1P9QC

Structure of a hypothetical protein af0491 from archaeoglobus fulgidus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
233
structure length
230
Chain Sequence
VSLDKAVIARLRKGGEEFEVLVDPYLARDLKEGKEVNFEDLLAAEEVFKDAKKGERASVDELRKIFGTDDVFEIARKIILEGEVQITAEQRREMLEAKRKQIINFISRNTIDPAPHPPSRIERALEEAKVHIDIFKSVEAQVKDIVKALKPILPLKFEEMEIAIKIPPEHTGRAISALYNFGGVTREEWQRDGSWICVMRIPSGMYGDLMDLLGKVAKGEALTKVLRRIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Shwachman-Bodian-Diamond syndrome protein family is involved in RNA metabolism.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein AF0491
total genus 58
structure length 230
sequence length 233
ec nomenclature
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01172 SBDS Shwachman-Bodian-Diamond syndrome (SBDS) protein
C PF09377 SBDS_C SBDS protein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.900 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1p9qC02
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1p9qC03
3.30.1250.10 Alpha Beta 2-Layer Sandwich Hypothetical 12.0 Kda Protein In Nam8-gar1 Intergenic Region; Chain: A; Ribosome maturation protein SBDS, N-terminal domain 1p9qC01
1VI7A 3B78A 4TNOA 2I0XA 2NPFA 3OQ2A 1P9QC 2BM1A 2IVYA 2XEXA 1KTVA 2KDOA 4M1KA 4FN5A 4QR1A 4ZCLA 1DARA 2ZITA 3E3XA 3ZZUA 4MYUA 4ES1A 3ZZ0A 3B82A 1U2RA 1ZM3A 4ZCIA 2L9NA 4ES3A 2CVEA 2I8EA 2BM0A 1N0UA 2WBMA 1FNMA 1N0VC 1ZM2A 1ZM4A 4MAKA 2EFGA 1NYNA 2E1RA 4MYTA 3EXCX 4ES2A 2BV3A 1ZPWX 2J7KA 3ZZTA 4ZCMA 4QR0A 5G4DA 4QR2A 1ELOA 3LH2S 1ZM9A 3UI3A 3B8HA 1T95A 4ZCKA
chains in the Genus database with same CATH superfamily
3CESA 2ZCWA 2RAEA 2AEFA 4D5CA 4MTEA 3QT6A 4BLGA 2ZVSA 2V8VA 3PTWA 2H94A 3HULA 1VLYA 2NVUB 2KM8C 5GAGI 2AHQA 5JHFA 1HNWJ 2PBIA 1VQLI 5J3LA 1TL3A 1WEYA 3JTOA 2RJZA 2FA5A 3DOLA 1VQ8S 2MKSA 3EVMA 5CPRB 1T05A 3OPKA 2BE9B 5LRRA 1RLCL 5DTDA 4ES3A 2HHTA 2GNKA 4DV3F 1OYIA 3KG4A 1SMYF 1D0YA 4YR3A 2KH9A 2DXFA 3JAMZ 2HQ3A 4HR2A 4PUOA 2OMOA 4MNUA 1N36F 2W7AA 2CU7A 3GTOJ 2DH7A 2V6EA 3UPFA 1IN7A 5A2QK 2OTJS 3AKZA 3S1RJ 5ED4A 1NZ8A 4DL2A 4M9ZA 1HNXF 2H65B 4ED4A 3FCVA 4CXFA 3RBXA 4EO8A 2JLGA 1J5EF 2KHCA 1C0UA 2Y1IA 1OS5A 4FT8A 3SSRA 4TY8B 4XK4A 4W98A 1MMAA 2DCUB 1MZBA 2CUFA 2PMZA 3Q86A 1SJRA 3B82A 3IHUA 1LB2A 2I2YA 4HQEA 2C28A 1HKQA 2RVCA 3M1VA 5E1ZB 3WHCA 2J7UA 2IHR1 2LDYA 2VG5A 3MF5A 4DL4A 3IXQA 4N8OA 3L2RA 5ETTA 3CJSA 4YIIA 1ZR4A 1Q81T 4C11A 1HSJA 4U8VA 5A8RA 2D3ZA 3EGZA 2O9LA 1RAJA 3CCQS 5F0WA 1ZYQA 1PJ7A 1YTYA 4YUDA 2UUAF 3IH3A 3BM7A 2MH9A 1VIOA 3PYDA 3QT5A 2FQ4A 2O66A 4AT1B 1KU2A 2SXLA 2KJCA 2HZAA 4NOHA 2IRXA 3GW2A 3J7AY 1UJ8A 3T1AA 3MM6A 3US5A 4M94A 2IRYA 3CNQP 4WYLA 3C15A 2E2JJ 5LMNJ 2KZVA 1ELOA 4U7DA 2AMCB 1CBKA 2P6SA 3VAGA 4KHMA 1E6YB 2QLFB 1Y1VJ 1X4BA 2P9GA 5K7FA 2YU9J 2IVYA 2ATLA 1BR1A 4ES1A 1VQMI 3M8PB 1N5YA 4Z2YA 1N88A 3Q8UA 3K4LA 1FOKA 2AYBA 1D8YA 4F55A 3I4PA 4XRFA 3O8WA 2E9ZA 2BJ1A 4DG1B 4GVLA 4U88A 1V6HA 1FHTA 3GBGA 1MBJA 1X3UA 4Z37A 3JRGA 1VS3A 2IT0A 3NKYA 1UMJA 4IH6A 2V2ZA 2X0LA 4JOMA 3PZPA 3A03A 2V6AA 2CWEA 1VHIA 1F9FA 2Z99A 2V26A 3EQLF 1XS9A 3HFZB 1GVDA 4QWBA 2A05A 4P73A 5EWGA 3RIRA 1IM4A 1WTBA 3K10A 1EKSA 4M5KA 1FIAA 2K1RB 3LA2A 2PG4A 2IYGA 3SSSA 3ZMUA 3H4BA 3MXHP 4L9JA 1O8BA 2YPZA 1AFIA 2IM3A 2HS5A 1VQ6I 5B09A 5EWEA 2AJ4A 3EYZA 3MMYB 1UZHA 2VG7B 3TAMB 1VQ6S 3C6UB 1GFWB 1RC9A 4I6YA 4WFYA 1S6PA 2CWXA 2WVEA 3CCSS 2J6UA 1TTYA 7FD1A 4XOTA 4L9NA 5KFTA 1UA1A 2M4MA 2LFBA 4IHYA 2HOTA 4BEHA 3HZEA 3S3MA 3QAUA 1V5EA 4FYYB 4M73A 2J9DA 2L9RA 2DA1A 2YNIA 1V3ZA 5FFZA 4UHTA 3QRRA 3BR6A 1UVLA 4X4PA 1U1KA 1UMQA 2BW3A 2PLYA 3IWXA 1RUOA 1KS2A 3PCOB 3HRSA 2DPUA 5DLFA 3GFYA 5HDKA 1TWAJ 1X9WA 4UV8A 3VF0B 3TAQA 3FMRA 2R5YA 2X1CA 4R0EA 3ZMZA 5KFEA 1X1BA 1TKXB 1R27B 4DL7A 1D9FA 2F63A 3N05A 4XDCA 2ZJQQ 5EEAA 1HD0A 2O67A 4J9MA 2XB5A 1X4FA 2HBZB 4LIVA 2IA0A 1OCCH 2H5JB 4G1QB 1XR5A 2MFZA 3S8SA 3H90A 3PUBA 3JXOA 5KFHA 2IMWP 4O3SA 1UEUA 4XPEA 1O3QA 1X58A 4ENNA 1BGXT 4JP8A 3N9UC 2DJIA 1EARA 4J9UE 3OVAA 2XB0X 1ETVA 3HPGA 4ZDOA 2ZKZA 3FEZA 3BZCA 1ZM3A 1FBSA 2ZH1A 2JSPA 3UFCX 4R8UB 1YKWA 4JQFA 1WF1A 2CFXA 4JI8F 2DYSH 2R7DA 1MW7A 4X64J 4ZLNA 1VQLS 1ZQ3P 1SH3A 3PW5A 2R7RA 2YXLA 4URSA 3I32A 4YFXF 5F1JA 1TQMA 4ZTFA 2QJ3A 4C3HJ 3BDPA 3CO0P 4GDFA 4D0PA 2K9SA 1QVGR 6PAXA 1EA3A 2JVGA 1ZZFA 1FEHA 4O3QA 2CQHA 4NZ0A 3BPSP 1WI9A 1R43A 2BYVE 3UD5A 2RU9A 4ED2A 1SJ4P 1SQGA 4PEOA 2F4OB 4AVZA 4X66J 2HKEA 1CPZA 1R8AA 1N36J 3TP0A 3QZ8A 2OAZA 3U1MA 4ESJA 4USWA 1Q95G 2VOOA 3U1NA 2A1BA 4L72B 1MJBA 4DI6A 2WK4A 3AD7C 5FJ4A 5CVRA 4XNFA 5KG0A 3HVRA 1AFJA 2FZKB 3RB3A 1VQOS 3SYZA 5H9FK 2CUEA 4KGVB 5C2GA 4F0MA 2VG6B 1TV6A 2BW2A 4B3MF 5D3GA 1N54B 1JKRC 1SJ1A 1FO1A 4OIRF 4B3TF 4LF7F 5FKMA 3R6GB 4DNCA 3LA0A 2NQPA 3CIMA 1D9AA 4LF4F 4A8KA 3UVJB 1JNRB 3LFKA 3CLQA 4OL8A 3C2BA 1I94J 2H5EA 1P4WA 1S0VA 2ZH8A 1IRZA 1HDPA 4JI6F 1VFJA 2E1RA 4J7CA 4ICLB 1E6VB 2DPIA 2B0LA 4BHCA 3TR5A 5ETLA 1SJQA 3OTOJ 4PWDA 3JR9A 3CJ3A 1V5IB 5GADU 2YX4A 3PEHA 2ZOGA 3SQNA 2N3OA 1WOOA 3I96A 4IOCF 1UAAA 3NGDA 4RNMA 2DODA 4IOCQ 2H51B 4IHVA 2J5OA 3W64A 4YFUA 5KNLA 1FKPA 1DBDA 2VKDA 3W2VB 2Z2YB 3HJFA 2EC0A 2QLJB 3K5NA 4NA2A 2EILH 1BUXA 1HXDA 1Z4UA 