3TS2A

Mouse lin28a in complex with let-7g microrna pre-element
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
135
structure length
135
Chain Sequence
QLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSINHMVASCPLKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis for Interaction of let-7 MicroRNAs with Lin28.
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein/rna
molecule keywords Protein lin-28 homolog A
total genus 27
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00098 zf-CCHC Zinc knuckle
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3ts2A01
4.10.60.10 Few Secondary Structures Irregular HIV-1 Nucleocapsid Protein Zinc finger, CCHC-type 3ts2A02
4BY7H 1IXRA 2Z6KC 4IPHA 2UUBQ 4EQ5A 5C0XJ 1FGUA 5H1SE 3GTOH 2AKWB 1PH9A 3H0GH 1YZ6A 3D0FA 4OX9L 3K80C 3UDIA 2E2IH 2YU9H 4R4IA 3E9HA 1PH4A 5LMUL 1YJWA 3U4ZA 5FLMG 3H0GG 3PUYA 3CCSA 4AQYL 2N78A 3K7UC 1G6PA 2IT1A 2E8GA 1A62A 4NPSA 4GNXA 4LNQA 2NVTH 1YITA 3KYHC 1KAWA 4JYAQ 5LMNL 5M3FG 4DV4Q 1L0WA 4A3EH 3PGZA 1XPRA 2B29A 1OXUA 5M5YH 1U0LA 4P74A 4A3FG 4DR7Q 4JOIC 3EBEA 3MXNB 4DR7L 4HIKA 4IOAA 5JJLA 2UUBL 1JMCA 2Y0SE 1U6PA 1X56A 3B6YA 2F3IA 3A0JA 1LYLA 1PYBA 1YJNA 1JJGA 2ATWA 2Q2HA 4IPDA 5JEAJ 4YCWA 3K8AA 2OWOA 4JBKA 4DR6L 1JT8A 1Q3YA 2JA5G 1WWDA 4JI3Q 2UXCQ 2NZOA 3T1HL 4EX5A 2VQFQ 2QGQA 1E1TA 4HIMA 1IBLL 4B3TL 1XNQL 1VQPA 4GN4B 5IWAL 5IYBG 3NYBB 1UWVA 3J80c 3I7FA 2UUAL 4JBWA 2R7FA 3I2ZA 1S72A 1WI5A 4LWCA 4RG1A 1N32Q 4YCVA 4A3JG 2L15A 3S24A 4P73A 1X54A 2VQEL 1Q82C 1KXLA 3TS2A 4WJ4A 1VQLA 2BA1A 4JI2L 4JI3L 2UXCL 1WFQA 1J5EQ 1EWIA 4GKJL 1X3GA 1EIYB 4A3CH 2AWNA 2JK8A 3CPWA 1Q86C 4BXXH 2VNUD 2LSSA 4DK3C 4QGUA 3E9IA 2AWOA 4DK6C 3DLLA 3SGIA 4BBRH 4QIWE 2QEXA 1C0AA 4DR4L 1XTDA 1N9WA 3PCOB 5J3BA 2JA6G 4BBSH 4JI8Q 5BR8L 2ZJRA 5IYDG 5IP7G 1XMQQ 5M3FH 2CFMA 1PH7A 1HNZL 3CD6A 2I5LX 2F52A 4DV2Q 4LF8Q 1PH6A 1HNZQ 3RLFA 4NXML 3GTLH 1GKHA 1NMGA 2PI2A 3PO2H 2A8VA 1Q3ZA 3A5UA 3KF6B 1PH1A 3AYHB 4A3JH 4LF4Q 1K0RA 4IOCA 5ELNA 1EIFA 1W3SA 1XNRL 3PIPA 4FDBA 2ZTCA 1XNRQ 1QZHA 1WYDA 2GN5A 2MQHA 2QA4A 1K9MC 4JI0Q 4KLKA 2UUCQ 4LFBL 3F2BA 1VQ5A 3GD7A 2HIVA 2ZM6Q 1WOCA 4KHPQ 1A8VA 4BY7G 5C44H 3M4QA 4NXNL 1PA6A 1CUKA 3GO5A 4ALPA 3IRBA 5M5XH 4A3GG 3OYYA 2F4VQ 4APVA 1Q1BA 2UU9Q 1C7YA 3CP0A 1CKMA 1OXTA 2IHFA 1EUJA 1V1QA 2K5HA 1PHJA 4DV3L 1X3EA 2XTIA 1A1TA 1PH2A 1JE5A 4DNIA 2Q2UA 4TVAB 5IYDH 3RLOA 4YWMA 1GD7A 2CCZA 5IP9G 2UXDQ 4DUYQ 2Q2TA 2R93H 1VQCA 2ID0A 