QK 3CDEA 3R97A 3HTSB 2PI5A 2GXBA 2RJZA 2WV1A 2R3SA 2HWVA 1HQUB 1TMMA 3R6LB 4X65F 4WJBA 2K7KA 4YDXA 2KVQE 3K4KA 1E0EA 3CCVI 3I0RB 3GZ6A 1RQ0A 4ECTA 1X5SA 3PSIA 1RXOB 1RAHB 2GA7A 3OR1A 1UB9A 1UVLA 3A8JA 2DA3A 3R3TA 3UD5A 4LR9A 2JA6J 3VVUA 1AKHB 3C6UB 1YX3A 2JWNA 1PKUA 2PJRB 1KU2A 4I56A 2Z57B 5GMKa 4BY1J 4HX8A 1VR6A 4ZDOA 1VC5A 1RWNB 5LSOA 1RTZA 4ZCKA 4B9VA 1U26A 4KISA 2VPYB 2A18A 4F55A 1MSWD 3BQYA 5DDPC 2DCUB 1TVRA 2F4FA 1H2TZ 3KMQA 3LF0A 3NNHA 3K89A 2M3AA 4J5OA 2BY0A 3FGVA 5ADZA 1IF1A 1K44A 3NGUA 2W7AA 3JQKA 1UPMB 3HHLA 1WGXA 3AA9A 2V4RA 4CT9A 2KMUA 2UUBF 2W2QP 3T1BA 3OV8A 3BKUA 4ID8A 2P4WA 2OD4A 1TU0B 2W4SA 3GTMJ 1RBAA 1J2VA 2QLJB 4KICA 4UUSB 1KGSA 1S7IA 2EG2A 1TKDA 4I68A 1FK9B 4IZZA 1LQ1A 4DW6A 4I6YA 3VAFA 1QGPA 3B54A 3JTGA 4L0ZB 3BM7A 3NAIA 3QLHB 2PMHA 4HT5A 2UVUA 2QL7B 3FBIB 2FHKA 2VQFJ 3MDFA 4RS8A 3JTOA 2ID3A 3CCUS 1IDYA 5HLGA 1JXSA 3WU2C 5L8RC 4K2XA 4ES3A 3L2RA 3PO5A 1X4EA 1T6SA 1VQSA 1EF4A 1XIQA 1H0HB 3KG1A 1YJNS 2PA8D 2JA8J 2EFOA 2Y0SN 2HDWA 2KHMA 3UI3A 4KGZB 3I9ZA 1CF7A 2L3MA 1UG2A 2G9WA 3EJMA 4PK4A 4KIAA 2ZH9A 4YIRX 1JLCB 4K5RA 5EDWA 1RISA 3P3DA 4PUOA 4J37A 4G1IA 1DU6A 1S8NA 3NCQA 1HLWA 2VE8A 4AFFA 3UE2A 1S72S 2XZWA 4WPAA 1Y11A 1FTZA 2L7ZA 4A8WA 1I3QJ 3SFIA 2PMZN 3WG9A 3N9UC 4USJC 2G2YA 3UW1A 2QA2A 1W2IA 2XSDC 3ENAA 5LFAA 4K50A 4KT0C 4WP8A 2BVLA 2G1DA 1P1LA 2WVFA 5L3DA 1DP7P 1BQMA 5TGTA 4KR0B 6AT1B 1Z21A 2IJRA 4X4OA 4UVBA 2NR0A 1IKYA 3CD5A 2MGZA 2X1CA 5KFIA 3JQMA 2VT3A 1R6YA 3SSSA 1SFOJ 2QL9B 1XDSA 4JV1A 3KNAA 2M34A 3GTPJ 3M8JA 2ELKA 3NBPA 4XIUA 1OO0B 2WSCC 3ZZRA 3TX8A 3H5RA 1CQTA 3JTNA 2DHSA 1QAIA 3VQSA 2CAJA 3U27A 1NG6A 4ANEA 1TZ0A 3R4KA 4FNHA 2PI0A 2VFRA 1RCXB 1HXDA 1HQ2A 4BDYA 3QAEA 2F9JA 3G71S 2QUFA 4YG2F 3WTVC 3GBGA 2UXNA 1V3ZA 1SMYF 3SIPB 2L2OA 3NAUA 4WFZA 3HOTA 2P9EA 2HVSA 5C42A 2EFQA 2HVRA 2VBXA 3EPIA 2E5IA 2LEAA 1HBOA 4DR3F 4QQBA 4ZJZA 3LSJA 2J0WA 4EQQA 2BVMA 1WF0A 5K5RA 5H9EJ 4JI4J 2WC2A 2K40A 2P5LC 4KHMA 1C1CA 3H5XA 4EGZA 3CT9A 1RB0A 2R5ZA 2HXIA 3Q9SA 2DH7A 1MU2A 3L3CA 4IQMA 2KG1A 3PYDA 2XMWA 3TAMB 3T5XA 2YUSA 4N4OB 3CC2S 1NJYA 2DGOA 4XOPA 4GKKF 1WOPA 3S8SA 2I2YA 4OJ1A 3TJ8A 1I39A 1XS9A 1JKHA 1KRPA 1FA0A 1VC0A 4DUYJ 3OLAA 1KEKA 4AT1B 4ERDA 3PKYA 1EP4B 1X1CA 2KIFA 3MMCA 1FOYA 3ZQQA 3SZGA 1FKOB 5M2PA 1PJRA 4LSLA 1N75A 3M9AA 3RYRA 5KTQA 2ZZTA 2QLZA 4GO1A 4QPXA 2E1OA 2XEXA 4ELTA 1HNXJ 4M9SA 3CC7S 3JAMK 3Q8RB 2JK3A 2M7BA 5DZ7A 3KLFA 3CC4S 4WK1A 1BR1A 1WH5A 3OQ2A 1NH3A 4ZP6A 1REVA 4CLPA 5CVIA 4Q5VA 2HU9A 2BE9B 3HJFA 5HS7A 3MD3A 5F8HA 3CCMI 3SYTA 1TV6B 1W4MA 2CYYA 1FESA 2CQXA 2O8KA 1ONVA 1QJHA 4HSTA 2FOKA 2J0XA 3IC1A 3H2VE 2RAEA 2GOXB 4HLXA 4DR6J 1P1TA 5IS2A 1WCMJ 3HJVA 3MPVA 4N76A 1LFWA 3P7NA 2O66A 2HEOA 1SD5A 2R4FA 3WTUC 3OTEA 1BE4A 4OQJA 2E66A 2N4DA 1UCNA 1JLQB 2CUZA 3FQLA 4N7TA 4LRAA 5EN1A 1SJRA 4UY8I 4KAIA 3VODA 4R5PA 4WK8F 3I6PA 3ILLA 1ACMB 1XMXA 3C7JA 4JOMA 2FGOA 4YB7A 2DA1A 5KT4A 5D4LA 2OZ6A 4L9JA 5DG7A 1RWUA 3JYTA 4B3XA 4R79A 5KFCA 4KO0A 4KSEB 1VQ9S 2V9PA 4NLOA 3KLOA 2MSTA 1R0AA 1P8GA 3TP3A 2QN6B 2ZWOA 2C28A 3C16A 4RX6A 2VOPA 4XMYA 2CPXA 2AP6A 2Q6BA 4XR6A 3R9LA 1LWCA 4CYCA 3MKZA 4CLZA 2RB7A 3DPTA 3DM2B 1ZBTA 4Q2LA 3J80Y 4ES1A 2U1AA 4KV8A 2A5WA 3A4TA 2AYEA 5L46A 4OI3A 4RL1A 1WF2A 2XNQA 3H7HB 2CIMA 3H5UA 3M8SA 3RRHA 3RUBL 4NCBA 4JB8B 5AONA 5FD6A 4B02A 4CCJA 5BPIA 2IM3A 4RPFA 4AUXA 1FVQA 4LF5F 1U25A 4HF1A 1YS6A 4OZ3A 2HBYB 2Z0GA 3THVA 3NNCA 3W5XA 4TNOA 5DLFA 3DGVA 2OIHA 5KOWA 3BJOA 3LFUA 2N4CA 3LP1A 1W7PD 1Q8BA 1FT8A 4QIVA 4A0ZA 1DQAA 3MI7X 4DR2F 1RJJA 1TK0A 2CH0A 2KO1A 5FDLA 2QEXS 3M7VA 1XMQF 3VALA 2V63A 5DDRC 3U9GA 1R43A 2CQHA 2UV8G 3GO5A 2MQOA 