5AIPA 3BBCA 3P4UB 3MMAB 5AE2A 3CJKB 4IQMA 3J81K 3KHLA 1QDUB 3BGFA 3FM5A 2MYFA 1N33F 1WQ2A 4EEYA 4AIHA 3WIUA 4V2GA 4Q4ZF 2HQDA 1VQMS 1KD1T 3AOCA 3D3CJ 5HN0A 1YW9A 1T3NA 1FWPA 1WKMA 1T95A 4WP9A 1OMSA 1NDLA 1D9DA 3HX9A 1A0OB 3D9BA 1XMQJ 3T5KA 2QQ8A 2OP5A 2OHDA 3JSPA 1X3ZB 5J4YA 1OLTA 1TL7A 1S48A 4II3A 3GZ6A 2L7MP 1HWIA 5KK1A 1RK8A 3VPRA 2M0GB 4WCGA 3LQQA 5FROA 5KFRA 5GVQA 2BHZA 2OI2A 2RQQA 3WX4A 2A6HF 1QLNA 1BBYA 3BQZA 3GTYX 3JREA 3Q5FA 4QWCA 2ELKA 1J2VA 3D4JA 2B9SA 1CGPA 2M5YA 3MPDA 4DBRA 1G4DA 1JX4A 4K5SA 4OI6A 1E3PA 2JUCA 4BQAA 4RX6A 1SL0A 4PXBA 3KIOA 2FRHA 1LEOA 1VK3A 2JL9A 1OIAA 2BHYA 3AY0A 2CMPA 3H5UA 1WELA 4IRCA 4IR9A 4G6QA 1RHJB 1MSEC 4Q43A 3D0IE 4EJOA 1B8IA 4I67A 3K5OA 1UPMB 4ESFA 5K8MA 2VJIA 4HX7A 2E1CA 3LWLA 4C6AA 4AE5A 4DSJA 1NPRA 2IVFB 3EWGA 1I50J 1Y39A 2DH8A 2HXOA 3KX2A 2VL1A 1K8AT 1X31C 1Y11A 4JI3J 4PG4A 1PJ5A 2FVRA 4X84A 2DO4A 5DM7Q 4M3DA 2XMKA 2PMUA 1T0FC 3BH7B 1FI4A 1NLKL 1NPKA 2XPUA 2ACMA 2MW8A 3HKZD 4X62F 3OIQA 2BV6A 3R1HA 4JX5A 4IH5A 4B9UA 4BY7J 2DDBA 5HMXA 1UVIA 2JEGA 3AFGA 2R7FA 1BE4A 1EV7A 4KMUX 1R31A 1V4RA 2G0JA 2YQ1A 2XULA 5F6FA 2GAGC 2VG5B 3KK3A 5FFXA 2IDLA 5JVTA 1TMMA 1MU2A 4A4JA 4Y2MA 2MZRA 2FJDB 3MFKA 2HHPA 4NXNJ 2OAUA 3MKLA 1Y0NA 2D1HA 4KKOB 1FKPB 2CJKA 2LCWA 4QIWD 5T7LB 3CJTB 4H4MB 4CH7A 1ACIA 4R0JA 2IXSA 2A3JA 3CCTA 3NCPA 4YIFA 4Y2AA 2ESHA 4FYWB 1OCRH 1QRYA 3BYRA 1P9QC 4I56A 3TQNA 4UVCA 3F44A 2W57A 5DO2A 4YR2A 3KYDB 3NWRA 1KZHA 5ETOA 4ZYDA 2KB2A 2C3OA 2KYZA 5DM6F 2YY3A 3DRXA 1MROB 1QVTA 4KQZA 1YO5C 1GT0C 1GXLA 3G8TA 1U6BA 2VQFJ 2KFDA 1N48A 2DHXA 1WF0A 3U21A 1B7FA 1C1CB 2E7VA 5HROB 4WBFA 3WGGA 5HBMB 2VB6A 1ZA1B 2CPFA 4XMYA 2W4SA 2VOPA 2VH7A 2RH3A 3GB0A 4I09A 1YJRA 1XN7A 1BQMA 1RKTA 4KJZA 4KT5C 5J47A 3TARA 1D1AA 1U1OA 3OXLA 1SD5A 2FD5A 3P3DA 1R0BG 3EUKL 2HMIA 1Y4ZB 1M90T 3W8GA 2XSFA 2LP0A 1U02A 1B72B 3QP6A 5HODA 1ZTWA 2RVJA 3EXYA 3EVOA 4KUMA 2FDNA 2JVRA 3NS7B 3TX0A 3AQPA 4P9FA 1XMBA 4RW8A 4CWBA 2JOQA 3RBDA 1WI8A 4QOTA 2UXDF 4PWDB 3D5SC 3H2LA 2MBFA 1ZS6A 1WPKA 3K5PA 3UDVA 2DIVA 1KTQA 1SFUA 1WZ2A 2KYXA 2BQRA 3HPHA 3CMEI 1HWUA 4WJBA 2OV7A 4D3GA 2ZNYA 4OI1A 2IBKA 3DKYA 3AD9C 2HNDA 3G96A 4NLXA 3GMGA 3EMTA 3CCSI 3JW4A 3DLBA 1BL0A 2D41A 2E5LF 4X0GA 3N01A 2B3TB 2HQNA 3UNYA 3HCXA 4Y2IA 2L01A 1S6OA 2KJWA 1VISA 3T1YF 2G7UA 3BQYA 1JNZB 5HANA 5E1XA 3EDQB 3ETMA 1IQTA 1VQPI 4IOBA 5BYQA 4DYQA 3IUOA 3LH2S 3CMQA 4UOHA 2QSHX 4YN3B 2XF6A 2MDAA 2ABYA 3GQCA 2QF7A 2ZBIA 4UB8C 2ZBRA 2IM1A 4FVMA 3DBLB 1CS4B 2QQAA 2RS8A 4EWTA 4IXAA 3PIPQ 3SCLE 4KO0B 4OIOF 1LW2A 1VIXA 4RMNA 5LSLA 5C24A 4B9TA 3NLCA 5LGUA 3PACA 3CVKA 4U0YA 3U1DA 4CLZA 5DG8A 3U9GA 5EJCA 3C2GA 1XGSA 3HOYJ 3N0VA 1BQMB 2O03A 3CCMS 3M7VA 5HJYA 4OZLA 1Q8KA 4G1IA 2R8KA 2VA2A 1REVA 4IVNA 1QAYA 1ZG1A 3W3SA 2DNHA 2DPDA 4NC6A 4R25A 1AUSL 4PKDB 3GJSB 2TDXA 5C25A 5LMUJ 5LMUF 2VBYA 2WAQN 4BHPA 2IBDA 3QT7A 5D6GA 2QBYA 1U4BA 5E3NA 2W9CA 1N5VA 4BQOA 2VE9A 1YIJI 5FRNA 3TZYA 2VC0A 2H8WA 5E8GA 1MMLA 1HC8A 4BACA 2EZLA 1ZZNA 3CJRB 1TFYA 3NGSA 4J9LA 4N56A 5AONA 2GOXB 2HZVA 1DHMA 4RBOA 4DV7J 5D8LB 3VZHA 3LWFA 1Z1DA 3RAXA 2KO1A 2XKPA 3MAAB 3MZHA 5BQTA 2IAIA 1NBEB 2AF6A 2YX1A 1NDKA 2M8EA 3GV7B 2EQRA 4RGXA 4JYAJ 1RWNB 3H0DA 2DGWA 1H38A 2HRUA 1RAOA 3LAKA 1KP6A 5H6QA 4EATA 3I0RA 5F64A 2DGSA 3W66A 3L95X 2QEXI 2KRCA 5A8WB 3S1NJ 2ALZA 2EK6A 4MK9A 2L3MA 2HAFA 2GXAA 4RO0A 4IRKA 3B6BA 2LNBA 3LPYA 2RSQA 5DQGA 1Z91A 3LW5C 2J76E 2OEKA 4QR0A 2ZWPA 5DZ6A 1K78A 1B59A 5DDGA 3UI3A 1S0OA 3H0GJ 1TWFJ 3S8PA 2AJ2A 4MK8A 1B9MA 5C24B 2AJ1A 3ZNUA 1U25A 3P5JA 1T02A 2MSSA 4B3XA 3S3OA 4DL6A 4CCHA 2EA4A 4YB7A 3CCQI 3CJQA 1IXRC 3R5DA 2ZH9A 3V6KA 5M5WJ 3KK1A 1WKLA 4XN0A 2NSBA 3V2UC 1REVB 2EBIA 2MSTA 1DP7P 2ZZMA 3KLHA 3RU0A 2RF2A 2CQCA 3DC2A 2H4WB 1XB4A 3U02A 1Y8QB 4LJZF 3SDEB 5KOWA 2MKIA 3TWZA 1TFWA 4FKXA 1NK9A 2HHXA 2HNDB 3HTUA 3J80U 4G7HF 4BWMA 3L7UA 3BR1A 3AAWB 2XWYA 2QA2A 2H09A 1J59A 5E3PA 3GCWP 4ILRA 5E2QA 4DG1A 1QTNB 1I39A 2UV1A 3WX8A 4OYZA 1WCMJ 3RQIA 2AGOA 1YSJA 4C7QA 4MK7A 2HURA 3QGHA 1OR7A 1LWCB 2YNFB 1XNRJ 3GYNA 2ZD1A 2QSGX 2OH2A 2XMWA 2VDHA 4RGRA 3RYPA 1QVFR 1O51A 1W5TA 1NK8A 1F0XA 2R8GA 2IM0A 3D54A 3DTIA 2B7BB 4PRFA 4I1TA 1NK4A 2C1EB 3R3TA 2NS1B 2K5CA 5IT9Y 2YWKA 3S2HJ 1OPCA 2JEJA 1WC1A 1WHUA 2BOAA 2ME6A 2QE5A 2WV1A 4N4NB 2GHWA 1MGTA 1FC3A 4MIMA 5KVRA 3NOGA 2HYFA 2BJ7A 4NXNF 2Q1ZB 1RT6A 4X2BA 2B8PA 5JLXA 3TA0A 2DO7A 2ZBKA 1LOUA 1HW5A 1FLIA 3DHWC 1F9EB 4DSFA 3NWSA 5C42B 1F5TA 2JFKA 4Z7CA 1H2TZ 4CCLA 2NOGA 1LWCA 2DK5A 2XRNA 3Q89A 1H88C 1TP7A 2JUGA 1SH0A 8AT1B 4ID5B 5FLXY 4A5NA 2XMTA 2XAJA 5I3QA 2JDJA 3F0NA 4UT4A 3FKIJ 2IMOA 2ZE2B 4Y00A 2Z2MA 4I2QB 3NQOA 4J5OA 1IGNA 3S1QJ 4XM3A 2JX2A 3I5BA 3PUFA 3HM5A 3T1HF 2OA4A 3ABLH 2FJ1A 3OR1C 2RD5C 1MH4A 4JV2A 1KU9A 5BYRA 2HK2A 2DNZA 1OMIA 2FBKA 4PCQA 2Z8QA 4LF9J 3L2VA 2RT3A 5AJ3F 5C44J 1TKDA 1RTHA 1FNOA 1XMOF 3M8FA 4HDVA 1UVJA 3FBNB 4U7UD 3K5MA 1ZR2A 1J5YA 4ZVUB 5EG0B 3ABMH 1RHQB 3VGVA 5DCMA 4WXDA 4XICA 1HHQA 1HNZF 1B6AA 4G6DA 4IZZA 1J7KA 3N4MA 1HBOA 4B44A 4RBTA 5SUHA 2OCCH 3ZTPA 2YPRA 4PPDA 4DPTA 3POTA 4L5EA 2HG4A 4HT5A 1P2FA 3BLYA 3CLOA 4DL5A 4DR4F 3O1LA 5HL7Q 1R23A 4IPAA 3D5MA 2E1PA 2R2TA 2KVQE 2A5WA 1NYNA 3S6EA 1G6NA 2HBRB 5FKKA 1NB2A 