1MFSA 4X6AH 1K3RA 2XGTA 5AJ3L 3CCJA 1P8LA 4A76A 4A3KG 1I94Q 5JJKA 4OX9Q 5IYCG 4BBSG 1BBUA 2D0PA 2I0QA 1IL2A 3OTOQ 2KCMA 4BA1I 1Y1VG 2MNAA 1NE3A 4DPGA 2WB1G 4GLXA 3S1QH 3CXCA 1I6HH 2EQSA 5C44G 2LI8A 1VQHA 3UE0A 3W5OA 1N34L 3CCLA 5FJ8H 3G4SA 1YVCA 4JYAL 4A3BG 1K8AC 4DV4L 2JA8G 2FXQA 2CQOA 2Q2IA 4X65L 4JOIA 3W1GA 1YJ9A 1XMOQ 4B3SQ 3ULLA 1NTGA 2R92G 3HOWG 3CW2C 4DV5L 1X65A 2K14A 4AIMA 1VQIA 4LW1A 4DR6Q 5GAGC 1QVFA 4LUVA 3M4PA 4DV1L 4HIOA 4L5SA 3RLNA 2B63H 1AAFA 4OONA 4LF5Q 5EAYA 3J7ZC 1A63A 4O0AA 4NB3A 1N36Q 1FVIA 3HOUH 4DUZQ 2RHQB 4UP7A 2YV5A 5IWAQ 5K36G 5JEAG 1VQKA 1BBWA 4QL5A 1PH8A 2AMCB 4DR2Q 4JI1Q 3L2PA 5C0XI 3GTPH 2VS1A 1Y1VH 2Y0SG 3MEFA 1T9HA 3HKSA 4YY3L 4DV7L 2HHHQ 2RF4A 1X6OA 2YTYA 2NVXH 1EQRA 4A3DG 2PI2E 4JV5L 2CQFA 2JZWA 4C3JH 4GN3B 1KRTA 4DV5Q 4A3KH 1Y1WG 1UE6A 4OXPA 1Q7YC 1M90C 1PYSB 2JQOA 3M9BA 5IP9H 1N8RC 2M3ZA 5C4XG 1QUQA 1OTCA 3AEVA 1L1OA 3HKZE 1MJEA 4IPGA 3EN2A 3BZCA 3K81C 3PO3G 1VQ8A 3E0EA 4LF4L 2OCEA 4Y7NH 3AFPA 4K0KQ 2DUDA 4LF6L 1UE7A 1K8GA 1KC8C 1XPUA 1Q46A 2K5VA 4O2DA 4JBJA 1VQEA 1HR0Q 1RIPA 3CPFA 1EQQA 5BR8Q 2R92H 1CKNB 4A3IG 4NXNQ 3J7A5 1E3PA 2D0OA 4DR4Q 1VQNA 1YNXA 4JI8L 3FP9A 2PQAB 1VQMA 1XMQL 1AE2A 1VQAA 2E2JH 2N49A 4UP8A 3D31A 1CKOA 4TQUS 1A6BB 4GNXC 4JI5Q 4XIGS 4K0KL 1N33L 4JI0L 4A3FH 1WJJA 3STBC 4X66Q 1CSPA 3RN2A 4LF9L 2BA0A 3CCEA 4A3MG 4UY8C 1K83H 4RMFA 3J81c 2UXBL 4LF9Q 5AJ3Q 1WWFA 1CKNA 2UUCL 4LFBQ 1I94L 1QVGA 3GTJH 1IBKQ 2K52A 1TWCH 2F4VL 2K4KA 3CCRA 3S17H 4GN5A 3HOYH 1VQJA 3G71A 1O7IA 1SR3A 4LF7Q 2LXJA 2VZAA 4NXMQ 1TWFH 4DV3Q 4IJLA 1D8LA 2KBNA 1HNXQ 4MZ9A 1NMFA 2R6GA 1HNXL 4AYBG 4DV6L 4BY1H 3U4VA 1HH2P 4GS3A 1A0IA 4HJAA 3KLWA 2RCNA 4X65Q 2R7DA 2L4LA 3F2CA 2PNHA 2MO0A 2OTLA 2UXDL 1LM0A 4DV0Q 2ZM6L 2R7ZG 1CSQA 1F6UA 4KHPL 4R4OA 4YHHQ 1VQFA 4A3IH 1IBMQ 2R7ZH 2VW9A 4XTCS 3PUXA 1PV4A 1H95A 4IFDI 1PH3A 2JA9A 3H3VH 1HZ9A 4UPAA 1YBYA 4BY1G 4A4IA 1HJPA 3EIVA 3TQYA 1BKBA 1VS0A 3G6EA 3HOZH 1RL2A 2E5LQ 4LFCL 1UEBA 4QJFA 5C4XH 3RZDH 2PMZE 2C35B 3GTKH 3CF5A 3I4NH 3GTGH 3STBD 3I56A 4PZ7A 3RR5A 4HIDA 2WP8J 2VQEQ 5GROA 4GKKQ 1SN8A 4YCUA 4GOPC 1VQ6A 1R9TH 3PV0A 3ICEA 3M3YH 4A3CG 4DUZL 3OW2A 2K5NA 3NENA 2VUMG 2YTXA 4OWXB 1OXXK 3M7NA 4L5TA 1BVSA 2KCTA 4PZ6A 1IBLQ 1E7ZA 2BH2A 4KHZA 3M85A 3NEMA 3CC4A 4YWLA 1V9PA 2HHHL 1VQGA 2GVBA 3T1YQ 1HR0L 4R1JA 4LFCQ 3T1YL 2LXKA 1XMOL 1P16A 2ZTEA 1E24A 4A93H 4JV5Q 1N32L 3FHWA 1VQBA 4R4TA 2IY5B 1L2FA 1XJVA 1KL9A 1Q12A 5IYBH 1WWEA 1D7QA 4MTNA 2EXDA 2CWAA 