2OCEA 5CLSA 4R8HA 2GNKA 5DCMB 2GIVA 4C2MA 3Q0WA 1IKXA 1T0TV 1HNVB 4YELA 1WH7A 2LA6A 3T5JA 1QZYA 1D3WA 1BIBA 4FS2A 2K3IA 1VDHA 2XDVA 1SFXA 4LIWA 1HWKA 3HJEA 2UWMA 3DP7A 5E0OA 1RT1B 3M8ZA 5LGNA 1ZS6A 4LB5A 4QPTA 4EMSA 2EV0A 4JI1F 2COMA 4FTHA 3PYFA 1BQXA 5BR8F 1ZZFA 1JKOC 2K86A 3D7SB 3Q0VA 5AXNA 3BPDA 4BXFA 4PZVA 2KI2A 4B44A 5HP1B 1XMBA 4LSNA 1LW0B 3Q8SB 2VICA 4EM2A 3OSGA 4KFBA 2N82B 2MYSA 3FBNB 2NVUB 1K1QA 1EAYC 4WYLA 4MHGA 4X62F 5J2MB 1BIAA 2ME6A 1KHVA 1VIOA 2XY6A 3G9CA 2CQCA 2EBEA 1CLFA 2Q0OA 3HSZA 3QODA 5IP9J 3MR7A 4F26A 4FE7A 5HK4A 4DF8A 1RT4B 3T9ZA 3M9OB 4RB2C 3EGNA 1GTHA 2HG4A 2PX9A 2G7UA 3SEOA 2KTQA 3AB2B 3PFIA 1KS2A 2YSRA 3MPDA 4I64A 3H9GA 2HFNA 2HNDA 1S12A 1USTA 4IDKA 2MKJA 2H5IB 1UAWA 4B3OA 4ANJA 1RUNA 3OTCA 3TZXA 2XZDB 4U7UD 5CYQB 4U7BA 4WTYA 1FKPA 3C46A 5FJ4A 3O2IA 2RRNA 4NLUA 3TEGA 2DMNA 1FDBA 3VAKA 3BR5A 2MZ1A 2F5DA 1F3FA 1X4DA 4DZPA 3H9QA 3MZYA 2B0LA 2JRMA 2W2MP 3PO2J 2R3VA 2H51B 2ZH7A 4ZPDA 1TKTA 4B9LA 3N01A 3OY9A 3LSGA 4ZC3A 4OMYA 5A8RA 3OS0A 4D7MA 2RU9A 2BVZA 2HQ5A 1OISA 4LMZA 2OLWA 2L3DA 2R7TA 3Q9VA 4H4MB 2WVDA 3IRQA 4P2FA 3M6VA 4L9TA 4L72B 4AUKA 1QVUA 2J7KA 1MZBA 5EZHA 2EZKA 1RT3B 4C8LA 5I42A 4OYBA 1AXQA 2GIRA 1OKRA 2DFFA 2B9XA 4OHWA 3G4SS 3HF5A 3CVKA 3W9JA 3HGYA 4M3BA 2B4UA 3MTKA 4DV4J 2A6MA 1KU9A 4GKJJ 1YTYA 3H9JA 1SBRA 3VHQA 2RKIA 3D68A 1OQ6A 1WC4A 3K17A 3DFEA 4Q5SF 4CYUB 1FNXH 1SPBP 3BBCA 3TARA 3NWRA 4MNUA 3HHEA 2WONB 4I4BA 3UD4P 3DDIA 2DJIA 1NCLA 3CUQB 3HT0A 2DMUA 1R27B 2DOFA 3E51A 2D5VA 1D1BA 2ZUGA 2BZ2A 1IN6A 1TFWA 5IFMA 2VKHA 3K4NA 2DDAA 5K1YA 3PW2A 4M3EA 1MNEA 5JI6A 5D5UB 4NUBA 2E5LF 2IS6A 1F1BB 4ZIWA 2PMUA 2PI4A 4ED8A 1CVJA 2DGVA 4C0BA 4ZP8A 3GFHA 2STWA 3K4JA 1LDJA 2RGVA 2LKSA 3QWPA 4IRDA 2D9PA 2Z8QA 1R1TA 1FNOA 3HLUA 1ETYA 2JFDA 3OOUA 5FB2A 4X4UA 3GFIA 2YH0A 2XF7A 4LF8J 1LWEA 2V7FA 2BE7D 1X9WA 1JLGB 3SEZA 2KKHA 2H48B 3DGPB 4Y7NJ 1S0NA 3BZ6A 4OI4A 2WTFA 3DLLF 1Q8IA 2WTEA 5BYRA 3KHHA 1Y6IA 5HS8A 3M8PA 1X0PA 2KXFA 1P7IA 2R7DA 4FBTA 4PG6A 3ZTSA 3MPWA 1SJ3P 1SH3A 4DG1B 5H6QA 4MK7A 3MAQA 3AKZA 2NSBA 3GG1A 1X1DA 3Q23A 2RSQA 8ATCB 5HLFB 2NVTJ 2OPQB 2WZ1A 1X4GA 1ITYA 1BR2A 2V4JC 4WWCA 2XYGB 4P72A 3GIJA 1N5YA 2R9LA 2B6AB 2IPQX 4A8OA 4DYQA 4DN0A 4GO7X 2WADA 3QWLA 3BSNA 4QCLA 3L95X 3POTB 4KDPA 2BKOA 5FD1A 2FJVA 4XSZF 2MC4A 1HNWJ 3QT5A 3GFMA 4OX7A 1FOKA 1BN5A 3HIFA 1YZ7A 2RS2A 1HHQA 3CO0P 2VF3A 5DJBA 4G6TB 2VHGA 2V8VA 4ED7A 4ED1A 4JYAJ 5CABA 2JA5J 1WJ5A 1AZSB 2G7HA 2BANB 1PILA 1CULA 4OX6A 1CJKB 3FIWA 3VAIA 3OFGA 2KQRA 4A3LJ 3HOYJ 2XAGA 1YIJI 2XPWA 2W2PP 3FUYA 1J0RA 3JRFA 2XO7A 4CO4A 2XAHA 4KBIA 1MMGA 4DUYF 1C1BA 2XI3A 4BS2A 3LP2B 3SSQA 4DX7A 1OR7A 5A8KB 4HX7A 4NLWA 4RBVA 4CO8A 1Q95G 5F1RA 4C2TA 2QZ8A 2ACMA 2DR9A 1U49A 3HPOA 2A6TA 4X6AJ 3FBCA 2DMTA 2M9HA 1KQ0A 4AVZA 4YB5A 3FFIB 5GAEI 1LPQA 2RHQB 3EMTA 2GO9A 4OYXA 1LKZA 5H1SV 1F2HA 1S6PA 4IRCA 2MY7A 5GAGU 3LOCA 2B3TB 5KT7A 3LWLA 3EDQB 3Q8PB 1SQFA 1POGA 1XCBA 2Z2LA 3MVPA 3BPVA 2YKOA 3US5A 3OYMA 4PQAA 3BG7A 2KIUA 4KY3A 5E3NA 1RBLA 3A4CA 2VKZG 1LW2A 2PFFB 3AJDA 5FKLA 3OD2A 2QWWA 4M73A 3LPEA 1PYSB 4P5OA 5HVQC 1RKWA 1U1OA 3CMMA 2Z16A 4HNTA 1GXPA 1VQKI 2BJ8A 2I0XA 3FDSA 5CD4H 3FZBA 5KFHA 1J09A 4RW4A 1JJ4A 5LL6d 4K4UA 1JXEA 5F0FA 3FXMA 4J9OA 4MFBA 4M6XA 4NZ0A 2ZVSA 2MLGA 3HHLB 1DTTA 2N7YA 3R7BB 3KZZA 2F5CA 2XF6A 5DG9A 4IOBA 2MD0A 3C14A 3C15A 5AE2A 4DL5A 4RB1A 4XRSA 4AQYJ 3FHZA 2F8HA 3P49B 1TWHJ 3GZ5A 1YSJA 4Q0BA 2Z4PA 2J5OA 3QPIA 4ZYGA 3HVRA 3UQSA 4CO5A 1YW7A 3IS9A 1UFKA 2KHCA 1LEOA 4BEHA 1HA8A 1HW1A 1VQ4I 5BYQA 1UVIA 1IR2A 3Q86A 2W24A 2C42A 3V6KA 3BN7A 5H20A 4O4GB 5H2FC 1SH0A 1YLXA 3B78A 2P8IA 5E3PA 5BMZA 