1S1UA 4CO0A 2DFEA 3E6CC 5J4VA 1RT2B 4GCVA 2NXNA 1SV5B 3KK3B 3W5YA 1NG7A 1K44A 1DUXC 4HT7A 4K4ZA 5K9FA 3C15B 2Z57B 1H2UX 1S7AA 1WJAA 5GMDA 5K14B 1D1UA 2QC3A 2MQQA 5GAGJ 2VKVA 2BQUA 1OJ4A 2QO3A 2OUMA 1RUSA 4KNYA 2XO7A 4DWIA 4ZCKA 4RUAA 1OY9A 3DLGB 3D5RC 2GVZB 3FGVA 2DHHA 5HS9A 2FGCA 1F36A 2QBYB 3HOVJ 3BCBA 1S9HA 1W0TA 2K3FA 3Q0UA 1KOOA 3FZVA 4MO7A 4J91A 4I0WA 3HFVA 5IT9K 4CLUA 2WCXA 3EPIA 4J9RA 3OYHA 5CVUA 4K59A 3CJRA 3LA3A 1NK2P 2NYXA 1IBKJ 5J2PB 4A3MJ 1G1XA 4CZCA 1VBYA 3GE9A 2X9DA 3RPUA 3Q2TC 1HNZJ 4H0EA 2HFUA 1H3DA 1TVRA 3U1KA 4H4KC 3RB0A 3K58A 4TV7A 3KMSA 3OJUA 2PMHA 3RAQA 1REPC 3IP0A 1Z67A 3DOKA 1LNQA 4Y2KA 4EYIB 5J1NA 4AD6A 3S7RA 3DDIA 5M3FJ 2FQ3A 3IBWA 4IO9F 1WG4A 1FJ7A 1V5FA 2PT0A 3KP4A 2AV5A 2V4JB 3KJQB 4DMZA 3GIKA 2HBQB 5DGBA 3QIPA 4TN2A 5J1YA 1Q86T 5KG4A 3QODA 4J9SA 2JK3A 4DUYF 1ZAWA 1JLQA 4PYDA 2AKWB 1FSHA 1OYWA 3RUBL 4PUOB 1R8CA 2RNGA 3VGSA 3G8QA 1JXEA 4KDPA 2DD8S 3V81A 1E6YA 2R4GA 2MQPA 2XPWA 3B6AA 5KOXA 1NUEA 1ETOA 4XOPA 2LFVA 1CF7A 4DYRA 4HL9A 4WKYA 3KLFB 2C22A 1VC0A 2BM0A 1SFKA 2CQXA 4QIVA 4TYAA 4QPQA 1JUPA 3E6DA 1VLOA 1NHVA 1ERDA 2DMNA 3CCZA 5CYQA 4ALZA 5CLSA 3C19A 2MKJA 2NVXJ 1ZRCA 3M07A 4L76A 2FUG9 4CYCA 3HOWJ 1FP2A 4KAIA 3DLJA 2ZMEA 3E0JB 1PUFB 3I64A 3O6BB 2XMJA 4L3NA 4CT9A 2M7BA 3ESWB 2HAIA 3VVTA 1RYSA 1H89C 4YP3A 4OYXA 5FB2A 1W7WA 2CPIA 4HLBA 3BPXA 2VV5A 1VRUB 4ZP9A 4HBLA 3G71I 3PFIA 1K1QA 4MQ9F 1KU3A 4C11B 4N0BA 2F40A 4YFKF 3TA1A 5FKLA 1U8WA 3CO7C 1BC6A 1FIPA 1WOPA 1KQ9A 4UOCA 2MZJA 3ZZTA 2YKOA 1FOXA 4HI1A 2GMLA 1NMEB 1KN6A 5EG0A 1T11A 2X4HA 2IPOB 1XNRF 4UVBA 1K79A 4ED7A 4RW8B 5KFSA 5J8FA 5EN1A 1BOBA 3DMJB 2UWMA 3CMYA 3E2EA 1HCRA 4HSRA 2A0FB 4WIQA 5KTQA 2AO9A 1TL8A 3AQOA 3GTKJ 1AOYA 4EYHB 4CCMA 5EEHA 1MD0A 4UB6C 1MBGA 1NDPA 5C2CA 3VAKA 1YE9A 2PI0A 2YVSA 1OY6A 3K1PA 5HBMA 2XNRA 2YSRA 3EM1A 2Z58B 4NLOA 1S77D 4FE7A 3KG1A 4R8HA 3RKWA 4YQWA 1R1UA 3QYBA 3KYLA 5B0DA 2C6YA 1RAGB 5L9XA 1TL4A 3JAMK 3QQCD 1BI0A 3DPUA 2ZITA 4ILMA 5LOQA 4ZP6A 3E5QA 3BZKA 3NWTA 4FBTA 2GLOA 3D0GE 3D66A 3K59A 1YBUA 2QN6B 2X3DA 3MEGA 1ROFA 3G87A 5HVHA 1LWFA 4UUTA 1V54H 2OMLA 2ZM6J 3LFUA 2CW0F 3ZQHA 3LQRA 5M2RA 4JI5J 2ZO4A 3VDXA 4LF1A 3WZ0A 4C3KA 3RCOA 4HHHA 4UXNA 5FLMJ 3FX3A 4A2UA 2WSCC 2UXCF 4RJVA 2VL8A 3M4OJ 5LL6d 3WTWC 2LMDA 4DLEA 1HF0A 5LRSA 4U9RA 3AG4H 2DXIA 4F4AA 1WORA 3GFHA 2JPCA 5I3UB 2W1BA 5CVJA 5KFIA 5D5VB 2C2MB 2BA9A 3GP9A 4ECWA 4ILLA 1F1BB 3KNAA 2B8QA 4DQ2A 1UVNA 4RM2A 4U67Q 1CULB 2OCEA 3E1SA 1CS4A 2C2DA 1XK8A 2F8MA 1F3VA 4KTQA 1BC7C 1VQ7I 4BYYA 3CJQB 3NGKA 3NS5A 3MR5A 1NKCA 1Y0UA 3I5AA 1ZGAA 3KP5A 1K0VA 4LG0A 1HBMB 3FK4A 3HGYA 5KFDA 3KLHB 1ULRA 1J5OA 4ZPVR 4JI6J 3R2DJ 5A2QY 4B9SA 2DR5A 1M5PC 4P72A 1WC3A 4DF8A 3ABKH 2Z9OA 2VFRA 3ROUA 3MEEB 3CIZA 3F3XA 1YBTA 3M9MB 1SANA 5HLHA 3CC2I 1XNQJ 4ZA1A 2KJVA 5F8IA 3REOA 3DGVA 5KT7A 3CMMA 3CC2S 1JLFA 4F50A 4DZPA 2W84A 5LEKA 4WX9A 2CPEA 1N8RT 2FOWA 3DOKB 1FSEA 3MEDB 2Y8YA 2A61A 2IA6A 4BBRJ 1WDTA 2QA1A 2HHVA 4RU9A 2JMWA 2O5DA 3AJ2A 2D1VA 3QPLA 3MHYA 2B7CB 5EHHA 2D1CA 4OOIA 2GGPA 4FF1A 1NJIT 3GFLA 3CMES 3CCRS 1B0PA 2EW9A 1KTVA 2EZIA 3EYIA 4NCBA 2DEJA 1HD1A 2QV6A 4GYIA 1RETA 4XIDA 3ELHA 1NJYA 3AOBA 3C14A 2DN0A 3MM6B 2LD5A 4FNHA 2UUBJ 3DU5A 3MQ0A 2AX0A 5I42A 4NLYA 5IV4A 5AXKA 2POKA 1VF9A 4CLWA 1OY8A 3G73A 5LHHA 3MPYA 3ZGKA 3NY0A 4TVAB 3ZQ7A 3OYKA 2XSJB 4MKAA 4DX5A 4X64F 3G3ZA 3D2WA 2DXDA 1QU3A 3CPWR 4BDPA 5LT5A 1T03B 4PR6A 2XF5A 3PW7A 1FKOA 4DV6J 5LSRA 1L5UA 2L9NA 2L41A 3S3NA 1VK8A 4U6PA 4C9DA 1NDCA 4HA8A 4DV0J 1TKZB 2MLZA 2GZOA 4RL1A 3H9GA 3C2HA 5K5RA 2VBZA 3QJJA 2BR0A 2LVWA 2VT2A 1DU6A 2V4QA 3MM7A 2CW8A 1RT5B 1T39A 1CJUA 3ISPA 4HYKA 4B17A 4BQNA 1VHFA 1XPXA 2YNGB 4N5SA 5KFUA 3Q0AA 2WA0A 1CSJA 4LFCJ 3KLIB 4FNIA 2CQIA 3MUTP 2FY8A 2ZC4A 2RRAA 4E98A 1N25A 2J5AA 1R22A 4IL6C 1F4KA 4ZVQB 1BW5A 1D0ZA 3ZQQA 4ED6A 2Q1LA 1X4HA 2BVZA 3ASNH 3D6FB 4EI2A 2ZKUA 5LFAA 2XROA 2NNNA 3PKMA 3PR5B 2V50A 3RPQA 3MWBA 3GR1A 4FTHA 3UN3A 2HNYB 1GMUA 1HOMA 3M9NB 2CNOB 1D3YA 3K2AA 1VRTA 2QT7A 3KLNA 1RE1B 3JRDA 3LSMA 2B9EA 3OFGA 3GJQB 4RW7A 2W2PP 4LQ9A 3H42A 3SDBA 3HL2A 4K2EA 2DTZA 3HDSA 3B54A 1RT3A 2RILA 3M2RB 3SEQA 4E7SA 4LRAA 2VJJA 1YRXA 1W2BR 1EF4A 2AGQA 2E44A 1IAWA 4A6DA 1DGWY 4PXEA 1NM2A 3QPIA 1HW2A 2OQGA 3DBRB 3DFGA 1HQEB 1BMQB 1JKHB 2GMHA 2FBIA 2Y8WA 2DU9A 5MLCV 4FHTA 2BKNA 3DM2A 2YKNB 3MM9B 2EJRA 1YITS 3TOBA 2RGVA 4FPRA 2J6TA 4K2XA 1IXCA 1RLDA 1O0PA 1TAQA 2DTRA 2WAFA 1X60A 2BBEA 1EETA 3R4KA 1MSWD 4P7TA 4CI0B 1RZ4A 4XQFA 5KT2A 5DV5A 3PV8A 3MWMA 2E66A 1EKEA 2YNFA 3CTRA 2L54A 2W9BB 5D4LA 1HWLA 1HI0P 1JLQB 3NAIA 1U9OA 4M3FA 2XGQA 2QSWA 2E1AA 4HI2A 2VJUA 5J40A 1YG2A 2XV4S 2QL5B 5E18F 5EUHA 3A01A 1SI9A 1ZLKA 3K1MA 1K6YA 4KYWA 4O44A 3BG3A 3IRQA 2UVVA 4ZLPA 4QW8A 2K7KA 3DKXA 1I3AA 4AL6A 3KEQA 2D7SA 1UAWA 3WHBA 1SJFA 4P9SA 5DQHA 3CF5Q 2BE7D 1VNDA 4L74A 2B4VA 3K4BA 2M0CA 4UUVA 2R5ZA 2HDCA 4DZ6A 2LVSA 2GVDA 1UVKA 2M4GA 1BQXA 2YU3A 1C0TB 2R8HA 4OYMA 3DTKA 1MDMA 4USTA 4WXOA 4DEZA 4QWQA 1FDAA 3LWMA 4HQMA 1TQLA 4PJ0C 2RHSB 4I7FA 1VR6A 4JV0A 5E17F 2GXGA 2J8AA 1TW2A 2BJ8A 2K2PA 1ZG5A 3DYAB 4OZNA 1CEZA 1GV2A 2PIIA 3SDEA 3R9LA 3IS9A 4RKUC 3OL7A 5F9NA 3CD7A 1RTZA 1STZA 4B9NA 4U8YA 2XBPA 1X5TA 3I56I 2HVQA 