3CCQA 3J81i 1YHQA 2VUMH 3S15H 1SROA 2ALYB 4A3BH 2VQFL 1J5EL 1JJ2A 4B3TQ 2YTVA 5IT9c 1XNQQ 5JJIA 4POFA 3M4OH 1NY4A 3UDGA 3I4MH 1LUZA 3ZJYC 2JA6H 2CKZB 4X66L 3KDFA 1QUQB 3F8TA 4KI0A 2B63G 2R93G 1OXVA 2UXBQ 1TXYA 5FLXc 2JA7H 1MJCA 5LMNW 1EOVA 1Q1EA 4GOPA 1UE1A 1GM5A 4WJ3M 4P72A 1LTLA 1G51A 2HQLA 3K0XA 3RNUA 2I5MX 1B70B 4DAMA 1C9OA 1EYGA 4JI4L 4OWWB 1YIJA 2YYZA 4J15A 4JI2Q 3WWVA 1VQOA 4OO1G 3A5ZB 3JAMc 1SLJA 4DR5L 4PZ8A 4HJ7A 1X3FA 1B7YB 1SRUA 3PUZA 5FLMH 1TWHH 3GDEA 3CCMA 1WCMG 5GQOA 3W1BA 4X64L 1VQ7A 3CC2A 3S14H 4DR3Q 3JC66 1VQ9A 1MIUA 4POGA 2JA8H 5GADC 2H5XA 4GOPB 3S1NH 3UDXA 3S2HH 2YSAA 1EFWA 1KQSA 3CAMA 2JE6I 4C3HH 4DR1L 2EC7A 1I50H 4AYBE 3S16H 2OTJA 3H15A 3VDYA 3CC7A 4LF7L 1Z9FA 1XPOA 2RHSB 2NN6I 4IPCA 3PF5A 2ZJPA 5C0XG 3BJUA 3PO3H 2WFWA 1NBWA 4JI5L 1Z47A 3LGJA 3AQQA 3NELA 2MO1A 1Y14B 4DUYL 2HT1A 3ULJA 4DV0L 3CCVA 3UE1A 1X9NA 3PUVA 4LUOA 2WAQG 4BBRG 4B3SL 4AH6A 3PF4A 1X55A 3HOZG 4DKAC 4B3RL 4GLAC 5LMUQ 3TS0A 2JA5H 5IYCH 1AH9A 2EIFA 2N8NA 1IBML 3RZOH 3KDFB 4IFDG 4P75A 4DR1Q 1SFOH 1SE8A 2JA7G 2A1AA 3FKIG 1Q8KA 4GLVB 3ER0A 3OTOL 4LUZA 4A3GH 1MKHA 4BA2I 4MNOA 3F2DA 3CQZH 3UDFA 4HJ8A 4DV6Q 4BXXG 4DR2L 1M1KC 1IYJB 3H3VI 2E5LL 1IZ6A 4L5QA 1VCIA 1PVOA 2DGYA 5C4JH 5LMNQ 2BH8A 3DM3A 3NBHB 4DV7Q 2EXFA 3HOXG 2K75A 4IFDJ 2JJQA 4PMWA 1K73C 2KHIA 1ASYA 3K7AH 5IY0A 3S1RH 3JAMi 3AFQA 2IHEA 1YHBA 2AHOB 4LF5L 2ASBA 1HZBA 1KRSA 3CCUA 1JJCB 2V1CC 4DV1Q 1N36L 3Q8DA 3HKZG 3HFZB 1ASZA 1J6QA 1DGSA 4X62L 4JI6L 2IHXA 3BZKA 5FJ8G 5IP7H 2E2HH 1G291 2KHJA 4GKJQ 4X62Q 1WCMH 3PUWA 2IX0A 1E1OA 4GNXB 4IO9A 4IJHA 4JI1L 3TREA 2KENA 3CMEA 1N34Q 4LF6Q 1B8AA 4DAYB 2WB1E 4P71A 3TEHB 4UP9A 1AE3A 2VY3A 3GTQH 1S3OA 1GVPA 2VL6A 3FKIH 1I5FA 1Y1WH 3S2DH 4HJ9A 3J80i 4YY3Q 1HNWL 2UUAQ 1BJ6A 1E22A 4H02A 4B3ML 2Z6KA 3RN5A 3PIOA 3CMAA 3S1MH 4B3MQ 4PG3A 1GO3E 3A74A 4A75A 2ZTDA 3L7ZC 2I5HA 1Q81C 1PH5A 4GKKL 3ERSX 3I4NG 1I3QH 4ME3A 3KF8B 3U50C 4QQBX 3I4OA 1YEZA 2NZHA 4JI6Q 4LFAL 1KHIA 3T1HQ 1HNWQ 3GTMH 2OQ0A 1TWGH 2WAQE 4OWTB 5HY6A 5C3EG 4X64Q 3ULPA 1NJIC 3KJOA 1WWGA 1L1OB 1OXSC 4JCVE 1QZGA 2JEBI 1JB7A 4JI7L 1QVCA 2NVQH 2IX1A 5M3MG 3HOXH 2ES2A 4JBMA 1FL0A 3L0OA 2CWPA 4OO1I 3KJPA 4Y52H 3TRZA 4JI4Q 1U5KA 1VQDA 4A93G 4C2MH 2K50A 1KIXA 4L5RC 1YI2A 1SMXA 3KOJA 2HIXA 1VQ4A 4DV2L 4LF8L 1S40A 2B3GA 2N3SA 3F1ZA 2JEAI 4DR5Q 5DLQE 4LFAQ 3HOYG 4C3IH 1HZAA 3KFUA 3I55A 4QY7A 4R4CA 5E7NA 3PO2G 5ELOA 5M5WH 5C3EH 1N33Q 1HR0W 1ESKA 2MFIA 5IE8A 3HOVH 5GAEC 4A3MH 1PFSA 4R4QA 4JI7Q 4DR3L 4YWKA 3G48A 1TWAH 4JG2A 4B3RQ 3HOVG 4A3LG 1YHAA 3U58A 4YHHL 2ZJQA 2NN6G 1IBKL 2UU9L 5GAHC 2D62A 4A3LH 2Z0SA 3PSIA 4AQYQ 1L1OC 2A19A 1KD1C 3J81j 3HOUG 3BU2A 2NVYH 1FJGL 1HZCA 3I4MG 4A3DH 3KF6A 1W2BA 5HGQA 4A3EG 1FJGQ 2OQKA 1UE5A 4HJ5A 1V43A 5M3MH 2GVAA 3HOWH 4JC0A 2PQAA