4XKCA 2OH2A 1VS3A 3BO2A 1FBQA 1DU0A 1NK0A 2IW5A 1FWZA 4LF2A 3NRVA 2E35A 1YJNI 5KFKA 1FXDA 1E3PA 1ZGWA 2XYHB 1SD7A 4OX9J 3FSYA 1KBRA 4BY7J 1FTCA 1HPZA 3IA0A 3KOAA 4IF4A 4A6DA 1CF7B 3X2QH 2EFPA 3DLAA 1GX6A 3WX8A 3RYLA 3I59B 3FMSA 1JJ6C 2KG0A 4JX5A 5A0YA 4LQ9A 3PRVA 3CJ8A 2K7JA 1TL3A 3HDDA 2MJNA 2LKXA 5D6FA 2RQ4A 2PG4A 4PWDA 1LE8B 4AYBD 1PYVA 4IFVB 2EFWA 2OSQA 2LECA 2OA4A 1U1PA 4MKVA 5JXSA 3V8LA 1T0FC 3RR7A 3BSOA 4ELUA 1GNKA 2HYJA 3M1EA 4O0IA 4HV5A 3HOUJ 3TO8A 1MMLA 2EXUA 4OZJA 2LQ9A 4IR9A 3HOVJ 2XULA 2ACYA 5GAEJ 3UPFA 1XEZA 2GVZB 1BQMB 4FKXA 1QTMA 2NNNA 3I4PA 3OYNA 1MD0A 4URSA 4C30A 2K9LA 1PDNC 2M8DB 1KTVA 2NUHA 4XBFA 5IP6A 1JUPA 3DKXA 3NBPB 1TLHB 5E8IA 1EARA 5I3UB 3GUDA 3HTUA 1DTQA 1XCVA 3F23A 2DOEA 1S9GB 5DM6F 1R9TJ 2RD5C 4JOUA 2CG8A 3KYLA 1YHQS 3G71I 3ULHA 2MKKA 3MR5A 3GIRA 3TUIC 3OTOJ 2F3JA 4DPWA 4Y52J 4DUTA 4JI8F 1C4CA 2EIMH 1N5SA 2GX8A 2DGUA 2CQ4A 2CQGA 1Y56A 1UP1A 4Y2IA 2XGPA 2AEJA 3REOA 3W1YC 1QUVA 4CTAB 3CMEI 2ZH8A 3LSKA 3HKZN 4MQ9F 5C42B 3FSIA 1J5OB 4UTGA 2OI2A 3MAAA 4M94A 3H3VK 4IVNA 1PAEX 5IOLA 1W5SA 1PSDA 3ABKH 4IHTA 2LF7A 1XBWA 2XS5A 2HK2A 4B1RA 1C1CB 3WBZA 4NC6A 4OYAA 3RBZA 5DQGA 5J1NA 5IPAA 1LQ9A 1RDRA 3J80U 1MU2B 2AXLA 3MXHP 1RLDA 5DTDA 1N78A 2YU3A 5L3CA 2HOSA 1PCAA 3U1KA 2K4JA 3R1LA 3P6YC 4U8YA 4DV4F 3CIZA 1IBKF 1BBYA 1FE0A 1VQ7S 4QWCA 2D69A 1JKHB 1KD1T 3W3CA 4ED0A 5DDGA 3H5NA 3P9KA 3CP8A 2CV0A 1PJ6A 4PYDA 3MMCB 4KIFA 3IAS2 3I31A 4LLLA 4LSLB 2BGCA 2PO4A 5D5VB 4O3NA 1FTTA 2HYGD 4HHJA 2L9VA 4DR7F 1XNRJ 3N6MA 1TT0A 4ZTFA 1M5VC 2W82A 4IO9F 3CC4I 2O7OA 3KLFB 1M1KT 4L18B 1FTRA 2JTVA 2UUZA 1IUYA 4B17A 1REVB 1Y39A 4W4MA 5L39A 4X64J 2CO5A 1R5GA 2GVDB 1TK8A 4Q4ZF 3GJQB 2YWEA 1DRZA 4HLBA 2DHGA 3U1LA 1PP7U 3GG0A 2HEKA 1Y1VJ 3KK1A 1C4AA 2EV6A 2AWZA 2X6YA 5K8PA 2FBIA 4G7HF 4NLGA 4RAFA 4LF8F 1FX7A 2HZAA 3MD2A 1UPPA 3TKYA 2B5JA 3BH6B 2MYFA 4HDVA 1BJZA 1R22A 1SUQA 2CW8A 3MKWB 2DPIA 1S48A 2LK2A 5CH7B 3WGGA 3MMBB 4ZLNA 1X3ZB 3QT6A 2UVVA 3PW0A 1O3RA 2XIGA 1D3YA 4IHWA 4DPUA 2ZKZA 4OOIA 1K78B 4I1TA 5HBMA 4LF6J 3ILIA 3NS7B 4FASD 4BUPA 1Z6TA 2VPWB 2CFOA 2E1AA 4QR2A 1ETVA 3CB4A 2EZIA 2DAOA 3FXKA 1U09A 3W5YA 4R5PB 1Q86T 3F44A 3I0TA 5KFOA 1IR0A 4NEZA 1VJQA 3DLBA 1OCTC 1E6YB 1FRIA 2IA6A 3Q2SC 3JYTB 1KONA 4CIOA 3G3ZA 4IG0B 2DD8S 4KO0B 1J5YA 1RU1A 1ZTRA 2GOMA 4QU6A 3FRZA 3C16B 1FWPA 3MR3A 1K8AT 1I3AA 4H54A 3BPXA 3AQOA 4CCKA 3KFWX 5B0EA 4CYCB 2VG5A 2YU9J 3BT9A 2L7KA 4G3IA 4CZCA 1AWCA 1VGYA 4BJ5C 3UD3P 1GMWD 4DV5F 2EG1A 5LXYA 2B9EA 1UEKA 1HL6A 1UJ5A 2Z2SB 4UUWA 4B3MJ 1HNWF 4I02A 4R0EA 2AYBA 5RUBA 1QD1A 4FPIA 2ZKUA 2BKNA 1NSPA 1HBXG 1UZCA 2J6UA 1ZLKA 3E6CC 1UW9A 1VQLI 2NS0A 5E33A 3DTIA 1SIWB 2CNLB 4OI2A 4JYAF 4EVIA 3QJJA 1GXLA 1X9MA 1GH8A 3QATA 3H8YA 4I2OA 3KJQB 2LD5A 5E5NA 4ZJQA 3JCUC 1O7FA 3MN2A 3LP1B 4ED5A 2JVRA 5F08A 3TO7A 2PN6A 4UVCA 5IT4A 5FDLB 1U1RA 3OL4A 4J90A 3LQVA 3RR8A 5BNGA 1T9VA 2W8LA 4GVBA 4HQEA 3W6JB 2ZBIA 3ZMTA 3C8YA 3ZMZA 2IIHA 1WC5A 2RDPA 2LLZA 3GYGA 2Q8KA 4DEZA 2DEIA 4R8UA 1IKXB 1MNMC 1ZELA 1ZPVA 3RJPA 2QSGX 2H6BA 2DPDA 1IN5A 3FQKA 5IYDJ 4E7SA 4N0BA 2IAIA 2VUGA 2L54A 2XHWA 1PG5B 2MQ8A 2W7PA 3MCZA 2HDCA 3LA0A 4B3TF 2UXXA 4DFKA 3Q5FA 4WXCA 4Q45A 3H92A 4LG3A 2D74B 3H42A 2DXFA 2CRLA 3UVJB 2GMLA 1ENHA 2C3UA 2JVOA 1MJBA 2MFZA 2HPIA 2J0QD 3M9NB 4KFBB 2C2EA 4G12A 2R7UA 2RDDA 4B08A 3H59A 2MA3A 1Z3YA 2DNHA 5E1ZB 1IV8A 5AIPA 3ZQLA 3K7AJ 1X7VA 1T9XA 2L5QA 4AE5A 2A10A 1V5VA 2C22A 3I87A 4FX0A 2CV1A 4RNMA 1Y8RB 2LR8A 4OU0A 3OIPA 3D5MA 1KLMA 4ZYDA 2LF8A 4KGMA 2KFDA 1VI0A 2WY7Q 2VU5A 2FU4A 4IFYA 2L9RA 4D9JA 3FKBA 4ECRA 2HNDB 2R8GA 3CW2C 2JUGA 4HDGA 5C7PA 1UHMA 3CXCR 2QX0A 4XO0A 