3C8YA 4MYUA 1GUUA 4HZFA 4OX9J 1TKZA 5K5MA 3BJ6A 1HQCA 4GKKF 1YIOA 1F43A 3HSGA 1BOAA 4I2PB 2Z1DA 1N77A 3PO3J 2BYCA 1RT2A 4X1EA 3GYHX 3PX0A 2KG0A 2IRUA 3TZWA 2IS6A 4KT6A 2JSXA 1Q7YT 3H3VK 2W2MP 4RR5A 5F8HA 3I4HX 1S6LA 2OBPA 3HHKA 5I3PA 2YNIB 5F9LA 3ADAC 1RHUB 3T8TA 4YB5A 3E5XA 4ECRA 3BQ2A 2HI3A 3OSGA 3M32A 3P9CA 2MJNA 1KRPA 3F56A 3V8KA 1LW0B 2ADBA 1GXQA 4CCOA 1YX3A 4ZPDA 3PY8A 4DJAA 4AL7A 1FYKA 2EH3A 3KJNB 4QIGA 1K61A 5THWA 3EGWB 3W1YC 2DVIA 1XGMA 4XN3A 4BS2A 3J7ZI 2PJPA 3DP7A 4B48A 1S4FA 1T9YA 3B4MA 2LQBA 2CUJA 2K40A 3W65A 1S9GA 3OUYB 1OFCX 3KKFA 3OFEA 4S0HB 5GAHJ 4LFCF 4B3TJ 4LF7J 3PRBA 3RB4A 1RT7A 3SV4A 3CC4S 3PYEA 3HMJG 1RAAB 4K4SA 2CJYB 4CO1A 2JRSA 3OYAA 4ID5A 1T6SA 2VQEF 1Q7LB 3GSDA 2PGCA 2XY7A 2C2EA 2VG7A 4ZK7M 2OPSA 3H0PA 1X2MA 2G0CA 5GTIC 4CTAA 3GR0A 5GMKa 2FC9A 5CQEA 4RGSA 2YKMB 5BJRA 2BJ3A 4LRDA 2DMTA 1LVAA 4M3EA 5FLXZ 1XBWA 2V94A 2E5IA 1NKEA 3MI7X 5ETSA 3WTXC 1YFHA 5DZ7A 5GAEJ 4RW4A 3ZZZA 4QPXA 2J9DE 1Z21A 3ZZOA 1R5HA 3I9V2 1HYSB 2AGPA 3PJWA 3DI6A 4QCLA 2QTWA 3KJVA 3QZ7A 3R5JB 4USUA 2KIUA 2A69F 5E7OB 1PILA 3J7Z5 1KHWA 1EH8A 2R7WA 1VQ7S 3D28A 4MMOA 1S1XB 3TAMA 1ZRDA 2JZYA 3SXYA 3W60A 5F0FA 3FBCA 2UUBF 1XX5A 3SZ2A 4NLQA 4OZ1A 3LP1A 3S1MJ 3HSRA 2DW4A 4LIUA 4NQWB 2M3AA 2D5VA 1BHNA 2IGOA 3CJ4A 5L3GA 2XMMA 3CXCR 1OPZA 2IGKA 1LWEB 2KI2A 1K9MT 1S1TA 1X1DA 1U7LA 1TAUA 4MTPA 1FYLA 1VQYA 4FDFA 3PNTA 2C2OB 3GSIA 2O0YA 2GJFA 1VRQC 3ELKA 1GDTA 1Q5VA 2C2RA 1FX7A 3L4BC 4XAKA 2HVIA 4N41A 2XZTB 3P9IA 3DDNA 1WJ9A 1U1PA 3BO4A 1QSSA 1YITI 1IRXA 1R00A 5DUIA 2R2SA 3Q9SA 2Q79A 1FPQA 2PA3A 5J6XA 2KMUA 5KT3A 4ZPCA 4FXVA 3OR2B 3C18A 3DLGA 3IBFB 2ADUA 2ZHAA 4XKVA 1TC3C 3IR6B 1ZHFA 4LG3A 1LQ1A 2WVFA 4MKBA 2ZJRQ 5FD1A 4PZJA 1S72I 4WE1B 5CHCB 2ZXWH 3TL4X 2FLPA 4LF9F 3ZZ0A 4URQU 1SVDA 2CUZA 4G3IA 2K02A 4IX7A 4NRTA 5D5UB 3NGRA 3PL8A 2LF8A 5FJ8J 1T9XA 2BXJA 1ZAOA 4B9LA 1ETQA 1ETWA 3ZO7A 2A2DA 2XLKA 3CWJA 2CPDA 4CH0S 1QO0D 4C2MA 4IF4A 1U24A 2LYVA 1SAUA 3THPA 3W8PA 5HLIA 1XSXA 4O3NA 5IT3A 3PIOQ 1S79A 1SD4A 1SD6A 2K7LA 2AJQA 1FVQA 2E34A 3LMMA 1W5SA 2EI5A 3M32B 1MBHA 1DTTA 4ZVEA 5G0RB 1TR0A 4NX9A 3RJPA 4CCJA 2CZVC 1I1GA 2VKHA 4OV1A 2O7OA 3M2VA 3PX6A 3MM5A 1HFEL 3M1VB 1U0HA 2JA2A 3L2UA 3WTUC 2FSWA 2UXCJ 1T9WA 5LGTA 3KG0A 5F1RA 1HI1A 1W0UA 1RSCA 1A35A 2EWHA 2KXNB 1RACB 4P55A 4UNOA 4F7VA 4LBPA 3ULHA 2AHOB 4QYZK 3GTLJ 2Q66A 1KQ8A 3BG6A 2ZXJA 3EXCX 2P9EA 3LGHA 1WJDA 2RAQA 1K1SA 5JVGQ 1WOSA 4KH0B 3CB4A 1KBRA 1T98A 3F0CA 2XGPA 2VPZB 2X7IA 2GXBA 5A6PA 4V19K 3U7JA 3LSGA 3HP6A 3F8CA 2DGVA 3GILA 2JZ5A 3I0RB 3L7WA 1TLHB 1KOHA 3FCWA 4HDGA 3TX8A 4XLAA 5B5EC 4AIJA 2Y0BB 2CQ7A 1SV5A 5L1KA 3ABTA 2BVLA 4CM0A 3PNIA 2GW8A 4EGLA 4M6VA 4X4QA 2KG1A 4N8NA 3NMRA 4OX7A 1F5CA 5LMNF 3CD0A 1R5GA 3BROA 2F6CA 2M9HA 1M5OC 2XMUA 3CCLS 3W63A 4FP9A 3WE3A 1RT6B 1W36D 1PBUA 3OR2C 1POGA 5D0RA 3QIPB 4LSLA 2QYCA 2CRLA 2V9PA 1FERA 4CM2A 4NHJA 1CJVB 2W9CB 1R9TJ 2UUAJ 5C7PA 1QE1A 1FNNA 2M88A 5HSPA 2VJ4A 1YJTA 3ZOBA 3VV2B 2L2OA 4CDIA 1FRMA 4C0OC 2DDAA 1Y56A 3WGHA 3E3VA 1G3OA 4DFPA 3KLOA 1UFKA 1ZBTA 2IS2A 4AUXA 1MU2B 3M6XA 3LSKA 2HWTA 2QL9B 4DPYA 2EINH 1GAOA 4CNYA 1EP4A 3I53A 2MABA 2HVZA 4F3MA 1WEXA 1DTTB 4U87A 3UW1A 2I9SA 4CO2A 1OCZH 2OEJA 4PXCA 1S0MA 3S93A 1RT1A 3IKTA 3CC4I 5IP6A 2XI3A 4MT1A 2R93J 3MPVA 2E71A 4OZ2A 3FRZA 1A6IA 5IM0A 3M4XA 2UU9F 5L3CA 5HVFA 5DD4A 2LEAA 1YYVA 3J81j 1JT0A 1E2XA 5E3CA 3VYSB 2V67A 4EEFG 3TI0A 4ZVGA 3V7RA 2CQDA 4XR6A 3EUNA 1U1LA 2ZZNA 2L3DA 2HEKA 4J37A 1HNIB 2QZ8A 2PC6A 2DNPA 4M6XA 2GO9A 1RB0A 2OZUA 1JLBB 2G13A 3HOSA 4DR7J 3G1OA 2M8DB 5EGOA 1D1CA 5D8KB 4DV3J 5ICFA 5IOZA 4BL0B 4DV7F 4NUBA 4HOBA 3BTLA 3R2CJ 4ER8A 2QG9B 3HHEA 4YR0A 4OWRB 2V8PA 3Q22A 1A04A 5K1YA 1EAYC 2HMIB 2LXFA 3I5UA 2GHVC 4IDKB 4X65J 2FMYA 3I0TA 2MMYA 2CS3A 3EYYA 4J19A 4BDYA 1XNQF 1UKUA 1Z6TA 1OQ3A 3SEZA 2F5VA 5A2QZ 1WI3A 4BE1A 1RXOB 2IPQX 1KVIA 1GNKA 4RWXA 2H1YA 4NLUA 4NXMF 4C8LA 3J81Z 4WZMA 2W8LA 4A0XA 4RAGA 3FMWA 1YZ7A 3PR4A 3HHDA 3DOMB 4RB2C 1JHHA 3HVAA 4XLPF 3A3PB 1Z6RA 2ZNZA 1IC8A 2I0XA 2K9MA 2E19A 2BANA 3K2ZA 4ZCLA 2P4WA 1LQ9A 2WY7Q 2VKEA 2DNKA 2ZUAA 3ZXWA 2C3MA 4H4KA 1DLOA 4LG0B 1HBMA 3HSFA 3K69A 1N32F 2BMBA 3GIIA 2KLOA 1YI2S 5DDOC 5JFRA 3B73A 3DRPB 1I5ZA 1W36C 3HSJA 3CCRI 4ZVOB 1FJGJ 4XSZF 4X6AJ 1CC7A 2VASA 4PJMA 1I51B 3MR3A 1S72S 3IAM9 3I9V9 1TK0A 2NXEA 3NXZA 3GO5A 3V8LA 2AIRB 2V1XA 3QFHA 2VLAA 1GQEA 2ESNA 3IC1A 1UFWA 3QLHA 3BJOA 4DX7A 2DNGA 1AKHB 3GF2A 3L2WA 2A6OA 1UG2A 1DPUA 5J2QA 3MAAA 3I0SB 2EVZA 1EZZB 2HNZA 1X5PA 2AD9A 4CLFA 2N4DA 3T1YJ 2CQBA 3QGGA 1KYWA 2ZM6F 3CDHA 2HS3A 3DLEB 2DEIA 2E5LJ 2VQLA 2PO4A 4QYRA 4CSWA 4O5VA 2STWA 4AM3A 3C3LA 3JRIA 2IFXA 4ED5A 3NARA 4LVOP 1ZTRA 3MKWB 3Q3SA 3QSYB 2DOAA 1W7PB 1UEVA 5DEQA 3SZTA 2LOOA 4CGZA 2HVDA 3W5ZA 2ID3A 4FXDA 1F6TA 4HF0A 4RW6A 2P7CB 3OXFA 2HDWA 4HLYA 4RB1A 3HKWA 2XB2D 4A3EJ 4QWDA 4F3QA 4J9OA 3G9CA 3I55S 3BN4A 4O4GA 4CIOA 3MPUB 3O3LA 1FXRA 3MM8A 2ZHBA 1SKUB 3O8GA 3K7AJ 1N4LA 1WJCA 4WFBQ 1FNMA 2O6GE 4Q47A 2OPQB 1N6QA 2AU0A 4BHBA 2R5YB 1Q1HA 5KFZA 3VCDA 3VGTA 3V4MA 5K20B 2FLNA 1RTJB 2HPMA 2EKYA 2XYHB 3L2CA 3MMBB 3MAQA 1S6PB 2O61A 1TZLA 4I7HA 3ZCOA 2MC3A 1OSCA 4OHYA 3WTVC 1QAJA 2JWNA 3SCJE 5ILVA 4IDKA 1MBKA 1XC5A 2VJVA 