chains in the Genus database with same CATH superfamily
1IXRA 5JEAH 4IPHA 2UUBQ 4EQ5A 5H1SE 2EYFA 1SEBD 2F0SA 2TMPA 2YU9H 1Y1VB 4R4IA 4HTHA 3U4ZA 1C8CA 4TSSA 4B08A 1A62A 4NW2A 1KAWA 2EE1A 1EFID 5M3FG 1XPRA 4DR7Q 1EIHA 1U0LA 2UUBL 5CV8A 1RHPA 2Y0SE 2F3IA 1LYLA 4RCOA 3MFGA 4KD3A 1NR2A 2A69C 3W3AA 5JEAJ 4YCWA 5JAVA 1TIID 4HIMA 1XNQL 3J80c 3WOFA 1S72A 4LWCA 4RG1A 3C1EA 4PNYA 1Q82C 2L0CA 2RSNA 5LL6S 3R8BA 5E4XA 1CHPD 2BA1A 2KEDA 3NUCA 3QWNA 2UXCL 2JA5B 1X3GA 3CPWA 1Q86C 1MBYA 1H9SB 1YNNC 4QGUA 3GV6A 4DK6C 1S5DD 3SGIA 3H3VC 1C0AA 3A8IE 1XTDA 4X3KA 2JA6G 4DR4L 3FPPA 3VR3A 2DN8A 1XMQQ 5M3FH 3CD6A 1HNZL 1EEFD 1HNZQ 4NXML 3GTLH 3CU7A 3TZDA 4OHJA 3HOZB 1C4QA 5CBAE 1PH1A 1EIFA 1W3SA 2HD3A 4ZYSA 1UUPA 4FDBA 1XNRQ 2GN5A 2XIWA 4KLKA 1WCMB 3GD7A 4QB4A 3M4OB 3SEBA 3MXUA 4KHPQ 1UEAB 5C44H 2KA7A 1CUKA 4ALPA 5BN5A 1JQYD 1WTWA 3OWEB 4A3GG 2OXPA 2F4VQ 3VYTA 1Q1BA 2UU9Q 1C7YA 2KEEA 2IHFA 3CKIB 1GUOA 4DV3L 1X3EA 3EFXD 4RH6A 1ENCA 2JN4A 1I50B 1TQOA 4X3UA 2GA4B 4DUYQ 1F9RA 3T51B 1MD2D 1MFSA 1JICA 4A3KG 1PDQA 2WAQB 4OX9Q 2DY7A 4NKLA 2HCIA 1IL2A 3OTOQ 1LT6D 4GLXA 3S1QH 3CXCA 1RODA 2LI8A 4A3MB 3UE0A 3W5OA 1GJXA 3G4SA 1PZKD 1LABA 4JYAL 4A3BG 2JA8G 5IT9L 2CQOA 2F0WA 2Q2IA 1XMOQ 2R92G 1NTGA 3CW2C 4RA8A 2KOLA 2KUMA 2KQ3A 4LUVA 4HIOA 2F0TA 5EJWA 3J7ZC 3HOUH 4DUZQ 2RHQB 4QUFA 3BDOA 4BBRB 5IGFA 5JEAG 1PH8A 2EJFC 1RKNA 2MGSA 3HRZC 4WORA 5E1FA 3MEFA 1Y1VH 1HNWQ 1T9HA 2JP1A 4DV7L 2XRQD 2YTYA 1JWMD 2JZWA 1YNJD 2LY7A 1UE6A 1Q7YC 1PYSB 2JQOA 1H9RA 3M9BA 4RGMA 5C4XG 5CV5A 3VR2A 1L1OA 3HKZE 2PPBC 3BZCA 4G57A 1VQ8A 2K5VA 2A68D 4C3IG 1HR0Q 1I4RA 2MJ8A 1EQQA 5BR8Q 3HKZB 2EZVA 1CKNB 2D0OA 1VQNA 4F8MA 2M00A 3Q22A 1XMQL 1AE2A 3F2UA 1K28A 3E0JA 2K03A 2ZXPA 4XIGS 4X66Q 4B9WA 4A3KB 4LF9L 2BA0A 3J80L 4A3MG 1K83H 2UXBL 4LF9Q 1B9MA 4C3IB 4FF2A 1QVGA 4RHRA 1IBKQ 1E2WA 5KYIA 4RGTA 2XRSD 4GN5A 2WB1B 2VZAA 1CZWA 3K5NA 1HNXQ 4KKSA 1HNXL 2IL8A 4PMCA 4N8FA 4GS3A 1BCPC 3BS1A 2A6HC 2XWBB 2PNHA 5T1GA 3VYSA 1ESRA 2OEOA 2R7ZH 1PFNA 3LWUA 5I2XA 3KLSX 1PV4A 1BCPB 4IFDI 1HCZA 4A3FB 4A4IA 5IGBA 1BKBA 3G6EA 1IHZA 2KVMA 3RZDH 1LTRD 3SHLA 1ZYRD 4JK1C 3I4NH 3I56A 1Q8IA 3TZUA 2VQEQ 1VQ6A 