2GO8A 5LSLA 1TKXA 4KITB 1W7PA 2CQ7A 4LRBA 2A05A 1KP6A 1QA6A 2YQ1A 2K5CA 2M70A 2ZDPA 4OAYA 4U7DA 3UDVA 1UG0A 1X8DA 3Q24A 3ZMSA 3N5FA 4ER8A 1KHWA 3GCMA 1TKTB 2A2DA 3HULA 3S14J 1P4AA 4B3SF 3N4MA 1NZAA 2G2OA 2WAQD 2DIVA 2BEOA 5A8RB 2XUBA 2IM1A 3KP4A 5G4DA 2QA4S 2BA9A 4F3OA 4M6YA 1JGGA 4M5KA 3HD1A 1HQEA 3IO1A 4AQYF 3NARA 1P7JA 1SC4B 4M3DA 2NYIA 4DQSA 1TUWA 1WHYA 4DFPA 3R2CJ 2H65B 1OIAA 3B4DA 2DNYA 2W2NP 3G4SI 3QIDA 2WHOA 3K8VA 4J7CA 2IDLA 3UN3A 4QYRA 1ETXA 2P2CB 2YKPA 1MDMA 1LFBA 4KPYA 1I6HJ 1FBUA 3IKVA 2Z33A 1VBKA 1UCRA 5D4SA 4GFBA 1SAXA 2F8EX 3ML6A 2RKIB 4BLGA 2M7SA 4DV3J 1S1VB 3WG7H 4MK9A 1OWXA 1YRUA 1Q7LB 3BN4A 1FMWA 3TOBA 3FZVA 3R0JA 5DV5A 2PLYA 2J9CA 4ZDNA 2EZHA 2QYOA 3ET6A 1FFSB 2IA0A 4HPQA 2QBYB 1YKWA 2VG7B 3BBBA 1XGOA 3OXGA 2NS8A 3AAWB 4WBFA 3SFUA 4K2JA 5K5MA 2GQQA 3DLJA 3L9ZA 2FSWA 4ZVUB 4CH0S 1U9OA 2DFHA 2R8HA 3QRFF 1ZREA 4QOTA 4A5MA 3QP5A 2ZBCA 4EBCA 4G1PA 2GAHC 2Q2EA 4S0MA 1EKSA 1R8CA 4X2BA 2VPRA 1RAGB 3UN2A 3BTCA 4F25A 3C2GA 1IR1A 2EH3A 3K1MA 2ROEA 2E7XA 3FDYA 4ECYA 3VCDA 3RI4A 2VONA 3IKTA 4QWDA 3OR2C 3CJKA 5IV4A 1G4CA 2EINH 1R89A 1FJLA 4RWXA 4M5NA 2JSPA 2ZFHA 3WTSC 4YFXF 1SD4A 1WOSA 2IS4A 3LO3A 4I0WA 3FXOA 4TY8B 1BC7C 4ZHRA 2YNHA 1GXQA 3TP2A 1Y7PA 5EEHA 3FM3A 4HI2A 1OQYA 4UUTA 2X1BA 5F41A 4OV6A 4RJVA 2DGQA 3W61A 3HSFA 3CP2A 2V6AA 4CT8A 3QIPA 1UMQA 3CESA 2F9DA 2ZBKA 3HXMA 8AT1B 3BR1A 4ENJA 3OBIA 5E3MA 4WKRA 2E5NA 1RYRA 3J7AY 3PRBA 3MFHA 4LG0A 4LRDA 2OPRB 2VDIA 1HI1A 1NPKA 4C7QA 1YS7A 3MFIA 2OD6A 2IGMA 1SVOA 2HNYB 3L09A 4PFPA 1UZHA 3GE9A 1ZOTA 3PO4A 3HVAA 3K4MA 3ULQB 3HFZB 1MJAA 5FRNA 4QWAA 2ZB9A 1RT7A 3PACA 3IHUA 1N4LA 1B9MA 3RKQA 2QMXA 3CWJA 3S3OA 1CULB 4ZVGA 2K3PA 2FHJD 1NEEA 4PJ0C 2EK6A 1UFLA 3UDCA 2NYHA 5KAIC 3JSOA 2J0SD 4CHUA 1R1UA 1NDKA 5F6FA 3FXJA 3MHYA 3LAPA 3I0SB 1YDLA 3KK2B 2V9KA 5KCMA 3I55I 2X51A 3OYIA 4EU0A 5KFAA 1VZ0A 1M5KC 1FE4A 1IN4A 1C1BB 2OKQA 1RAIB 2QTWA 1KOHA 3PX0A 1YJUA 2KZZA 5IOYA 3K70D 2V8HA 4PG4A 3S3NA 4NOHA 3HEFA 1W36C 1ZH5A 2RRBA 4ECZA 2XNRA 1S29A 3S2DJ 1ZAOA 4ZOSA 2R0QC 1Z3XA 4DQ2A 1HWUA 2HQGA 3BG9A 3M8FA 2DY9A 1B8IA 3Q0UA 2FD2A 1NKCA 3K5LA 1G1XA 1PIEA 2UXCJ 4N47A 3FXRA 2JEFA 3RQ4A 3MTJA 1BI0A 4KGXB 3WHBA 2XKPA 4CCNA 3JSPA 1U6ZA 3S1NJ 3QGHA 2STTA 5KFVA 1WKJA 3KHLA 4DFJA 5IT9Y 3W2WA 3CDWA 4P55A 1BA5A 2FHMA 1EA3A 4LF4J 2XHCA 5HDGA 3NKYA 5DLGA 1LEBA 1NH7A 4CH7A 5LMNF 2VB6A 3G8QA 1HR0J 2WOMA 4ZYEA 1U5TA 5E79C 1KDNA 1TW2A 3MAHA 1A35A 4XSXF 1HOMA 1T9UA 1JLEA 2XSJA 1W5TA 1I50J 4WFYA 2DJNA 4LUBA 2KYZA 2Y0SA 4RW4B 4ZIVA 3P5BP 4U0YA 1IAWA 2F63A 3ISND 2JHEA 4C9DA 1R23A 2UV1A 3Q22A 3R7SB 2NOGA 5ETTA 1MSFC 2H3EB 3TA1A 3QPTA 1F5AA 3GLXA 3S1QJ 1DTTB 4HV6A 1BOAA 4QIEA 3GTOJ 4RW9A 3IC7A 3R5JB 2QE5A 2FDNA 3GTKJ 5CVUA 1R8AA 1ZA2B 2HQIA 4JI7F 4XAKA 2HQAA 2BHZA 3E0JB 4A0XA 1NPPA 3ASOH 1WI6A 2N3LA 4G94A 1P27B 1CEZA 3ILJA 2Y9ZA 1BWVA 1AYEA 1WFXA 1F3VA 4YOEA 5KT3A 1QRYA 1SC6A 2PMZA 4GYGA 3M2RA 2CJJA 4KE5A 1WKKA 1P4XA 3IS9B 1KNZA 3M8QB 2Y2ZA 3TRGA 4JUZA 3I82A 3W9HA 3MM9A 2LBFA 3ROUA 2KRFA 4M9XA 1GXTA 1D1UA 1I27A 2M5WA 3GFXA 1NJXA 1JKQC 4PRFA 2F1FA 2R42A 5FJ8J 2FJBB 3D0SA 1RA7A 1QSLA 2CJXB 4LJMA 4CRJA 1G3OA 4AIJA 4HBLA 1GUUA 1X3UA 2GW8A 1W0TA 2HFVA 1JJ8C 4NBQA 2MKCA 1N0UA 3H4BA 2MZJA 4KIBA 3RB0A 2GQ2A 1BQNB 1HPZB 1AA7A 2KIQA 2RV8A 1IWAA 4BXUA 3G2XA 2IYGA 1KYZA 4XRFA 4KYWA 2IY5B 5A0YB 2WRMA 4NMLA 4LREA 5B09A 1IBLJ 2JA7J 1WHUA 2PFDA 3HHLD 4X4SA 1G6BA 3WTTC 4CCHA 1SFKA 1Z91A 2BACA 3IBWA 3M07A 5J40A 2ZC2A 4HF2A 3MMYB 2EWHA 3G2BA 2PC6A 1JJHA 3FF5A 3MM7B 4PPDA 2E2IJ 3LTOA 4A47A 4GDFA 5KFZA 3DEEA 4C3JJ 2RS8A 5DDOC 3J81Y 2HVHA 3ENVA 5GAEU 2DR7A 1OY6A 3EWGA 3SBMA 