1ESKA

Solution structure of ncp7 from hiv-1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
42
structure length
42
Chain Sequence
NVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords GAG POLYPROTEIN
publication title Solution Structure of (12-53)NCp7 of HIV-1
rcsb
total genus 9
structure length 42
sequence length 42
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00098 zf-CCHC Zinc knuckle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.60.10 Few Secondary Structures Irregular HIV-1 Nucleocapsid Protein Zinc finger, CCHC-type 1eskA00
2YSAA 2L4LA 1U6PA 1WWDA 1WWEA 2M3ZA 1Q3ZA 1F6UA 1AAFA 1MFSA 1A6BB 3TS0A 3NYBB 3TS2A 1ESKA 2EC7A 2JZWA 2LI8A 1Q3YA 1A1TA 2EXFA 2CQFA 2IHXA 1WWGA 1WWFA 3TRZA 1BJ6A
chains in the Genus database with same CATH superfamily
2YSAA 2L4LA 1U6PA 1WWDA 1WWEA 2M3ZA 1Q3ZA 1F6UA 1AAFA 1MFSA 1A6BB 3TS0A 3NYBB 3TS2A 1ESKA 2EC7A 2JZWA 2LI8A 1Q3YA 1A1TA 2EXFA 2CQFA 2IHXA 1WWGA 1WWFA 3TRZA 1BJ6A
chains in the Genus database with same CATH topology
2YSAA 2L4LA 1U6PA 1WWDA 1WWEA 2M3ZA 1Q3ZA 1F6UA 1AAFA 1MFSA 1A6BB 3TS0A 3NYBB 3TS2A 1ESKA 2EC7A 2JZWA 2LI8A 1Q3YA 1A1TA 2EXFA 2CQFA 2IHXA 1WWGA 1WWFA 3TRZA 1BJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSA A;  2L4L A;  1U6P A;  1WWD A;  1WWE A;  2M3Z A;  1Q3Z A;  1F6U A;  1AAF A;  1MFS A;  1A6B B;  3TS0 A;  3NYB B;  3TS2 A;  1ESK A;  2EC7 A;  2JZW A;  2LI8 A;  1Q3Y A;  1A1T A;  2EXF A;  2CQF A;  2IHX A;  1WWG A;  1WWF A;  3TRZ A;  1BJ6 A; 
#chains in the Genus database with same CATH topology
 2YSA A;  2L4L A;  1U6P A;  1WWD A;  1WWE A;  2M3Z A;  1Q3Z A;  1F6U A;  1AAF A;  1MFS A;  1A6B B;  3TS0 A;  3NYB B;  3TS2 A;  1ESK A;  2EC7 A;  2JZW A;  2LI8 A;  1Q3Y A;  1A1T A;  2EXF A;  2CQF A;  2IHX A;  1WWG A;  1WWF A;  3TRZ A;  1BJ6 A; 
#chains in the Genus database with same CATH homology
 2YSA A;  2L4L A;  1U6P A;  1WWD A;  1WWE A;  2M3Z A;  1Q3Z A;  1F6U A;  1AAF A;  1MFS A;  1A6B B;  3TS0 A;  3NYB B;  3TS2 A;  1ESK A;  2EC7 A;  2JZW A;  2LI8 A;  1Q3Y A;  1A1T A;  2EXF A;  2CQF A;  2IHX A;  1WWG A;  1WWF A;  3TRZ A;  1BJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...