1XX8A 3PV0A 2AQ2B 3ICEA 2A73B 3IAYA 1EU3A 3NENA 3DMUA 2E75C 2KCTA 4PZ6A 3SK6A 4E6IA 3M85A 3NQIA 2GVBA 3T1YQ 3MZ5A 4R1JA 2QDLA 3T1YL 1XMOL 2I07B 4DNRB 2LMCB 1E24A 4A93H 3NPPA 3GTMB 1N32L 1EOTA 4ZRZA 3FHWA 1VQBA 4R4TA 1XJVA 3P75A 1EIGA 4OELB 1EQTA 4CHTB 1SROA 4A3BH 1JJ2A 3I70A 2YTVA 5JJIA 4RGOS 1PLFA 3UDGA 3C2PA 2DY8A 4HMIA 1TWCB 2CKZB 2B63G 2R93G 2F0FA 4ID6A 2JA7H 2NVQB 5LMNW 4MHEA 4GOPA 5EKLA 1UE1A 2HUGA 1D6EC 1LTLA 4P72A 5CC4A 3D3RA 3MFYA 2H1EA 1BR9A 1FNUA 1LO5D 2ZXRA 3A5ZB 3NBHA 4OO1G 4DR5L 4PZ8A 2AQ3B 3OIQA 1SRUA 1SYCA 1B9NA 1TWHH 3W1BA 5IGCA 3S14H 2JA8H 3IFTA 3OSOA 5IODA 1A2UA 2H5XA 4DGZA 2YSAA 4G4KA 2NTTA 1CI3M 5FOBB 1AZQA 1C48A 4OIJA 3A8JE 4AYBE 1LTAD 1BBXC 1XPOA 3GTOB 1JE4A 5I6WA 4IUVA 2NN6I 2ZJPA 4I65A 4JI5L 2Z1CA 2B2UA 1WD1A 3CCVA 4BBRG 1QJOA 1SNQA 3ZYYX 4AH6A 3H09A 4DKAC 4B3RL 3TS0A 3N52A 2EIFA 2N8NA 4IFDG 4DR1Q 1SFOH 2A1AA 4A3GH 4FF1A 2EVBA 3UDFA 1Y8PB 2JA8B 4GZYC 4BXXG 1G2TA 4L5QA 2EYLA 2B2VA 1TS5A 4H7BA 2BH8A 3K58A 3A8KE 5BN3A 2K75A 2A69D 1S5CD 1STAA 1LT3D 2KHIA 3M4YA 2AHOB 4LF5L 3AB9A 5IGGA 1N36L 3HKZG 2E2DC 3HFZB 1DGSA 1ASZA 3EROA 3BZKA 5FJ8G 2E2HH 4KV6A 2IX0A 1E1OA 1EY7A 2PW5A 3I4NB 4JI1L 3PIO3 3CMEA 1N34Q 1B8AA 1HTLD 4UP9A 2PQEA 4DXFA 3J80i 1HNWL 3RZOB 2QDBA 3MEHA 1S4ZA 4A75A 3H91A 2M2LA 3U50C 4QQBX 1QCBD 3C3LA 2EOTA 1YEZA 4JI6Q 3V96A 1O80A 4Z9CB 2B2WC 3GTMH 2CQAA 2OQ0A 1SMYC 3P7JA 2CW0D 2WAQE 3KJOA 1L1OB 5IGEA 1JB7A 2I46A 1QWYA 2IX1A 1FGBD 2ES2A 4JBMA 1PZID 4CKCA 5KEEA 1F2YA 2CHBD 4LJZC 4DAVA 1SJHD 1SMXA 4LF8L 2JEAI 4C3JB 5DLQE 5E3FA 1HZAA 2JA7B 5DEHA 3NHHA 3FKIB 4PV1C 4FF3A 3PO2G 5M5WH 2L12A 3ERQA 3HOVH 5GAEC 4JI7Q 5FO7B 1KNAA 3WOEA 1VMCA 1TWAH 4DXGA 3S9WA 1MGSA 3HOVG 3R2IA 2ZJQA 3BVZA 4A3LH 3PSIA 1KD1C 1I4QA 5T1IA 3J81j 2NVYH 1G8ZD 3I4MG 2EYMA 2RDHA 4A3EG 1NCVA 3QJYA 3TP8A 1V43A 4DV0Q 3HOWH 5JOBA 5C0XJ 2RVLA 1D1IA 2AKWB 2WINB 3H0GH 4CDEC 4OX9L 1ZXTA 3K80C 3JAME 2A6ED 2E2IH 1F9SA 2NVXB 3H0GG 2IJ0A 2XN9C 2G9DA 3CCSA 1DJRD 3K7UC 5FO9B 1G6PA 2E8GA 2WKDA 3FMCA 4NPSA 1EL0A 3K5OA 1YITA 1DOKA 3KYHC 4WJWA 4FO2A 3OWFA 4YIJA 4A3EH 1L0WA 4M8AA 4P74A 3IFDA 5JJLA 1PTOD 2F0PA 3CRLC 3K7AB 4JPBW 1EY6A 1Z7TA 3TN2A 1JJGA 4OL7A 2F0VA 1JT8A 4DR6L 2JA5G 2UXCQ 1PTOH 2NTSA 2QGQA 1E1TA 1S5ED 4IURA 1VQPA 5IYBG 3NYBB 2B2WA 3PMFA 3I7FA 1UAPA 4JBWA 2R7FA 1WI5A 2F0KA 1R4PB 4YCVA 4ZLTF 2L15A 4A3JG 2JYOA 1X32A 1KXLA 4CDDC 1K8OA 2JA6B 4WJ4A 1VQLA 1J5EQ 2RKSA 1SDFA 4KMUC 3ND8A 1GUNA 3X3MA 3J7YW 4A3CH 3A56A 1HPCA 