1QDUB 2ID6A 5K7HA 2BQRA 4DS5A 4UV8A 4I09A 3W6KB 2VJ4A 5K5OA 2L7MP 3R60A 1H2UX 2A1BA 2VKRA 4WE1A 3MMAB 1WSUA 9RUBA 2V6CA 3OLBA 3CLQA 2W4DA 4FHTA 3FC9A 3RW7A 2R5YA 1Y4ZB 2HZTA 2Y1RI 2WVBA 3S2WA 1L3SA 3KPHA 4LF9J 3G6EI 1S1XA 3IH4A 1OJLA 2AJ1A 2D7SA 2WSEC 5DQIA 3CO9A 4DL0C 3WGHA 3KYDB 2UU9J 1DTQB 3SDGA 4CLUA 3R7NB 3OUYB 2KH9A 4WFBQ 1UKUA 2YPRA 1VQ8S 2KRCA 1V54H 3CCWA 3W6VA 4QIFA 5L9NA 2R7WA 4F67A 2WB1D 1SKWA 2B7EA 2G0EA 2CQBA 2LLKA 5GVQA 1NBEB 1VRTB 1RWPB 3EX7B 4C3LA 1TL5A 4IOAQ 1ACIA 2OTJS 2CADA 5HOOA 1I5ZA 4BHCA 3PR4A 4F4ZA 1X4AA 2MQNA 3PIPQ 1DGRM 5MAOA 1X1AA 4X1EA 1LFPA 4ZPTR 3EUHC 3AQPA 1ZG5A 3GCWP 3BOQA 3OTBA 3OT9A 2R2TA 4OJHA 3CD6S 2LQ8A 4AYBA 5DS7A 2DFEA 2XLKA 3I5UA 3OWTA 2Y48A 3FMRA 1XSVA 1BWEA 3A1YA 1VIXA 1JWWA 5TRDA 3AAFA 4UUSA 4JP0A 5KFXA 3MM6A 4LLNA 4HEA2 2VJJA 1OYWA 1WQ2A 2VPLA 1TQMA 2BM0A 3BF4A 1HA1A 2DO4A 3QLHA 2HVIA 2HLTA 1BXNA 3GPAA 3K2ZA 2C3MA 3ZXWA 1W25A 4UV9A 1V4RA 4KJIA 1MWZA 2UXBJ 2ALYB 2X85A 4J9KA 5THWA 5EUHA 2KT0A 4D7NA 5EZGA 3CJ3A 2VIHA 4UF4A 3FNNA 5M3MJ 4URGA 5EYRA 1NNDA 2W1BA 4CLTA 4N4NB 1FBSA 1R5ID 4RA2A 5IT3A 3CLOA 4OZLA 2ZSIB 1S4EA 4NLPA 2HRYA 2AU0A 1MBKA 2XGCA 4BYYA 3PHEA 5F04A 4F50A 3GEZA 3RKWA 3NAHA 4H4KA 5DEQA 3W2VA 4M5DA 3GJSB 1GX5A 1RTDA 1JLCA 3F3XA 2O67A 3ZXSA 2V2QA 1JJ2R 4EJTA 1T39A 3LW5C 1U6FA 3VQTA 5CHCB 4HNUA 1XERA 3K8WA 3J81Z 3I56I 2M52A 1Z7UA 4CA0A 1T38A 2PSZA 2OEKA 4ECXA 3KK1B 4BHPA 3WIVA 3LSHA 4OYPA 4M8LA 4BGDA 5F9LA 1TMJA 3TW6A 3HHNB 1SUQB 2XV4S 2R8KA 4M3FA 2VFVA 1FYKA 1JNZB 4LR8A 1EKRA 4FQGA 4X84A 4EFAC 4PQUB 4ANDA 2J9DE 2HIQA 3KP6A 4EUVA 2K7LA 1HBNB 3V4GA 3IP0A 3PX6A 3DHWC 3HI9A 1N5TA 2DFIA 4B8XA 4DQRA 2X6OA 3ZZTA 1PUFB 1IJWC 1QVFR 3TP0A 2M45A 1S77D 3QO9A 2AS5F 1NG7A 4WF9Q 2ELHA 5JVHQ 2KVIA 4FYVB 1N36F 2VDHA 3EETA 1BY9A 4RW6B 4C4WA 3TDUC 4ZJLA 4LIUA 5KFEA 1DPUA 2G0JA 4QW8A 2XMTA 1ETKA 2O0YA 1D9AA 2CUJA 3O8GA 3DOLA 4E0DA 4DPTA 2VQGA 2DIUA 1OSCA 2FMYA 2AYGA 4DV7J 3RSNA 1AROP 2W84A 2HVDA 2QV6A 4V19K 2QG9B 4F36A 2K3FA 3SEQA 3PRDA 5J1UA 1IV6A 4YR0A 3CF2A 4NX9A 2K9QA 4F93B 4LF7J 2XMJA 2LXFA 1OYYA 3E7LA 4DX8H 3O1LA 1RAAB 1FRJA 5F1JA 3CGIA 4FDFA 2K02A 1RGVA 2J5AA 1U78A 2AJFE 2RH3A 2ESHA 4QR1A 3UDLA 1U0HA 3BREA 3HZJA 2J76E 3SV3A 1WC6A 4RGRA 4WYWA 3JTPA 3P5JA 4WCEQ 3M4OJ 3E5QA 2DGWA 3I58A 2ZXWH 4P10A 2O3FA 4A0YA 1V3FA 1LDKB 3CMAS 2R8JA 1EP4A 2DNGA 4E7ZA 3PV8A 4R1HA 3OIOA 1J7KA 2AF6A 4O3PA 1T2KA 3IAM2 2NS1B 2KL4A 1V6HA 2VODA 1Q1HA 3HRTA 4F7ZA 4RB0A 3CD0A 4USWA 4BQNA 5GAHI 4ILLA 3CCJI 4ID5B 3CZ6A 4JV5F 4X65J 1DBDA 4W1UA 1FJGJ 4H4OB 3QMQA 2XQCA 4RWWA 5EEGA 4JBAA 1GMWA 2UVRA 4U6PA 2YX1A 2O61A 4EBEA 3IGNA 2D3UA 2OTLS 3R5AA 3EUKL 1U3EM 3QGIA 1JHHA 3PW4A 4LF4F 2FZKB 1KLMB 1KR4A 2KJVA 1DHMA 5B0GA 3D5SC 4BQOA 4CGZA 2F5GA 3FSXA 4NE9C 5ILVA 4IFYB 4Y2AA 2WSFC 1U48A 1P2FA 5TJJA 4ZVQB 5LJ3Y 2JMWA 1LNQA 3K0LA 4WWSA 2RILA 3PNVA 3S7RA 1N54B 3FXQA 2J8SA 3ZMDA 3KE2A 2V2ZA 4CO1A 3UNGC 5K7FA 4X4RA 1JLQA 4FETA 1CJTB 3S3MA 1S6UA 1TKXB 1S1UA 2BJ9A 3IM8A 3SFZA 3C66A 3BGRA 3EZ5A 2P9GA 2XAQA 2CDRB 3EVOA 1OYIA 4ZP7A 4ZYAA 1O4XA 4Y33A 1B0TA 1PBUA 4ETZA 2FNPA 3TR5A 1B72B 4BACA 1V5EA 4DSLA 1HW5A 2VD3A 3PFEA 5B1AH 1SB6A 4U7CA 3HP6A 1VQNS 2GS8A 2JA2A 2L9DA 1HQEB 2ZBRA 3G87A 3F6OA 2O01C 1QQIA 3PQKA 1A7GE 4HR2A 4F2SA 4U95A 1Y00A 5IYBJ 3W60A 4RNNA 2CS3A 1VQ5I 4AXJA 2Y9HA 3U1MA 2MTLA 3JSRA 1OMIA 5G0RA 1S3JA 3LAMA 4NC8A 1SC7A 1V55H 1SVLA 4ZVTB 5FKOA 1Y9OA 5KK1A 2BW7A 1UVNA 2B7CB 1YJTA 1UAAA 1WPKA 2JWTA 2K8GA 4LVNP 5KFPA 3M8YA 1FWLA 4BU2A 1UL3A 1K73T 1D09B 4HZFA 4HKQA 3AODA 2XG8A 1OYDA 2V1DA 5J2PA 4NI2B 3U7JA 3FEZA 5C3EJ 1MN9A 2HHUA 2KJCA 5KG2A 1ZR2A 3E5XA 1R6RA 1NYNA 