2B9YA 2EV6A 1TNTA 3VODA 4DSKA 3H92A 3MAJA 1JKPC 1B4SA 3QRPA 1GXPA 4DV4F 3PO4A 4XLHA 3VAHA 3EVWA 3BH6B 2BACA 2P0WA 3ULQB 2FLLA 2DB1A 2IW5A 2AZ3A 3R5GA 2XMAA 2KFYA 1U78A 5L1IA 1RCOB 1PUEE 3ERED 4XRMA 1ZELA 3DI6B 4M5MA 2HGMA 4OYOA 2W7NA 2WSEC 2L7ZA 2FVSA 1VCTA 4FX0A 2VE8A 1RT1B 3DRSB 1U1MA 1C0WA 5ETVA 4C2TA 4TLQA 2OTJI 1IG7A 2UVRA 4LBIA 2UZAA 4O3MA 4QR2A 3WC2A 3MMBA 2XVCA 2PEBA 1QVUA 8ATCB 1X19A 2DYRH 2XRLA 4IHTA 1S7IA 1QJHA 4X4RA 4I0BA 1GMWD 3KZIC 3T41A 1TL1B 4ZMMA 5IFMA 2IGNA 4WXCA 4OHWA 2JEIA 3FXQA 3ERMA 4O4RA 3HPOA 1NSAA 1GH8A 1WHYA 3K0JA 3R5BA 1NG6A 1MJAA 4DR6J 1UFLA 5KFVA 4XSXF 3HDDA 2RU3A 2PMZD 2E2HJ 3K57A 3BDEA 1ZG3A 1Q8LA 3R7SB 3TP2A 2V8DA 5DETA 2CJQA 4ES2A 1ZGWA 4EJTA 3MPWA 4ZVRB 2U1AA 3ILJA 3CF5F 2EG2A 4HG2A 1SC4B 2RKIA 3WE2A 4DN9A 2MD5A 3ZXSA 1MDMB 2QIFA 4IG3B 3FBEA 2LREA 4RNNA 3UCZP 1LEAA 1PYSB 1PKUA 3KHHA 4K4YA 6FDRA 2Y0SN 4E4HA 4ZKAA 1RQ0A 3A4TA 3T8RA 2YKAA 2QQBA 4Y0FA 2MZ1A 4OZ5A 2NREA 1UZDA 2MQNA 3NNAA 3H25A 3VAIA 3HKZA 4C3JJ 1RAIB 2EFNA 2K9LA 3CW2C 4OFZA 3L9FA 5JI6A 2OEMA 1IR0A 2BDPA 2G0EA 1R36A 3MECB 4O0NA 2QVOA 2JVOA 4OIQF 3FMBA 3BOQA 1MN7A 1MNDA 2R7SA 2FEZA 4NLSA 1XTZA 2FJVA 2E1OA 4BHQA 3I56S 3QWPA 1WHWA 4MIWA 1U2RA 4M3GA 1IJWC 5LHGA 2CADA 1WH5A 4DS5A 1R1VA 5KG2A 1YLFA 1F60B 3Q0VA 3SQGA 2M3DA 1SUQA 3PM9A 3PW4A 4EJUA 4XORA 1IW7F 5AXLA 4L73A 1N33J 2XIGA 4ZPAA 1TT0A 4UY85 4ZJZA 4DPOA 4P96A 1QSYA 2ZDPA 2XAGA 4IHWA 2JNJA 3NOCA 1OCOH 4WU2A 2TRTA 1P6TA 3QWUA 1D0XA 1Y3JA 3DMJA 4AQYF 2UVWA 1JWWA 2H5IB 1LWEA 1U6FA 1FESA 1L3VA 2UZKA 5B66C 2JH3A 2R7VA 3OVSA 2BY0A 1TKXA 3LAPA 3NGTA 3WTSC 2XSDC 5AJ3J 2WAEA 3S2WA 1X1AA 1BN5A 2I5JB 1RHRB 2PFDA 1D8JA 2AQEA 2WWYA 5CYVA 1I94F 2CVEA 2GGPB 1R5ID 2EFGA 1RISA 1B0TA 5HLFB 4LF4J 3IA0A 1W26A 1GTHA 1P1LA 1YJVA 5FDLB 3KK2B 1G59A 4BJ5C 4ED1A 1IN6A 3UDCA 1B9NA 5D4PA 1BIAA 1Y5LB 4LBHA 3HM9A 3Q24A 1S76D 1YS6A 2C2KB 4Q5VA 2PI5A 4HEA2 1HLVA 5IC6B 5HLFA 3M8QB 3PXGa 4XKBA 3DLLF 3Q8VA 3I59A 2B63J 3MEEA 3KK1B 3LA7A 2HVEA 3TQEA 4C8OA 1WJEA 2MEWA 4CQ1A 2Q6BA 2L4MA 3N5BA 1OWXA 3PYGA 2Y0SD 2XTJP 2Z5UA 2CV0A 3JSMA 4KITB 1BI2A 2FBHA 3H3UA 2Y0SA 3K4MA 1SVLA 1X0PA 2MA3A 2FUG2 1O4XA 2HQCA 3A8IA 1H0MA 2WHOA 1A5JA 2W4CA 4KHRA 2R2UA 5IYDJ 5EZGA 4DV2J 3HHLD 4Q0BB 3MDFA 3HD1A 5KG7A 3ZQLA 4C3MA 1SIWB 2RNEA 5F0CA 4KKOA 2DJNA 3GU0A 5ILSA 2JFDA 3IV5A 4PFPA 2PDAA 2FU4A 4ECXA 4YIRX 1ZAVA 2A3SA 5L1LA 3BBBA 4F04B 1MNEA 4ECVA 3OYBA 1XTAA 3M8QA 3C66A 4DN0A 5DUKA 2XC7A 2VQHA 3I71A 1NCLA 5K14A 2K3KA 3RPUD 1PYTA 2RDIA 1TL1A 2GIQA 4GO7X 3TVYA 1JJCB 1WHXA 1IKYA 4HRIA 1FEEA 2WAQD 1QPMA 2WZ1A 3S14J 4RW9A 2WAQA 4MIAA 2RREA 4WWSA 1RT7B 4OQJA 1PVEA 2F5FA 4F93B 2EBGA 4E7IA 5LEJA 1SC3B 4ZDLA 2R3VA 3CJ2A 2XI2A 1C1BB 5F8GA 2VA3A 3UCUP 1FWZA 3HT0A 1OCTC 1U0JA 4DV5J 5SZTA 1TWCJ 1R7JA 1YK9A 2HPIA 5JXSA 1PSDA 1R0CB 2E5HA 4HAMA 5HS7A 3DLLQ 3W61A 4HTJA 1YJUA 1RU1A 2L08A 1R0AA 1T0FA 2W00A 2LBFA 3R7NB 1Q8IA 5CD4H 4UQGA 2E9TA 3H1CA 4C30A 1T38A 5GAHU 3T5LA 1UELB 5EZHA 1X4EA 2GJ2A 1ITPA 1ZREA 2GA1A 3WTTC 1JXVA 3WTZA 3LSHA 3GV8B 3R0AA 5LD2C 4DUTA 2CNKB 3M2UB 1UETA 5C4JJ 2R42A 3BP8A 4BDZA 4I6AA 3FQKA 3D68A 4FX4A 1OQ6A 1X5OA 5M2PA 2EKNA 4N4OB 2M7SA 2EFVA 5K7HA 2BZTA 4P10A 2R92J 1NPPA 4CZZA 1D1BA 1JKOC 1YG0A 2Y69H 3HHLC 4L0YB 1U09A 1R7IA 2QYGA 1D8KA 4WF2A 1RPWA 1KQSR 1HSTA 4PG5A 4UTGA 2FJAB 2M70A 4OLOA 3IGVA 4ENKA 1YJ7A 3SJMA 2DT5A 4X62J 3QATA 3BO2A 4JK1X 2NAZA 1LXNA 3UN5A 4PJNA 3NAUA 2HS4A 4IFYB 1FK9A 2CQ1A 5KFWA 4FYXB 2DR8A 5AT1B 5RUBA 1N56A 3SYTA 4EBDA 4A8QA 2BEOA 1IKXA 5AE3A 3THTA 4JYKA 3CCLI 2R8IA 1FYMA 2DI3A 5H1SV 5BOXA 3MOJB 3PRDA 2DAOA 3C6TB 1TBXA 1I3QJ 3CDBA 1FK9B 5CD4A 2CZ4A 2ROGA 3DXBA 1NK0A 3H59A 5J1PA 3IWFA 3LSIA 2YKQA 3RKXA 2AJ0A 2J7KA 4HACB 1LWFB 3EDRB 1ULYA 2NVTJ 4IG0B 1H98A 2BE2B 1RUNA 3ZMTA 3NEKA 3VTIA 4EZ6A 1VQ9I 3K89A 3BKTA 3OOUA 1RCXB 1RKIA 1CQNA 2Z30B 1WSRA 4DSEA 1QD1A 1P1TA 1Z3XA 3CO6C 2DK2A 1CQMA 3DRRA 2DNRA 5D3GB 4F67A 1XSVA 1KFSA 3OV7A 3BBFA 3V7SA 5MAOA 1SUQB 1QTMA 2V1UA 4DFKA 1S12A 1VC5A 3VAFA 1U49A 4CYUA 3OSNA 3OTCA 4ELTA 2EV0A 2B51A 3FXMA 5F3TA 4H54A 4IG3A 1BD6A 2DNMA 3OYFA 3T9NA 1I6JA 2NUHA 1DAXA 2JSCA 2RDDA 1SFXA 4OJHA 2ALYB 4RLFA 2ILYA 3OL3A 3G1MA 2ELHA 4QWEA 4C48A 4IHSA 1U5TB 4WCEQ 5KG3A 4USMA 1HNXJ 4ASNA 1Z7UA 3S1TA 1DZ5A 3AFHA 3DEWA 2AEJA 3ASOH 5B0GA 3HHLB 3OLBA 1TKTA 4UQTA 2P5KA 2PFFB 3E7LA 2XF7A 1S9GB 5H2FC 2V9WA 1I27A 2GAHC 4RW4B 2PD1A 2CV2A 9RUBA 3V8JA 3RZDJ 5BPDA 2FQQB 2Q43A 4ZPWR 5HROA 1NH3A 3HRTA 4FN5A 4NASA 1RHKB 4U7BA 3TO9A 1JGSA 3ZZPA 3GUDA 3D6HB 1N75A 3BG9A 1RT4A 1YHQI 1MG7A 1FRXA 4JI4J 1TU0B 1HNWF 1BWEA 1KC8T 3OOPA 2UUCJ 3M8JA 4GC6A 3KWMA 5BXIA 4NLWA 1ETYA 3GFIA 3CDIA 3JSYA 1LKZA 4BEHB 1ZPVA 2GBYA 5KAFC 3ZZRA 2JC0A 3MTJA 2KL8A 4B3MJ 3AJDA 4BKXA 2MJUA 4F52A 4P2FA 1K4TA 2L9DA 3GJTB 1F2GA 2C3YA 5CVIA 4UOFA 4YMEA 3FM3A 1ZARA 1PAEX 2WV0A 4K4UA 1ON2A 3GFZA 3DKDA 1V5GA 2DGTA 3TBIA 4CO4A 2DLLA 3OSFA 2WY8Q 1FWKA 4NI2B 4K4XA 4E70A 2HLTA 4NRUA 3TEHB 2K27A 2NPFA 5DDPC 5FO5A 4LK0F 2O1PA 1EQMA 1Z7LA 1R8HA 3ZPLA 3MZ8A 2I38A 1XGOA 3W62A 2I5JA 4F02A 3T3FA 5HLGA 5L3EA 3HSEA 1J5OB 2IAJA 2LG4A 3OXGA 1JB0C 3HFKA 1J2XA 2MC4A 4ZPBA 2GVZA 3K4NA 1VQKI 5E3MA 2LF7A 1HBXG 3CC7I 1Q8BA 2ZEJA 2Z2ZA 2MQOA 