3DWPA 4LAAA 4MTKA 3E9IA 1A2TA 2F0JA 4EQNA 1DONA 5C3WA 4BBRH 2QEXA 3BYYB 1N9WA 5J3BA 3M7GA 5I9OA 2ZJRA 5BR8L 5EPJA 2CFMA 3D4WA 1PH6A 3TMEA 3RLFA 2K32A 1GKHA 2PI2A 3NWTA 3HP3A 2A8VA 3KF6B 1CQFA 3S2DB 1K0RA 2C9OA 1IL8A 1CTMA 1VDZA 3PIPA 2ZTCA 2QA4A 1GUWA 2UUCQ 4LFBL 3NWSA 3F2BA 2ZM6Q 1WOCA 4BY7G 1K83B 1LTGD 4KD4A 3GO5A 1QILA 5M5XH 3OYYA 3BVGA 3S14B 4O42A 1CKMA 3MHBA 4KHVA 1EUJA 1V1QA 4TVAB 3RLOA 1JCKB 4IZ8A 4YWMA 5IP9G 2R93H 3D8GA 1II3A 3SK8A 4MIUA 4X6AH 1Z6HA 2XGTA 5AJ3L 3CCJA 1I94Q 4RWSC 1BUVT 3Q6SA 5IYCG 2QW7A 1JB3A 2I0QA 4EVOA 3TP6A 2F0NA 4ZK9B 1SNMA 4DPGA 1GUSA 5BN4A 4LK1C 5C44G 1VQHA 3ITPA 5DM73 3T56B 4DV4L 2MUYA 3KFUA 4JOIA 4NMZA 4S3SA 3ULLA 4F88A 1CK1A 2WV6D 5L37A 4DV5L 1X65A 2K14A 4LW1A 1FR3A 3P20A 4DV1L 4HSPA 2L5TA 1H9SA 2L1BA 3RLNA 1U4PA 2MHVA 4O0AA 2KCCA 3SR1A 2K28A 2E74C 3NQTA 1BDOA 3DEOA 5IWAQ 5K36G 1VQKA 1BBWA 2DJGC 4G7ZC 2IX3A 4JI1Q 3L2PA 4DAPA 3GTPH 5KNDA 4YY3L 3HKSA 1QE6A 2NZ1D 4UAIA 2RF4A 3URYA 1EQRA 2NBFA 2PI2E 2JXMB 1Y1WG 4R8NA 2PZTA 4IUNA 5IP9H 1N8RC 2F0MA 4L6TB 3IKJA 4XT1B 3EN2A 3S15B 2VUMB 2OCEA 1CHQD 2CH4W 4TRDA 1D5ZC 4HCEA 2PZWA 1QG7A 3J81L 5JVH3 4A3GB 4RCNA 4A3IG 1E3PA 4DR4Q 3Q23A 2SNSA 3FP9A 2B2YA 1Y1WB 3D6WA 1B2TA 4XQJA 4UP8A 2PO4A 2CVRA 4TQUS 2J0TD 5LL6X 4BBSB 1PYWD 4JI5Q 2Z6BA 1NNXA 5LHY1 3S16B 4K0KL 1N33L 1WJJA 3OHXC 1NAPA 3NTIA 1CKNA 3I3CA 1I94L 2K52A 1DD2A 2K4KA 3MWYW 4XXEA 3S17H 2L55A 1O7IA 1SR3A 4NXMQ 3DEPA 3S1RB 5EKKA 4MZ9A 3Q24A 3NTKA 4AYBG 1A0IA 4K6LA 3KLWA 2L4LA 2R7DA 4CGYB 3I72A 2MO0A 2UXDL 3CQZB 1LM0A 1CSQA 4R4OA 1VQFA 1WTRA 1LT4D 1SFOB 4K8IA 3PUXA 4KTAA 4L63B 1WTQA 1H95A 3H0GB 1BCPF 2K5DA 3H3VH 4UPAA 1H9JA 3KF8A 3TQYA 4PQXA 3HOZH 4N9TA 1RL2A 2E5LQ 1UEBA 2KHSA 2PMZE 1WTXA 1I6HB 1SYBA 4HIDA 2WP8J 3DWQA 4A3EB 1XYIA 3M3YH 1SE2A 1B50A 2K5NA 1KLUD 1OXXK 1TWAB 1U9RA 1B4OA 2E2HB 3X3NA 2R92B 2B63B 1K0SA 1QNUA 1VQGA 4WRDA 1HR0L 3VR5A 1PRTF 5CGKA 3LWEA 1EYAA 4Q0FA 5COYA 3O13A 1W6JA 3TSSA 2MP1A 1BO0A 1KL9A 5IYBH 4K2LA 4CJ0B 4V0BA 2KJXA 5JPNC 5IT9c 4U673 5D3DA 3I4MH 2QKIC 3BG3A 2JA6H 4QUCA 1QUQB 2NUCA 4KI0A 4MN3A 2UXBQ 3PO2B 1SNDA 1TXYA 3E3XA 1EOVA 1Q1EA 3M3YB 4K2KA 4C3JG 2I5MX 1EYGA 1TS2A 1YIJA 1STGA 2X6GA 3WWVA 2EYPA 5ELDA 2L9HA 1SLJA 1STEA 2BE5D 1E2ZA 2E76C 3PUZA 2AQ1B 1PFBA 3JC66 1MIUA 3GTJB 5HGTA 3S2HH 2VXWA 1EFWA 4DR1L 1I50H 4DK0A 3VDYA 3CC7A 1CA6A 4LF7L 2RHSB 4CKEA 1O78A 3PF5A 1IW7D 5C0XG 2JSOA 2WFWA 1EY8A 1Q90A 3LGJA 1TT2A 3MXGA 4DUYL 3TP5A 2Q8RE 4IQZA 4LUOA 