4MTDA 3JRDA 3MD1A 2RDJA 1D0EA 2IVYA 3AHPA 4UY8T 1JQGA 4A8XA 4NNJA 1SAUA 2GZWA 4AIDA 3ENQA 3RB6A 2R2UA 2JDJA 1EV7A 1R8PA 2JRTA 1Y3JA 2L0KA 2GHWA 3KJVB 2MSYA 2IFXA 5ETKA 2VL8A 4QYZJ 4DQPA 2KZVA 5KVRA 2NXJA 1TFYA 1FLIA 4D5FA 3G82A 1RT1A 2Q2EB 2QRRA 4XN0A 5BS6A 3M32A 4YFUA 4ECWA 2BQUA 4ZVOB 1ZRDA 3M9MB 2WAQA 5I3PA 1QHHD 3A3NB 2XY7A 3UCUP 3T1HF 1WWXA 3MEEA 4P2XA 4UUXA 1FPQA 4OX8A 2CRGA 1VQOI 5HP1A 1VJWA 3MUMP 3QYEA 5L1KA 1RHUB 2ZH1A 3LGHA 5ICGA 2ADCA 5J2MA 4JX6A 3BGUA 5BYSA 1WHWA 5E1XA 3LA2A 1U2FA 3KDOA 1AOYA 2K06A 3KETA 1FP1D 1ON1A 4U9RA 1IDZA 1R8BA 3L7WA 4DDFA 1G59A 1RT4A 4UXNA 5IT9U 2PT0A 4G7OF 3OYHA 2GMJA 2LKPA 4NLQA 3QYYA 3ESWB 1KQGB 2ZC3A 3UCZP 2X1GA 2YTCA 3AL0C 2MQLA 5HLTA 3GW2A 4OZNA 3K1NA 2CXEA 4JI3F 1QBJA 1T05B 1ZLJA 2ZNZA 2XF5A 3TZWA 4DJAA 3E01B 2QM3A 4P74A 4X4NA 4K4XA 2BX6A 1MWQA 3MEXA 5HMYA 1VQPI 2GA2A 2ADUA 2HS3A 4LD5A 3SYZA 1FNMA 3EXYA 4XK8C 2X4HA 4NXNF 3AG4H 1VQ6S 3OSPA 3Q0AA 1SC1B 1Q1KA 2QMWA 2YQ0A 3GSIA 3DEUA 3GVAA 3PKMA 4DR3J 2D1CA 1O51A 2FJWA 3CTAA 1ZK8A 3HM9A 1RLCL 3KHRA 2QKLB 2PA3A 2FY1A 4CO2A 3LQQA 3LH2S 2IS2A 3JRBA 3NXZA 2ZE2A 1VBXA 1RT3A 2VXZA 3JRGA 2VI6A 3CCYA 1M1HA 9ANTA 4XLEA 3U1DA 4Q43A 2RRAA 4K4ZA 3CCLS 2CA9A 3BG5A 4MEXF 2VC0A 3DMJB 3CF5Q 3TWZA 3QT7A 2BE2A 3HSEA 2XZTB 1MROA 2CQPA 2FOWA 3RZAA 4MO7A 4RAZA 3DLEA 1T8IA 2MBFA 3I71A 1YBTA 2AO9A 3FMQA 4J91A 5J2QA 1FT9A 3R2DJ 2VFUA 2OPSA 1ZTWA 1Z1ZA 4PG7A 1YO5C 4A69C 1REPC 1AB8A 2AEFA 4PPZA 3CUQA 1JE8A 5FLXY 2HVZA 4KKOB 1KOOA 2R7OA 3GFYA 1B8IB 5LLQA 1IKWB 2F5EA 2CJQA 4BJTA 5J2NA 4DS4A 4CDGA 3J7AO 1Q7YT 3ECOA 2B9WA 1WORA 2CMPA 3CCRI 1NK9A 2IBKA 1OCPA 2VC1A 1WOOA 4KIGA 1GT0C 2CNKB 1YRTA 2FTRA 1S1WA 1PP8F 2X3GA 4E70A 2XRLA 2M2BA 4BJ6C 3W2WB 4OLOA 1PAUB 3L2UA 3CJ4A 4JQFA 1DAXA 3R61A 1YX2A 3BR8A 3JQJA 4KYZA 4CCLA 4UQTA 2FVCA 3VAJA 3CCQS 1FOXA 4P73A 1HHSA 3O2PE 4CCMA 2J5PA 3J81U 1WJ9A 3DGPA 4BCAA 3BZCA 3CJRB 3FMBA 4QWBA 2WOMB 4JI0F 3MMJA 4HLYA 4C48A 4XL9A 4I2QA 2ZC4A 1E6VB 4Q8EA 3HZEA 1JLEB 3DOKA 4O3SA 2ZMEA 2H5EA 1S9HA 1FYMA 1S57A 2MD5A 4UZCA 1ROFA 4DG1A 3K59A 1H9TA 3OW2R 2OQRA 4HEA9 4I0AA 4I2PB 1ZA1B 3AOCA 5DG8A 1F36A 3KUHA 4DSIA 1Q1VA 5HLFA 3JR9A 5A76A 2DA4A 5GPCA 2OPQA 2V8DA 1LOUA 2JX2A 5E20A 3RPUD 1WWHA 3F8BA 4U96A 2GJFA 3UWTA 4OV1A 2H4WB 2B6AA 5MLCV 3PIPF 2WA0A 4TYAA 1O6XA 3UKGA 3M2RB 4DL4A 1U24A 1T98A 5EGYA 4D3GA 4E4HA 2M0MA 1N56A 2NNYA 1T02A 1Q5YA 2OF7A 3BBFA 3MM9B 2DEJA 1B99A 4LF7F 3GJTB 3QAHA 1XPXA 1M0SA 2Y30A 4USUA 1UW4A 2ZFWA 1IXCA 4EZ9A 4CO3A 2H6CA 4C8MA 4PJMA 2Y8WA 4X4VA 2OCCH 4AXIA 2JLGA 2CDQA 1AZSA 4LOCA 1SFEA 4M5LA 2M0CA 1KVKA 1EETA 4YFKF 2E9RX 2A61A 2LC2A 3VSKA 5J1PA 2DISA 4DR2J 1OQ3A 2X6WA 4NC7A 2DGSA 5BJRA 3TAQA 3KIOA 4DL2A 4QIWN 1H9GA 2MQPA 2E29A 1VHFA 4I69A 4XM3A 2B4VA 3TX0A 4N77A 3LP2A 1CJUB 3NRBA 3SXYA 2NCKL 4ABZA 5FLXZ 1IJEB 4C2MJ 2MDAA 3LALA 4MGRA 1RHRB 2I8DA 3HKZA 3F73A 2O9LA 4DV6F 4ED2A 4C11B 3IWXA 2QKMB 5HROA 4O5VA 2LP0A 4RUAA 5BR8J 4M5IA 2CPZA 3IWNC 3GTGJ 2BJ3A 3DNCA 3FFIA 1FJGF 2I5UA 5EWEA 2BR0A 4WE1B 2ZDOA 2DY1A 3A3PB 3HDSA 4X62J 2R5YB 1SL2A 1WTFA 4F8RA 5M5YJ 1NDCA 2ADBA 1S1XB 4IEJA 3EDPA 1K4TA 1YK9A 2Y0BB 4IRKA 3S1TA 1ICEB 5IC6B 4OHZA 1TL1A 2E60A 2X1EA 2E1MB 3GV7B 1VQ8I 4XICA 2PIIA 2N3OA 2QENA 3OJSA 3DLGA 2Y9YA 4FCYA 1C0WA 1MG7A 4PDKA 5B0CA 2OC6A 5B08A 3JB9k 4DR4J 2ZXHA 4AU7A 1IXRC 4DPOA 2O6GE 2FNAA 1MNDA 5B0BA 5D0HA 3QYFA 3K4CA 1A5JA 3HB9A 2IJNA 2BRKA 2PE8A 2TRTA 5KAFC 2YR2A 2J7WA 2RVJA 1SFUA 1IXKA 2E9TA 1R0BG 3ERED 1TP7A 2BXYA 1U8RA 2QC3A 2KPMA 4RO0A 2PGCA 1T95A 1OYEA 1RR7A 1RUSA 2P6SA 4PXBA 1VC6A 3OFFA 4OZ2A 3CD7A 4FT8A 1N77A 2LDYA 3GYXB 2QFJA 4USKA 4Y15A 3HKWA 3MM6B 