3OL8A 4CLYA 1FWLA 4PYAA 3J7A1 4IOAQ 4DCOB 4QBUA 4LF8J 4DW6A 1IDZA 4DSIA 1CF7B 1WSVA 1JUMA 5TISC 1RR8C 2W85A 2QGFB 3LQVA 5HMWA 2GCFA 3GMEA 4OMFG 2H9ZA 4KIAA 1R89A 2GX8A 3H5AA 1MWZA 4AXJA 3BWGA 4EJWA 2OPQA 2PQ8A 3UDEA 2CJXB 1YZ6A 2BE2A 3G6XA 4NWBA 3C16A 2X6WA 4IFVA 4OI0A 4OLPA 2HFHA 1YJ9I 3I55I 2AJFE 4DYCA 2DYAA 2XGXA 4U95A 3J7YI 3TQ1A 4C0BA 1YJ9S 2DFIA 2LU1A 2OIHA 3VQSA 2K06A 4ZJQA 3MUMP 3RW6A 4HLXA 1RTDB 3HTSB 5I3UA 1O7LA 1XERA 2H3EB 1O3RA 2YBVA 2YKPA 1XCBA 2DNYA 2OD5A 4L75A 4ICLA 2DHGA 5FDLA 5DCMB 3D67A 4F36A 1R8PA 1T05B 2CNLB 5E3LA 4LSNA 1MWYA 3Q83A 4O3RA 3G82A 1U26A 4RW7B 4A3LJ 3RDIA 3VALA 3F8FA 1MBEA 3W2AA 4LQ3A 2DNQA 5LLQA 1SFOJ 2L9VA 3RGIA 4RLEA 4W1UA 4BC9A 3GZNB 3BZQA 5HLTA 1VQ8I 4B3SF 3VVUA 5H9EK 1S10A 3LUYA 2RKHA 4AIDA 4UUSA 3FMSA 3LP0A 3BTJA 4LLNA 4Y52J 4DLGA 2GA7A 2W8KA 4DQQA 4M8LA 2RE1A 4CICA 4G6VB 4CO8A 1BJAA 2VPLA 1WVRA 2G0IA 4E7JA 2XAQA 2CW7A 1V55H 2Z2LA 2G2OA 3DHXA 4FF2A 2COLA 1RBAA 4URGA 2E1NA 1BWVA 3PFEA 2IP2A 3OS1A 2HRTA 4WFAQ 3ZTRA 1ETXA 1FCAA 2NCKL 2NS7A 1C4CA 2BY1A 4Z7YA 5HATA 4BAYA 5HOOA 3FK7A 1CG2A 3K4JA 2FHMA 2WOMA 1RABB 2XY5A 3OSPA 3CJKA 2HLUA 1FBQA 2CJ9A 5TGTA 4CLKA 3QFWA 5F0UA 4CLPA 2H48B 3ETOA 4USHA 4YEJA 2CJBA 4JOUA 3JRFA 4OV6A 2A07F 2DRDA 1AXQA 2HIYA 3H2VE 1VRUA 1NB7A 2RIJA 4I76A 3NS6A 3IAS9 4QR1A 3PG9A 2DBBA 1AYEA 4LFBJ 1WWHA 4EUVA 1WRJA 5EYRA 4DL3A 5K7ZA 3E5UA 3B02A 2HOSA 2F5GA 1TWHJ 3GTGJ 3FBIB 1QY7A 3CJ8A 1SL1A 2ZXIA 3TO6A 2JRMA 5DM7F 1S1XA 3LNQA 1UHWA 2FTRA 5ITHA 3MMJA 4OYWA 2HFNA 2CYYA 3QOEA 2NYHA 1T03A 5H6RA 4ZHRB 1VBKA 2DGQA 3H20A 3Q8QB 2PX9A 3HO1A 2OFGX 1MMGA 3IKVA 4HDHA 1JI8A 4WXWA 4FF3A 1IZ1A 1M5KC 9ANTA 1BR2A 1FRJA 2AWZA 2F5EA 1JT6A 5DYMA 3V81B 2HRYA 2RDJA 4X66F 2MD0A 2KRFA 4MHGA 4F4KA 4DV6F 4UOGA 5KFQA 2MLKA 2KT2A 2OSQA 3GTPJ 2HWHA 2HQFA 3HHNB 4KR0B 1S5LC 4Y33A 3HIFA 4LFUA 5IT0A 1RTIB 3FDYA 2N7YA 5GPAA 3DCFA 2NVYJ 1T8IA 3KHGA 2KFZA 3HYIA 3E01A 2XCAA 5IT9U 4NMLA 4Q2LA 1MMNA 2G4BA 4IFVB 1ZGJA 2V2QA 3Q9VA 3C6UA 1J5EJ 3D0SA 3M3YJ 2UXXA 2KTQA 2HVHA 4J9PA 4F91B 2X6OA 2OC6A 2CUYA 2V9VA 3DWLE 2BXZA 4XKWA 3PQJA 3UKGA 2VUGA 1OISA 3H4DA 3JB9k 3K7RA 1EIYB 3H9JA 5GAGU 1NK7A 4GVBB 2UUWA 6AT1B 4W90B 1MIJA 3WG7H 2CQ4A 2AYEA 2ISZA 4I2QA 5M2UA 3PYFA 4ZOSA 1OKRA 4ZYAA 3SCIE 2A6EF 4A3IJ 4YB6A 3GFJA 1QM9A 3DFEA 4I6WA 1A36A 5A0YB 5D8HB 2Z33A 1K7AA 4RNHA 4MFBB 4AL5A 4Y2CA 2UP1A 2CA9A 5L1JA 2X51A 2E5NA 2I6WA 3F6VA 1XSDA 1I3OB 4M72A 2XDVA 1V3SA 2CDRB 4IEJA 1S7OA 1CC8A 3KLEA 3GCMA 4I99C 1HARA 4LSLB 3BDDA 1SAXA 3HXLA 5CH7B 2BW7A 5ETRA 4CCKA 2NXNB 1IKWA 3HI9A 1JXLA 1KHVA 1RIOH 2V34A 4QW9A 4ID8A 2F8EX 3FSYA 2XHCA 2RHQB 4KH1B 2LLZA 3HG9A 3MZYA 3UDLA 4P5OA 1SCJB 3I4NJ 2Q0OA 2XPVA 3KLGA 4AFFA 4HW0A 1HW8A 4E7ZA 4MYTA 5HI7A 4DV1J 2ZMEC 4A8FA 1G2EA 5D78A 3MGJA 2HHQA 2HYGD 3T19A 3ZR8X 2LEBA 1QZYA 2CXEA 3E01B 3VYUB 3SDGA 3G4SS 3D5LA 1A31A 3OL9A 4DJBA 1IM6A 2BGCA 3VEPA 1MBFA 1JJ2R 2WVBA 3ITHB 4RAFA 4EBEA 3H35A 2R5ZB 4W97A 1CJTB 2W4PA 1LV5A 4LRBA 4OAZA 4ITVA 4PSXA 4K7QA 2MGZA 3SFUA 3GIRA 4LF6F 3E3XA 2X1EA 4JI5F 4A8WA 3TRGA 4B43A 1UZCA 1HR0J 3N6NA 1Z1ZA 2PI4A 3TZZA 3HHLA 4UY8T 2QRRA 4FETA 4BE2A 1U0HB 2VQCA 4ZTJA 4ZHRA 1UL3A 3QLHB 3Q8SB 5L3DA 4Y17A 4EGZA 4F2SA 4R8UA 4E8UA 1RR7A 2CQ0A 1X2NA 4ETSA 3P5TL 3N79A 3LSPA 1X4AA 1NXIA 1JQGA 3D6TB 3KUHA 3GG1A 5KFMA 5KAIC 2G2ZA 1XMKA 1B72A 2E7WA 5I4MA 2YUSA 1IKVA 2WW4A 1GT8A 3H98A 1SXLA 1KFDA 2APOA 4WFZA 4WP3A 5K5QA 1BLUA 4KA4A 1HPZB 4ZLJA 1XJWB 2VFVA 4ELVA 1FMVA 4ELUA 2K3IA 4RLQA 3A2KA 1B99A 1SC1B 1HWKA 4XPCA 2FMLA 3L2QA 1HQEA 2P8TA 3CUOA 2P5VA 2N8GA 1R0AB 5EDWA 5C42A 1L3SA 1RT5A 1I1SA 3OYEA 2W82A 2GV1A 4ZP7A 3VGUA 2P5LC 5D0EA 3KEOA 3PJXA 3M8YA 4NZ7A 5ETQA 3C1DA 3CCEI 2M0MA 1JGGA 1RWOB 1BY9A 3BPVA 1RWVB 5B08A 3TW6A 1F2HA 2JA8J 2E36A 5IS2A 3BG5A 2JRTA 3M8RA 3LF0A 1BI1A 2V1NA 5CABA 5LXYA 1G3YA 1KLNA 4BE0A 1RAEB 1YJWS 1APSA 2MLXA 5E79C 4WYWA 4Q45A 2WONB 2DQLA 4FYDA 3KE2A 1MJ9A 2DQRA 4UUXA 2XM3A 2PJRB 1GX6A 4NPOA 5L9NA 2XZWA 3O5TB 3W9HA 3IRRA 2VPXB 4Q48A 3BZ6A 3UO0A 3GTQJ 3PO2J 1GHCA 4X4VA 1FRKA 2LSOA 2W01A 2M34A 4PSWA 2XLJA 3CCUI 2C3PA 1R49A 4Z6YA 1IUFA 3MAHA 2QSFX 1QAXA 1N5QA 1DLOB 2P7VB 1JJ8C 1W25A 3FXRA 2ZC2A 3J7AN 3PFYA 3LSTA 1Z0XA 2FYXA 5DM6Q 3PSIA 4FE4A 2EZHA 3G71S 4CYCB 1JLGA 2GWRA 2QKMB 3RBEA 1RGVA 4DR3F 2O3DA 2EG1A 2ZUGA 1VGYA 3H5YA 2Z2SB 2WVCA 4ZYHA 1NH7A 3H5SA 4KO0A 3DPTA 3K4KA 3EX7B 2DY9A 4DUYJ 4CO5A 4IO1A 5DD8A 2IIHA 4BWJA 3J7YJ 4XBFA 1JLGB 3M2RA 5A0YA 3ZMVA 3PDNA 3V4IB 1RWPB 4EFAC 3KLEB 4MGRA 4EBCA 4GYGA 3DGPB 4WP8A 1YIJS 3T6BA 3CF2A 4HF1A 5D15A 2WVDA 2XSJA 4FPIA 2QLZA 3DPLC 1VI7A 3L3CA 2KVIA 2JA7J 2CQQA 2J0XA 5KAKA 2B9XA 1HLWA 1S1UB 1RWKB 4DL0C 3RBZA 1Y7PA 1URNA 4BXXJ 2DHAA 1UFMA 3K70C 1KSPA 1ZKGA 1CJKB 4A8MP 1WEZA 1IWGA 4AD9A 1DDNA 5J2PA 5CJ9A 2UV8G 1P7IA 5IT4A 2HQGA 5JMNA 2Y2ZA 5HVQC 2PEHA 4FZVA 4YG2F 1N34F 4A8OA 4OIPF 4NLVA 3WG9A 4FCYA 1VRTB 4M5GA 4DQSA 2YQ0A 1FDNA 2Y48A 1LUJB 1NZAA 4AYBD 4DDFA 4G12A 4ZVPB 2UUCF 1AUDA 1NJZA 2G9WA 3OS0A 4OYAA 1UW9A 4D5FA 4OX8A 2AQ4A 5L39A 3AG1H 3F22A 3B78A 5GAEU 4ENMA 2KHMA 1HQ2A 2ACYA 3OR1A 4K8RA 4QLCU 3BS9A 5EX3A 3BSCA 4OZ0A 4NZ6A 4II2A 2PMZN 4KN4X 5F8NA 1JTXA 2FVPA 3UVJA 4JI1F 1GMWA 5FLXU 1EP4B 2KDZA 2HPUA 