4B3SL 1DM0B 4GLAC 1KTKA 1IBML 1DZ1A 3KDFB 5C3XA 4GLVB 3ER0A 1RCVD 4LUZA 1SYEA 1ZEQX 1EZ8A 4HJ8A 3H94A 4DN4M 4DV6Q 4DR2L 3JAML 1IYJB 4OIKA 3L3OC 3H3VI 1VCIA 5LMNQ 1KDCA 2EXFA 4HMJA 1GUTA 5ELEA 2EY5A 1BXTA 3A7LA 3MVVA 3JAMi 1CA5A 2LKVA 2OT2A 1JJCB 2V1CC 4HR7B 4DV1Q 3Q8DA 4BY1B 1HFNA 4X62L 2IHXA 4GKJQ 5C4HA 3PUWA 4U68A 4IJHA 5D3IB 3TREA 2EJMA 1HQRD 3J80E 4K8JA 1NUCA 1TY2A 1GVPA 1I5FA 1I4GA 1BCPD 2UUAQ 1E22A 2Z6KA 1ONLA 1HFGA 3RN5A 3CMAA 3S1MH 1GO3E 1TU2B 1DXMA 3ERSX 5ELBA 4ME3A 5KGUA 2PCFB 4LFAL 3HEJA 5C3EG 4X64Q 1NJIC 1WWGA 5G3LF 4JCVE 4JI7L 2JEBI 3DHQA 2EY6A 2NVQH 1SYDA 3NBIA 4K5XA 4C56C 1FNWA 1FL0A 3L0OA 4JVZA 4OO1I 4Y52H 4JI4Q 1VQDA 4ILWA 3I4MB 4L5RC 3KOJA 1PRTB 2HIXA 3F1ZA 5CYUA 2Y0SB 1RTOA 4C3IH 1WD0A 1G2SA 2XWJB 2RBMA 5E7NA 5ELOA 1N33Q 5C3EH 2MFIA 5IE8A 2RSOA 4A3MH 1PFSA 3OOCA 4DR3L 4YWKA 3LNNA 1LTSD 1S5BD 4KY7A 1E0BA 5CBEE 1U4RA 2NN6G 1IBKL 2UU9L 2D62A 5EBDA 1E2VA 3MXPA 4RKBA 3V05A 1SNOA 1ET9A 4K5VA 3BU2A 1T5EA 2RCFA 1PXUA 1FJGQ 2OQKA 1UE5A 4HJ5A 4TKOB 4JC0A 2PQAA 1ENAA 1FGUA 3TP7A 1HQMC 1YZ6A 3D0FA 3UDIA 5DM63 3ONAB 3E9HA 4C1NK 2ZXOA 3FDTA 5KYLA 2N78A 4OO1H 1KNEA 5J39A 3MA2B 2PNRC 2D2CC 5LMNL 2PW7A 3PGZA 2B29A 4JOIC 3EBEA 3MXNB 3K0YA 3QOJA 1JMCA 3B6YA 1PYBA 1M8AA 2Q2HA 2ATWA 3VYUA 2OWOA 2K1BA 1HTPA 3DWAA 1STNA 5M3FB 2SDFA 3T1HL 4EX5A 2VQFQ 2X6LA 1IBLL 4B3TL 4G7OC 4QIWB 4I7ZC 4GN4B 4UHVA 2EYJA 1SSOA 2B2UC 1X3QA 1SJED 1N32Q 2A74C 4NP5A 4FNFA 1TWHB 4CKBA 5DAUA 4JI3L 3GTGB 2R61A 2JK8A 5CV9A 4BXXH 2LSSA 3E5SA 4DK3C 2AWOA 3DLLA 1FYCA 4A3IB 4J6HA 2K7VA 2F1MA 3K59A 4BS9A 5IYDG 1GXDC 5C4JB 4LF8Q 4ME5A 4FF4A 3J7AF 1NMGA 3PO2H 3J81E 2F3VA 3Q0AA 3R2TA 4A3JH 4LF4Q 4IOCA 1SNPA 2WKCA 1VQ5A 4QMGA 4Y7NB 1A8VA 3M4QA 1PA6A 1DOMA 3IRBA 4APVA 1F2MA 2K5HA 3S2HB 2XTIA 3OIPA 2Q2UA 3H6MA 5IYDH 1F9QA 1SBBB 2IPKD 2CCZA 3QG1A 1EQVA 3BDLA 2K5WA 4J8QA 2Q2TA 2UXDQ 2ID0A 4K6DA 1V1PB 1K3RA 5D14A 1P8LA 1LTTD 3GTLB 5JJKA 1XWEA 2F03A 2K6AA 4BBSG 4J1MA 2D0PA 5TSSA 2KCMA 1Y1VG 2PMZB 2MNAA 2K5QA 2AUJD 1NE3A 2NVTB 3C46A 5I9PA 1TKWB 1B53A 1LACA 3CCLA 5M5YB 4C2MB 4ZCKA 5FJ8H 2FJ2A 3FPUB 1AFPA 4B3SQ 3HOWG 3K5MA 2P5ZX 1EU4A 4AIMA 3GTKB 4DR6Q 3RMHA 2ZT9C 1TWGB 4RKLA 4LF5Q 1HA5A 1A63A 1N36Q 4ODGA 4UP7A 2YV5A 3S1NB 4KK7A 2AMCB 4DR2Q 2FFKB 5C0XI 1AP0A 2B63H 4CDFC 4NDXA 4JV5L 5M9OA 4A3DG 4RFBA 5J22A 4C3JH 1KRTA 4A3KH 3TBIB 2FMMA 1M90C 4ZKBB 2DJFC 5ELCA 2K05A 1QUQA 4F87A 3AEVA 4IPGA 3K81C 3PO3G 3E0EA 5EKIA 3AFPA 4K0KQ 2DUDA 1K8GA 1Q46A 4O2DA 