4Z2XA 3IAM9 3HRSA 5CCMA 5AXLA 3OVAA 2CVIA 4HA8A 2K27A 1JIHA 4ED3A 1AHDP 2F8MA 3VGTA 2OD5A 4O4GA 3H35A 2IRFG 3H0GJ 3SSRA 3K57A 4ZZLA 1RC9A 1K1SA 2YKNA 1M1EB 1SL1A 4P9FA 2P81A 2Y75A 2BY1A 2NZCA 5L1IA 2DCLA 2IS1A 1UWAA 1YBAA 1S10A 1R5HA 1NKBA 2FRHA 4ZTJA 5FD5A 1TL4A 1XMKA 3I59A 3QPLA 4EEYA 2EK1A 2E5LJ 4M5DB 2V6EA 3W2VB 1RTDB 1T03A 3FMWA 3PDNA 1JT6A 2WB1A 3IM9A 3LAJA 4KN4X 1WKMA 3FXLA 2JH3A 3OIQA 2IRUA 1LE8A 2X3DA 2KB2A 4CP5A 4OYZA 4IFVA 2CVEA 3CEDA 1CG2A 4LRFA 3DWLE 3DFGA 4HI1A 3UR3C 1BM9A 4QPQA 2IHR1 3K6GA 1RT5A 5H6RA 2VL1A 2UVWA 2FMLA 3BV8A 1K83J 2JC0A 5T14A 2LXIA 3HPGA 4DV2F 1G4DA 2GVZA 1PJ7A 4RMNA 2BE5F 2DYSH 3BGOP 3P5TL 3WQPA 1L3VA 2Q66A 1NMEB 3D54A 3MCMA 2K9NA 1NK5A 1Y0UA 4UW2A 1O57A 5A2QY 2CQQA 3IRWP 2E7VA 3GIKA 5JFRA 1F9HA 2WVCA 3QO9B 2B56A 3BTLA 5I3UA 1B59A 2DTJA 3OL6A 5EGOB 1RP5A 2RN7A 1S9GA 2QLXA 4BAYA 2A68F 2VASA 2HZDA 2ZWPA 3NY0A 3DXBA 3A03A 1YZ6A 1WG5A 2AGPA 4WKYA 3D1HA 2JJ7A 2FF4A 4WXDA 3HXLA 3CCVS 2XB2D 5DUIA 4JV2A 1MMNA 2LY2A 1ZG1A 1R31A 1FHTA 2FVSA 4M72A 1YJRA 3DOLB 3MR6A 1REGX 3BR2A 4CTAA 2H8RA 5AIQA 1T33A 3ZC4A 2EW9A 3IWZA 3R6SA 1J5OA 1QPMA 4M71A 1QSSA 2HFZA 3ADAC 3NNAA 2P7CB 5EDNA 2EFNA 1FEXA 2POKA 4AL7A 4XQFA 1AUDA 3DTEA 1SD6A 1JTXA 4S0HB 1I51B 2ZH3A 1ETQA 2DNLA 3A8EA 4IH7A 4IHSA 2ICWG 1HW9A 1P9YA 2V0NA 1U0HB 1TKZB 3NS6A 2RNJA 3EUAA 4EWTA 2VQLA 2FE3A 2CJBA 3PYGA 1R36A 2VKDA 1M5HA 4CICA 3M4XA 1ZYRF 5LMUF 1D0XA 3PUBA 3NOCA 3RQIA 1EX8A 3CMAI 1TL7A 1KZHA 3PJXA 2EI5A 5F3ZA 3MOJB 5ERIA 1N88A 3CCTA 3V7SA 1Q53A 2LA4A 4GC7A 4A8QA 3U2RA 1SVDA 2CNNB 3A02A 4GO5X 4MJKA 5D5XB 2RE1A 3RRKA 1YYVA 4HH0A 3HC7A 2HHHF 4ZK7M 1YGYA 3TBIA 3PHTA 4IRHA 3HPHA 4DCPB 2YXLA 2H09A 1GTEA 2L4AA 4XRSG 1Y5NB 2YNIA 2QGFB 3UO0A 1QLNA 2JL9A 2BDPA 2D9OA 1TQPA 1LWXA 3T5HA 4NWBA 3HBLA 2GVDA 1R8HA 4BC7A 2EBIA 5KFDA 2CWEA 4F4KA 1BC8C 3KLEA 4ESJA 5F8LA 3ABTA 3DBLB 1FYLA 4QW9A 3EYYA 2PBIA 1E17A 4KH1B 3RIRA 3GILA 1LVAA 1QHGA 2V50A 3TW7A 3JTHA 3Q8VA 3KLVA 1FRLA 1ZM4A 3MMBA 2DH8A 2ZD1A 2LMDA 3HO1A 2H1LA 1K78A 1FY7A 2DODA 1IWGA 4OI6A 3G8SA 3N97A 2F4IA 3GFJA 4DV0F 4ZPVR 1P6RA 1QO0D 4K8RA 2VLAA 2ECCA 2KRHA 3PG9A 1S1UB 5HDKA 2HGLA 4CM0A 3LWMA 1OCOH 3BGRB 3M30B 4UY85 1X31C 3KG4A 1E6YA 1ZN2A 2KKOA 2AJQA 4RBTA 2GQCA 4XTTA 1FNNA 3I5AA 3SHFA 4IG0A 5D78A 4NZ7A 2HWIA 1NHKL 2P5KA 4I6ZA 5KFQA 3GLLA 4I99C 3VGUA 2RF2A 1VQNI 4RUCA 3M8RA 1O3QA 1A6IA 1XWLA 2QQ9A 1GFWB 4B9NA 1V9OA 2RIJA 2IMOA 1I3OB 2J9EA 3GCXP 2CQ3A 3OYJA 3QOEA 4EBDA 2AJ0A 1SANA 3GF2A 2G9OA 1M90T 5G0RB 1QU3A 1H6KX 1CSJA 5L9XA 2XCAA 1NHAA 4CLKA 1MWYA 5E1WA 5F0CA 4ZN1A 2KL8A 1WEZA 3ABMH 3NOGA 2YWWA 2JT1A 2HW3A 4CLYA 3V8KA 3C2BA 1HWJA 4MTPA 4WP9A 1IXSB 5J2PB 3HG9A 1YVFA 3CF5F 3VFZA 4JI2J 3ILOA 1D9DA 2KFYA 1RADB 3E6MA 2HS0A 2A69F 2BY2A 2Z1DA 3AJ2A 3R27A 1H8AC 3N6LA 2P6TA 1RKTA 4ZVEA 4OIOF 3L7PA 2J8AA 2HSEB 4HH1A 1VYAA 3T41A 1W2BR 4Y13A 3AD8C 3HX9A 1NDPA 4KPCA 2ZFUA 3HZGA 1OPIA 3VPRA 4Y0FA 5L1JA 1T3OA 1T8EA 4A6EA 2P7VB 5GAHU 4ED4A 2DKOB 4DX5A 3WE2A 1TNSA 4DYRA 1RE1B 2Z58B 1IM4A 4M3GA 1TP4A 2GXGA 4MMOA 3G82B 1H74A 3M32B 1HI8A 3BQ2A 4LT6A 1B64A 3BG3A 2YPYA 5C44J 5FLXU 4PYAA 3UVJA 1DY3A 1JLFB 3MEEB 3HVTA 3MECA 2HNHA 1KSPA 5LGTA 1G3WA 2X1DA 3GYHX 3CMQA 5KG5A 5KG7A 3AB4B 3A0HC 2K1RA 5HMZA 2GIFA 3P4UB 5LBQA 3L2QA 2TCTA 2E1NA 3T1AA 1S9EA 1RA6A 4U87A 4MEYF 3CDHA 1MMDA 1JNRB 4F02A 2CWKA 4DNCA 4YUDA 3R5GA 1RK8A 1YQAA 3AY0A 3VDXA 2NOJB 2ATCB 1V5GA 1LXJA 2HFHA 1X58A 3F6VA 2QQBA 1QVGR 3HK2A 2HXOA 2F65A 5IOZA 2FC8A 4ES2A 4JI8J 4DR4F 1OPCA 2BRLA 2X1AA 5F8IA 3D0GE 1YQHA 5T41A 4BWMA 1XK8A 1EZZB 3F8CA 3B8HA 4CSWA 1RETA 3J80Z 4I7FA 2RNEA 3TVYA 5B0FA 1PO6A 5GTHC 3F56A 