1I6HJ 3LO3A 1UEKA 4LLGF 3BCAA 2DGXA 2XG8A 5JR3A 1H74A 4BQQA 3R8YA 2HHUA 4BC7A 4A69C 4LT6A 3IR7B 3I59B 4EVIA 1B64A 2ZVIA 2X85A 1WSUA 2JTVA 3OTEA 4HNTA 2UXBJ 2GO8A 4KPYA 3FKJA 5B1AH 4X4NA 3GONA 2MY8A 4P6QA 1NKBA 2XMVA 5FKOA 3Q0WA 4FVCA 4WK3A 4ECUA 2BJ9A 3EUHC 1O3SA 2BJDA 2ILZA 1FE4A 1X4CA 5HS8A 1YHQS 3IAS2 2YWWA 2B4OA 4CLLA 1DTQA 1EQ0A 4EGYA 1ONVA 3T5HA 1IKVB 4C4WA 4JBAA 4C2UA 4ZYGA 3EPGA 3GPAA 3NCRA 3CE8A 3ABUA 1Y0HA 5BR8F 5T7LA 2OZ6A 1PJ6A 4PABA 2A18A 4P71A 5EGYA 3THVA 2OQRA 4ABZA 2VG6A 5F27A 2OU2A 3DTEA 1SKRA 3ZNJ1 2DR9A 1X0FA 2CQNA 2WB1A 4AYBA 1FRIA 4JV5F 5TRDA 1CQTA 1S49A 2KT0A 3UR0A 1PO6A 3G8SA 5ILUA 2XZDB 3OQ2A 5HNHA 1G8XA 2A5YB 3WDOA 4BJTA 5TJJA 3G6VA 1N52B 2UXNA 3MCZA 3ZQIA 2DT6A 5J2NA 1KVKA 3HRUA 1U48A 2HQAA 1D5YA 1AKHA 2RQ4A 4Q8EA 1VFCA 3M6UA 2J7WA 3JAMU 4ATNA 2QGUA 2LQJA 3I31A 4L6V3 4P1WA 4V19X 1WKJA 4DFJA 5J1UA 4JI0F 5IPAA 4YFNF 2STTA 2QENA 3KJVB 3CUQA 2R8JA 1JJHA 4OYBA 1NHKL 3RJMB 4ON0A 1M1GA 3A1YG 4HH0A 5CZXA 2VFSA 2Y30A 2LRDA 2BZ2A 5IT9Z 3HHHA 3T5XA 2NXJA 2UV8A 2HR3A 3M30A 1APLC 1X4DA 4KFCA 2MKHA 2YNGA 4J90A 2ASYA 2LKZA 4ENJA 3KZYA 1WGXA 3BGOP 1PJRA 2EIMH 1AWCA 4FS1A 1VQPS 2CVIA 1CLFA 1FA0A 3AB2B 3TGNA 4DBQA 3ILLA 4GVBA 4LVNP 2KZMA 4DSLA 3H40A 4O3PA 3QJPA 1LNWA 2Q3PA 3M8SA 5IP9J 2NXUA 2WTFA 3DDKA 3A13A 2BRKA 4LR7A 3I0SA 2QL7B 3QO9B 1SIZA 4Q7AA 4YY3J 3Q8YA 1MMDA 1YX2A 1H7WA 2EK1A 2MHNA 3RKQA 4ZN3A 4EMSA 1WKKA 4E6KG 2NZCA 2MZQA 2M87A 3AXKA 3KJFB 2VIHA 4BY1J 1GTEA 4I02A 4NB5A 2B4UA 2K9QA 2WB4A 2B43A 5L8RC 2OGUA 3CCUS 2OELA 4HTIA 2V4JA 5D5XB 2FC8A 4YRVA 2I8DA 5IYBJ 2XY6A 4GKJJ 2XEXA 2I1RA 2WRMA 2IY5B 3TUPA 1H72C 3CD6S 2LP4A 4B02A 3ZQFA 2CPHA 3X1LB 3OYLA 4U7UK 2NS8A 1NAQA 4NLPA 1GLNA 1WI6A 4IRHA 4EO6A 1HBNA 4ANDA 1MH3A 4LF5J 1UCRA 4DZJA 3CCMI 4QU7A 2KXFA 3ITHA 2E7XA 1S5ZA 3HXMA 1JLEB 4LGWA 1RNLA 3MD2A 1ETKA 2F9DA 1KLMA 2P6TA 2WW8A 2FE3A 2IM2A 5C3EJ 2ZJPF 2MKKA 4A3CJ 3MMAA 2ZZTA 2CFOA 3MCMA 3JSOA 4CLTA 2HGCA 3QPTA 3V42A 4PG7A 3ZTQA 5B3SH 3M8PA 1N5YB 3ZP5A 4KIBA 4D7MA 2QX0A 1R71A 4I4BA 5A8WA 3AD8C 3AXMA 2QLWA 2WTEA 4M5NA 1LKXA 1HHTP 3LAJA 3QNWB 1RTIA 5ICCA 2OSRA 5E0OA 4LREA 3VAMA 4Q8FA 2HNHA 3CCYA 2H54B 4JYAF 2OPPA 3NP5A 2MQ8A 2FVQA 4CA0A 3KYCB 3GLLA 3DNCA 1V5VA 2XYGB 2XS7A 1PCAA 2AYGA 1HI8A 3CULA 2VJ5A 2Y31A 2W9AA 4I6ZA 2KJBA 3I58A 3PFOA 2CQPA 1R6VA 3OBIA 3M9AA 3CTAA 2W25A 2DR6A 4HF2A 3MMCA 2ZBCA 1NRKA 1SJ3P 4JI7F 3IMQJ 2VHGA 1KVJA 1RP5A 4M5JA 3QSIA 4XLCA 5LJ5Y 1NJXA 4KHPF 2HWVA 4N9IA 1IN4A 2Y9ZA 1H9TA 3VSLA 3PHTA 2ETHA 3MR2A 4A93J 2OKQA 1EX8A 3MM5B 1ODDA 2LXUA 3C16B 2V2KA 2Z0GA 2ZMEB 1KONA 1S97A 4B3RF 2JT1A 3CZ6A 2X3GA 2NSCA 3T1BA 3D6MB 2GQQA 2LTPA 1XN9A 3TZXA 1RT4B 3OYIA 3NL0A 4JI0J 4IQXA 3EZ5A 4OX6A 3W3CA 1JUSA 2OPPB 4NC8A 4I2OA 3BC8A 2FJBB 3QWLA 1IV6A 4MEXF 2OO4A 3HOTA 2B6AA 3TEDA 4KV8B 4ZJLA 2HHHF 3OIOA 3DYAA 4YB1P 4C2MJ 3FF5A 1WJFA 3C2PA 1FT8A 1YBAA 5GPCA 5H9FJ 1IBLJ 5K5OA 4DU8A 4USVA 1B3TA 1U47A 4DZDA 2RQKA 3TA2A 4CYUB 1B70B 5A2QU 5FD5A 2E1MB 2E35A 2GOMA 1QA6A 2CQ2A 3W2VA 1WG5A 1PYVA 3I87A 3QPHA 4ZPTR 2DRAA 2BUNA 1AW0A 1GEHA 4TU9A 2YH0A 5HAOA 3VSKA 2LKSA 3D1OA 4S04A 4GO1A 2B9WA 2G9OA 2FX0A 3HJEA 3HVTA 2EFOA 2X48A 3FK6A 1S0NA 3QGPA 1R1TA 4BH9A 4M5DB 4AQYJ 3IC7A 3BJYA 1L0OC 4OMZA 5IOYA 2NPIA 1K6OA 3PEJA 5H9EJ 5E5NA 2BANB 3DM2B 1W4MA 2ZXHA 1VTNC 4WU3A 3IWLA 2QM3A 2G7HA 2YWGA 3MUVP 1XCVA 2H1KA 3PQKA 2UXBF 1S57A 1IXSB 1GXUA 4PDKA 1Z77A 1AZSB 2OD4A 1R6RA 3QIDA 3MD1A 2QA4G 1YRNA 1ZM2A 3HGGA 4C3LA 1X3WB 2CG4A 2X1FA 1HBUB 2UXDJ 1RAHB 1G3SA 2L02A 2DIUA 4JI1J 2Z3YA 5CKTA 4KY3A 3IWNC 3FXKA 4DIQA 1QGPA 3UR3C 1RAFB 1Z3YA 2AX1A 3JYTB 1G7CB 2DPJA 1LK7A 1QUPA 4IKFA 2GIZA 3NBPA 3UD4P 1BW6A 4KICA 1ZA2B 5D0GA 4RZRA 3R1LA 3UNGC 2F4FA 2VDIA 2MKYA 1FFGB 2XASA 1Z2ZA 5KT4A 1SC6A 2L4AA 1DARA 5LHIA 4KIGA 2H8RA 2HSEB 4CTAB 4HHJA 2VQFF 2XC9A 5DG7A 4UF4A 4DR1J 2KIQA 3UE2A 3CP2A 3H5NA 2JLEA 2KISA 3HEFA 4CUGA 1RU2A 3AL0B 4JI2F 1TTHB 4RNOA 4P75A 3P7NA 1U1NA 2FGOA 3UCGA 2QLBB 2VXDA 5B7WA 1C1CA 1BJZA 2Y0MA 3Q8PB 3CD6I 3G1LA 1BIBA 1UG0A 3CDLA 3DOMA 3MCNA 2HEOA 2N4CA 4A12A 1S1VA 2HIQA 2ZSIB 4XL9A 1ZAXA 2FHKA 2CQ3A 2K4JA 4KGXB 2ZH5A 3DXSX 1QZZA 2MTLA 2MH2A 4PK4A 3IO1A 2IBOA 3G4SI 1RESA 1OR7C 2D9OA 4TU7A 3RAMA 2KN4A 3LP2A 3NNCA 1KYZA 5D0HA 2HZTA 3OTBA 1HDDC 3GYXB 1H0HB 2HYIB 2L0KA 1H73A 3N5FA 1XGNA 4QQBA 1AU7A 1YLXA 1UW4A 3K8VA 2RDPA 1EKRA 4ECQA 2BW3B 3ISZA 3U1LA 3M05A 2HKXA 2DMPA 5KFXA 1RWMB 2DRBA 4F2RA 3AG3H 1FTRA 1FX4A 3C46A 1FBUA 2KDOA 4A3JJ 2EPIA 1AB8A 1A6QA 1FY7A 4I64A 4PJJA 1FOYA 2DCEA 4J00A 1IQZA 2X1GA 1SFEA 2ICWG 2FJEB 5ADZA 3QU6A 2GIRA 2AS5F 4HSTA 2VBXA 3A02A 3FQLA 4KBIA 2HS0A 4RM3A 2JN6A 2FHJD 2CPYA 3RB6A 4OYIA 5K8PA 1T8EA 3RKYA 3VB2A 3HB9A 4KJIA 4LLLA 4NE9C 1JLFB 2ATCB 4KSEB 3RZOJ 5AE1A 3QYFA 1SD7A 2M2BA 3JQKA 3T5JA 2B0GA 4J9KA 4DUZJ 4N7TA 4A48A 1NHUA 3W7BA 4U0WA 4NBQA 2EWNA 2CPXA 2LYCA 3P5BP 5HQLA 2NNYA 1YRTA 2E2IJ 1IKWB 4FYVB 4WFXA 5DLGA 2JPBA 4B3OB 1EH7A 1TQIA 2JA6J 1PDNC 5E20A 4AUKA 4AIKA 2HFVA 5IQQA 4QJVA 1HW9A 4DV4J 1U8SA 2LA4A 2MHEA 4NDLA 3HZGA 3ZMDA 4O6JA 2QFIA 2VI6A 4NA3A 5A8KA 3BR5A 4DQRA 1QNTA 4DXLA 1UA0A 1Y5IB 1DP3A 1XMXA 2FIUA 1Y10A 2K7JA 1FFSB 4NYZA 3LPEA 2VONA 1VQSA 3JYTA 3CCES 2RB7A 1J0RA 1X8DA 4TY9A 1YS7A 4RB3C 3UD3P 3DN9A 3IH2A 4OMYA 1X5SA 3BPDA 1U6GA 1P6RA 4OI2A 2FLOA 2RC4A 3HSZA 3IFEA 5J1RA 3KP2A 1XMQF 5IZHA 4A8SA 1V9OA 2MZSA 3O6QA 1T0TV 2V68A 2Z56B 5M3MJ 3E51A 4RAZA 5BPIA 2W2OP 3AB4B 4DCJB 5C4XJ 1JLCA 1FTCA 2WOMB 4WWCA 1UWBB 3OYNA 3BKFA 4HEA9 3EICA 2CV1A 3J7YU 4ERDA 2B56A 4NNJA 2J8SA 4F0KA 4Q0BA 1IRGA 3H5RA 2UUZA 2YTCA 2XAUA 1ZRFA 4ZS6A 4TXSA 4NMXA 1RI7A 3BGRA 4BXFA 1P8GA 3SQGB 3TJAA 2DT7B 3BGUA 4FBUA 4XK8C 1Y8RB 1IN5A 4NC7A 3MR7A 1OYDA 3GCXP 3AA9A 1U9NA 3K2YA 2ZJPQ 5F08A 1X1PA 1DQ8A 1UJ5A 5JUMA 2ZFUA 3TKYA 2ROEA 4LD5A 5U47A 3C6TA 4RDUA 4HNVA 1G6BA 1U45A 2EPFA 3QPSA 1P4XA 1X4PA 4O44B 4HPQA 3TUJC 4PG6A 3BR2A 4ZZLA 3K0LA 2DK8A 2XGDA 2E60A 2EB7A 1N5SA 1ZOTA 4L5JA 3FDSA 1HL6A 2PA8D 4Q44A 3A3OB 2JWTA 1QAIA 2TCTA 1D09B 5IWAJ 3I5CA 3QGIA 2NOJB 3G2BA 2NLWA 3FXLA 3JS9A 1J27A 1DPRA 2BV3A 1IBLF 2MQMA 4LFAJ 2G1HA 1FJGF 2P81A 3ILIA 4AXIA 5HDGA 1L3KA 2HU9A 4FXWA 1SKSA 1N32J 3OIPA 5F8MA 4PFOA 2CGPA 2R7ZJ 3SZGA 3G2XA 3SFIA 1VC6A 1GMVA 3MECA 1O7FA 1FRHA 4M6YA 2PFBA 1KR4A 2XSJC 2DGOA 1FFWB 4KGMA 2UVUA 3FEYB 4ZLLA 3AH6A 4LRFA 4IR1A 1Y9OA 3L00A 4P9UA 2O8KA 1EH6A 2HNYA 4EK2A 4EM0B 2BVMA 3LP0B 2BJEA 2IJLA 2EXUA 2LR8A 3DU6A 1UPPA 1NEEA 1NO8A 4B3RJ 4ED0A 4O4GB 4W92B 1S9FA 3CDUA 4FISA 1OO0B 3IRXA 3MKYB 2DCLA 2JA5J 2QEXS 3QQAA 1OQYA 2ECBA 1EHWA 4X65F 4AYBN 5J8CA 1BI3A 3H36A 3MFHA 1FEXA 3R5AA 4WFNQ 4DR3J 1R4MB 1B1BA 4Y15A 4USKA 4KISA 2EIKH 3ISNC 9ATCB 5LJ3Y 3F21A 3NRBA 3CMAI 3S01A 1FVSA 2B6AB 5KFOA 4CLSA 3IRXB 4M74A 3LSRA 4JI8J 3Q8RB 4B3OA 3A3NB 4R1HA 1DRZA 3TYTA 3E97A 2Y9HA 3IS9B 2D3UA 2R9LA 2BX6A 1ON1A 4MFDA 1V3RA 1IF1A 2EBEA 5E41A 3P45B 2F4VF 5E3AA 3QRQA 1O6XA 2MPUA 2I10A 2LBFB 4M3BA 2K8GA 1FX2A 1UB9A 4E7KA 3BG7A 3QAEA 4KRWA 3G6ES 1FNXH 4FF4A 4Y13A 2UU9J 5DDRC 4L9TA 2DA5A 4A3DJ 3CJ5A 4I98B 4XLEA 4KGKA 3QU3A 5AXMA 2ZB9A 3OT9A 4PQAA 1F3FA 2A10A 3X3UA 3DRSA 4Q2MA 2HVSA 5G4DA 2VBWA 3CJTA 3JSMB 3W6JB 4BS9A 1REGX 2XS2A 4A3GJ 1R8BA 1T9UA 2YPYA 2RQMA 4B4CA 3HOXJ 2NYIA 1ZM4A 2LY1A 4WZQA 2GMJA 3G6YA 3QAHA 1M1EB 2BBYA 5A8KB 2M5WA 2MB0B 3H5XA 3TO8A 3IP4B 1UTAA 2XHWA 2A68F 4Y28C 4A8YA 3EPZA 3PRVA 5D4RA 5F3ZA 3GVAA 4O0IA 5KFJA 1JMTA 2DNOA 3K4CA 4GKJF 2IVMA 1EJ9A 2V0NA 2HQIA 1S7HA 3ET6A 1YJNS 3ZQGA 2W4DA 2VN2A 2DNLA 2HVRA 2C3UA 2LQ9A 2U2FA 5CQGA 1AA1B 2BEFA 5JJBA 3WHIA 3B8HA 3PVXA 4NLDA 3T6JA 2COMA 5D6EA 5KG5A 2KQRA 1K4SA 3BR0A 2R7TA 2KM8B 4U7CA 5K8NA 3GLXA 3NCQA 1SVMA 4ECSA 3KP6A 3JRHA 1S6QB 1K78B 1ZPWX 2JHEA 2CRGA 5B0CA 1MNMC 2MLYA 3P96A 4C8NA 3A4CA 4H4OB 3KOAA 1HR0F 2G2YA 5KFAA 3AOAA 3ECOA 4CRJA 4ZVSB 4IQJA 5KFYA 3RYRA 2FB0A 3A8EA 1XIQA 2F8HA 3U2RA 4UUWA 1AHDP 3BV8A 2CKWA 3W9JA 3K9TA 3NGUA 1VYAA 1HMVB 2AT1B 4V19J 1HKTA 4ED3A 3LGMA 1MKMA 2COBA 3AA8A 2RRNA 3M1CA 3A8KA 1FJLA 3CCWA 4F4WA 3W2WB 2ZBPA 2F2EA 4UZBA 2OLWA 4F26A 1VZ0A 5GAEI 3MM8B 3SEOA 1U0SA 4R5PA 4RPFA 2R2RA 3V6HA 1Q0NA 5M5YJ 4KIFA 2OUGA 3EUHA 1N0UA 4YHHF 4KYZA 1VQ4S 1NSKL 2AQFA 2L7KA 5C5JA 1FE0A 4N47A 3HK2A 2CPJA 5L38A 3F9KA 3KNGA 1FT9A 4G1PA 1XD7A 2HQRA 4BBSJ 4DV1F 4XLNF 4V2FA 3KP7A 2D69A 2KU7A 5KFKA 2F3JA 4CNZA 4TQSA 4R5PB 1N78A 1UJ6A 4ECZA 4UVAA 3ZMSA 4PG8A 3TVKA 1P92A 3CCJI 4I68A 4OJ3A 2VQGA 4RNFA 1KQ0A 4RW6B 1K73T 2V8GA 4JV5J 5HDNA 5DS7A 7AT1B 3OYCA 4CHUA 5GP9A 5DRKA 4A47A 3Q23A 3PIOF 3GEZA 1WD6A 2FNAA 1LW2B 2D74B 3MZIA 3FVYA 3KP3A 2HWIA 1ZN2A 2IJRA 2R7XA 2JC1A 3WGIA 4U96A 5EF6A 5HJXA 1F9NA 3M9OB 3FSIA 4KB7A 3S32A 2AXTC 1IJEB 2L9SA 3F8NA 4M63A 3F8BA 1U2WA 2M30A 1SH2A 3BSNA 1IKXB 3AT1B 2OFHX 4OI4A 3TDUC 2XHKA 4USJC 2BABA 2X1DA 2QFJA 3V6DB 2Q6CA 3X2QH 2G1DA 4WF9Q 4H4MA 4NL5A 5E33A 4MJKA 2W24A 3JSRA 1LE8B 1FXDA 1E6VA 3CDWA 2LC2A 1C0UB 2DY1A 3H3ZA 1T2KA 3BJAA 1QBJA 4J9NA 3BQ0A 5D4NA 4ETZA 2GFFA 2YWFA 3U27A 1D8ZA 1TUWA 1BM9A 1B8IB 2V79A 4C8MA 3DQVC 4GC7A 4GRSA 2HTJA 3F6OA 1FKOB 4RBUA 3DBHB 3V4IA 1B0VA 1YRUA 4ECTA 4XONA 4KMFA 1IBCB 4CYDA 3IR5B 5G0RA 5B0BA 3D0HE 2Y1RI 2YH1A 2ZC3A 3UN2A 3JRCA 2RKIB 2WB1N 3OHBA 2JQ7A 4C3IJ 3OD2A 1PYOB 4QZVB 3TDZC 1TUGB 2WB1D 2EZKA 4DOZA 1YGYA 3QRFF 2ZJRF 2IS1A 5IY5H 2BE5F 1NNDA 5CAAA 1Y1WJ 2ZFHA 3MEKA 4S05A 4K4TA 1FF2A 3JRBA 2ASJA 3SV3A 4QIFA 4NEYA 2J0SD 1SVOA 3D1NI 4IHXA 1WC0A 2H6CA 4WTYA 4K4VA 1HHSA 4U0VA 1GX5A 4IRGA 2X1BA 1GXTA 3TVZA 3WBZA 2EIJH 2KZZA 2K85A 5LM7E 4DPWA 1OPIA 3SSQA 5B0AA 4NEZA 5KHDA 1Q1KA 4WPAA 4JX6A 3BSOA 1U8BA 3SIPB 2V2VA 1FP1D 4K50A 3AJ1A 3V4GA 1M5HA 4C0HA 1YQAA 3MCSA 1TW3A 3J80K 3A0HC 1NSQA 2DISA 4DR5F 2ZOFA 2RNJA 1FD8A 4LFBF 1BQNB 1FKAF 3W6KB 2KRBA 2CQKA 4FASD 1WFXA 2OPSB 3SCKE 2FOKA 4M95A 4OINF 1JJ4A 1GK8A 3CP8A 3DLKA 2FD2A 2RUSA 5IYCJ 4KPCA 1TELA 5B0FA 4K4WA 2DA4A 4LK1F 3F23A 4ZDNA 4K0KJ 2NZ4A 3CT9A 5DS9A 2VU5A 4USIA 1X4OA 4OHZA 3FISA 3R0JA 3TEGA 4PGHA 2BKPA 3FSXA 3R6SA 5JHUA 3RRKA 3RTRA 2GHPA 5JLWA 4DQPA 1SL2A 1YI2I 3KLVA 2D3O1 1O3TA 3CDAA 3I3LA 3IG1B 1CULA 4LSZB 2OPTA 4BU2A 1X9SA 2XQCA 5EDNA 3MCOA 4H4OA 1TQPA 1G4CA 1KQKA 2LECA 3DEEA 1UJ4A 1MSFC 1KEKA 3FBFA 4HX4A 2WADA 3MKZA 3N97A 3MN2A 5ETMA 5F41A 1S1VB 2A6MA 5T41A 2OF7A 1L3UA 2CWKA 1HNVA 2XGCA 2V5HG 3ENWA 4C8ZA 4O3OA 2KT5A 2O8XA 1QHHD 1LXJA 1YWXA 4OHXA 1U3EM 5ETNA 5J2MA 3NMAA 4J01A 4LOCA 4HVZA 2P2CB 2DOFA 1S1WB 1K0TA 3SQOP 5HQ8A 4RUBA 1WF2A 2C42A 4JV1A