6FDRA 1DARA 5EX0A 2BKPA 2VA2A 2K4BA 3SCIE 3KEQA 4YB6A 4M5GA 2HHXA 2PQ8A 3OSFA 4L3KA 1RT2A 4M1KA 3QNWB 3EGZA 1WHVA 2R2RA 2ZE2B 3BJAA 3LPYA 3V6DB 5H9FK 5J4YA 5L3FA 5GTIC 5K8MA 2ZBPA 3ENWA 1B3TA 2HZVA 1UMJA 2VQEF 1IBKJ 5AE1A 3OYLA 2BE2B 1MROB 1TTHB 1RPWA 2O1PA 4EM1A 3GTJJ 3DLEB 3OHAA 3I53A 2HQNA 1HDDC 1C0UA 2CGPA 2IDEA 4DUZJ 1MKMA 5J2QB 3ZP5A 1S1VA 2DGTA 3M7GA 2OPSB 2A6HF 4B9UA 3N6NA 5ICEA 1JK9B 2XAFA 1K79A 3EYIA 2AZ1A 2LDIA 4DR7J 1UEUA 5KFBA 4ENKA 1PUEE 2GFFA 5J1EA 5HI7A 3K10A 4ZLJA 1N34J 1Q81T 2HZCA 4PR6A 3HHGA 2DTRA 4XDDA 1HKSA 1RCOB 2DNKA 4FKYA 5J2NB 3ZQ7A 4RBOA 2QBYA 2VG7A 3EYZA 3ZPLA 5AXKA 2YH1A 1NK8A 3CJSA 5FLXK 3SQOP 2HHVA 2X7IA 3CJQA 3EZOA 4CQ1A 2RKHA 1S1WB 2LP4A 3PW5A 3SZ2A 3JS9A 3W5ZA 4JI6F 5J6XA 2AQEA 2CUEA 3BQ0A 2LDUA 2AXTC 1HYSA 2ZO4A 1EB0A 2QQAA 1YJ9I 3KDNA 2P9CA 1JMTA 3H1CA 1WI9A 3NGTA 2C3OA 2LSOA 1G3TA 1LJ9A 4RB3C 4RW8A 1S0VA 3JRAA 2KYXA 2DGXA 3V7CA 4KHPF 2CNOB 2Z2YB 4I2QB 4DGWB 4C9YA 2JN6A 3DOKB 4IHXA 2KFZA 2ZMEB 3V8JA 2B7BB 4N8NA 4A2UA 2ERRA 1G8XA 4DZ6A 4A3FJ 4TY8A 1VFCA 5U47A 2OAUA 1HCRA 1N5VA 3NCRA 1DLOA 4DU7A 2MABA 5EEAA 1S5LC 4ZMMA 4P6QA 2RAQA 3K69A 5LEKA 3SQGA 1SKUB 2RU3A 4FBUA 3KP5A 1XJWB 3C3LA 4MQVA 1S1TA 5D4RA 5CQEA 3VR1A 4V1Ak 1CJVA 1FOWA 2AHQA 4DV5J 2ZXIA 1HIYA 4YS2A 4YRVA 2MJUA 4ILRA 2F48A 4ED6A 3PNYA 3I4NJ 4ZCMA 1FJEB 2OPRA 3M05A 1MBEA 3M3YJ 3CE8A 2HNYA 3NGDA 3D28A 2HR3A 2HPMA 1EH8A 3WTWC 3HUGB 1FRXA 2W4CA 1YITI 5D4PA 4F3MA 2HK3A 2L02A 1O3SA 1EETB 2OAZA 3PX4A 2FY8A 2M87A 2Y1LB 1OSDA 5HANA 2DXIA 2Y0SD 2YY3A 4C97A 2A6OA 4DL7A 1S0MA 3FHNA 4G6VB 1WG4A 5HLHA 2L9WA 3I0SA 3KK2A 3JRIA 1X9SA 1LKXA 4USVA 1GVJA 3PL8A 1I5OB 2HHWA 1MBFA 3MAJA 1T9YA 1ZM3A 4P9SA 4X4TA 4ALZA 2JJ4D 2OJ3A 4RNFA 3QPHA 1KVJA 1MBJA 5KOXA 3UNYA 4PCQA 3NL0A 5EJCA 1RAJA 3TW0A 5ICCA 3DYAB 4TKTA 3BY6A 2PMZD 1OCZH 4B3TJ 1U2WA 5CQGA 5HROB 3SDBA 4PABA 3RPUA 4XPCA 2ZOMA 1T9WA 3SCLE 2XLJA 2W48A 2BYVE 1XMOF 3IRXA 2A5YB 3ZZYA 1FERA 2JOQA 1RR8C 2XYPB 1DZ5A 1FIPA 2HVQA 3CJ0A 3LA7A 4LF1A 1J59A 1P9QC 3DC2A 4DR1F 3HRUA 3ISNC 1ZM2A 5KG1A 2RT3A 5DCFA 4ZKAA 1NK6A 2JVGA 3BYRA 3SV4A 3VWSA 1TL1B 1UELB 2Y1IA 4TN2A 3H5AA 2EA2A 3S32A 3LP0A 1AA1B 2VZ9A 2OMOA 5FFZA 3DLGB 3RCOA 1UJ6A 2J6SA 4TU9A 4C8NA 2FJAB 3SCJE 4DSEA 2IA1A 1U7LA 2HAIA 1MSEC 3IH2A 5DD8A 3J7ZT 4J19A 2RC4A 3OR1C 4ECQA 3CULA 3CDIA 2OGUA 1W5CC 2YX7A 4TVAB 5AXMA 5A2QU 5HLIA 4M74A 4OI1A 3IGVA 1KVIA 2VPXB 1XR5A 4F3QA 4ESFA 5GAGI 2LY9A 1W36D 3MQ0A 4B3SJ 3D5LA 2CV2A 3K2YA 2N8GA 1RWOB 4J9NA 1S0OA 2ZNYA 2V4JA 2Z3YA 3TMOA 4K7QA 5HVFA 3RKXA 3W66A 3DOMA 3JXOA 1HSTA 3EVMA 1XGMA 1IQZA 2HWTA 1I1SA 2OPPB 3FRYA 5CYJA 4WZQA 4BDZA 4ZCLA 3IG1B 2R7FA 4RLEA 1IBMF 4DSFA 4KMFA 1M5OC 4F91B 3M8QA 3W7BA 1Z05A 1P6TA 1WJFA 5DGBA 1RTJA 5F8NA 3BZKA 3ETMA 2KM8C 3HHLC 5D8LB 1BMQB 1BHNA 2LFVA 3D0HE 4HT7A 1OLTA 2EKNA 3CCUI 1MH3A 3QFWA 1RZMA 5E18F 1B1BA 4NRUA 2DU9A 1ZARA 2ZHAA 1JT0A 3MF5A 1CS4B 1LFUP 5M2RA 2YKNB 4QSHA 2XMMA 2FUG2 2ZUAA 1APSA 2W1OA 1C2PA 4JI2F 3WDOA 4BE0A 2CJYB 4TU8A 1S7EA 5E41A 2L41A 1BGXT 1BQNA 4CZZA 3KNGA 1JKRC 2DPJA 5HQLA 2DHAA 4IKAA 1T03B 3TUPA 1WTBA 1Q78A 3VOEA 2UUAF 3ETOA 1VI7A 2B4PA 3LSRA 5F27A 4HF0A 3HSRA 4C2UA 2MZRA 3GTYX 1S72I 3ZFVA 2NUUG 3MM7A 4K4WA 2FBKA 2DNPA 3DTKA 3HM5A 2HKEA 2WB4A 2XY5A 4KHRA 1RT5B 3DEWA 2BQ3A 3TEDA 3MEDA 2HKXA 3PZPA 1H7WA 1R3NA 2OQGA 2JNJA 4WFNQ 2DYAA 4RU2A 1NPRA 1YIJS 3GWCA 2OUMA 1RKIA 5JUMA 4MFDA 3MMAA 3C2HA 4YFNF 3Q83A 5GMDA 1EJ9A 5HL7Q 3HYIA 4L5EA 3T1YF 5F0WA 4DFMA 4LMYA 5D4OA 4Y65A 5C5JA 2AQ4A 1FC3A 3M6WA 1T9TA 2EBGA 4Y6IA 3H0DA 1KWMA 3M2VA 2GLOA 2B0GA 3AOBA 5EG0A 2HMIA 4Y34A 5SUHA 4CNYA 2BUNA 2VQCA 4E7LA 3DDNA 4QZVB