4JBJA 3LX0A 1KABA 2R92H 4V190 3J7A5 4NXNQ 1CT1D 1YNXA 4JI8L 1H9MA 5M5WB 1VQMA 1VQAA 5CV6A 2E2JH 2N49A 4QF4A 2EDGA 4KJOA 1A6BB 1WTPA 3OW7A 4JI0L 4A3FH 1B44D 3STBC 1CSPA 4UY8C 1Q3LA 3J81c 1V1PA 1WWFA 1K3BC 3GTJH 3CCRA 1YNJC 1AZPA 4HSVA 4FXKC 2LXJA 3MXNA 3VA7A 4IJLA 3GP7A 1KDAA 1NMFA 5I2YA 3NP8A 1HH2P 4HJAA 1EEID 2RCNA 3F2CA 2OTLA 1WTOA 1U4LA 3DM1A 3QO2A 5C6AA 4KHPL 1ESFA 1A3TA 2RA4A 1J8IA 5HURA 1STHA 2SEBD 2EYOA 4EQOA 5CMDA 2VW9A 4XTCS 5ELFA 4XYOA 4ZAIA 1PH3A 2JA9A 1HZ9A 1YBYA 4BY1G 1HJPA 3EIVA 1SAPA 1VS0A 3CHBD 3ND9A 1SYGA 4QJFA 2NB0A 5C4XH 2SNMA 3QOLA 4ZKCB 4G7HC 2B2YC 2VB3X 1F2ZA 1KDBA 5DNFA 5GROA 1QOHA 4YCUA 2B2TC 1R9TH 4DUZL 4PMBA 3OW2A 3VYRA 4OWXB 4L5TA 2BH2A 1IBLQ 3EVQA 3NEMA 2ICEC 4JW0A 2HHHL 4QCLA 1GUGA 3DXJC 2SOBA 3G7LA 3EQLC 1AEXA 1P16A 2ZTEA 4JV5Q 2F0LA 3EA6A 2IY5B 1L2FA 3I8ZA 5EPKA 1Q12A 3OMGA 3P1HA 1D7QA 2K04A 4MTNA 2KCNA 3CCQA 4IUPA 3J81i 5A35A 1YHQA 2VUMH 3S15H 2ALYB 3HOXB 3SE0A 4K5WA 2VQFL 1J5EL 4B3TQ 1XNQQ 2KECA 2CH4A 1G6ZA 3KBXA 2EJGC 4X66L 1MSGA 2H4OA 3SK5A 1OXVA 3KBGA 4WJ3M 1PTOF 1G51A 3RNUA 4OWWB 2J4XA 1C9OA 4JI4L 1IKMA 2YYZA 2EY1A 1A3UA 2O5JC 4DU9A 1X3FA 3EJIA 3CCMA 1WCMG 1DOLA 4X64L 1VQ7A 4O1NA 3CC2A 3NXWA 4POGA 4I7AA 5C3EB 5GADC 1F9PA 2OF1A 2EXZA 4B9XA 1KQSA 2JE6I 4C3HH 5M3MB 4BY7B 2LS01 3H15A 2F0HA 2MPMA 5G3LD 2N55A 4IPCA 1A6XA 3PO3H 3BJUA 1RDPD 2MO1A 1Y14B 3HZXA 2HT1A 3UE1A 2WAQG 2Z9HA 2FMCA 5EQ0A 3PF4A 4DK1A 2JA5H 5IYCH 1AH9A 2A6HD 3RZOH 5EGTA 1JOQA 1SE8A 2JA7G 1D5XC 1Q8KA 1Y69U 1MKHA 1JOOA 1VMPA 5D65A 5FLXE 3F2DA 2D5DA 2E5LL 1PVOA 2DGYA 5C4JH 3DM3A 3QR8A 1U4MA 4DV7Q 3GQBA 2HDMA 1ASYA 5IY0A 1WTVA 5ISRA 3AFQA 1CQVA 2Z4HA 2IHEA 3GTPB 3VR4A 1F77A 2F4IA 1J6QA 1MI2A 4UDUC 4JI6L 3R93A 4X62Q 1GHJA 1WCMH 4GNXB 1PRTD 4IO9A 1EWCA 2KENA 1HXYD 4XDXA 4DA2A 4LF6Q 3HGBA 4DAYB 1BNZA 2WB1E 1AE3A 1Y1WH 1JORA 3FKIH 2O2LD 2XNAC 3S2DH 4HJ9A 3HS0C 2G5DA 1I6VC 2O4XA 3PIOA 5A2QL 4B3MQ 3L7ZC 1PH5A 3I4NG 4HAEA 3I4OA 5NUCA 1KHIA 3T1HQ 5C0XH 1TWGH 1TS4A 5HY6A 3ULPA 1EYDA 3W2DA 4LMQD 1ICWA 5M3MG 3HOXH 3KJPA 3TRZA 4HCSA 4ABNA 4A93G 3K6OA 2K50A 4HEDA 4C2MH 1YI2A 1VQ4A 1EYCA 1I4HA 1S40A 2N3SA 2VB2X 1ENFA 3HOYG 1X3PA 4QY7A 4R4CA 3I55A 3BYTB 1ESKA 1HR0W 2IWHA 1CZGA 4H44C 3KLSA 1K8MA 4YHHL 1LV9A 5GAHC 1I4XA 4K14A 2Z0SA 4AQYQ 1L1OC 2A19A 1SE4A 3HOUG 4Q5VA 1FJGL 1HZCA 4BWGB 4R8IA 3NE5B 4IUQA 5C4ZA 5M3MH 2GVAA 4IUTA 1SXTA 4BY7H 2Z6KC 1HHVA 3T4AC 3GTOH 1PH9A 3QB3A 1A15A 1PH4A 5LMUL 1YJWA 5FLMG 3PUYA 2M9VA 5I4DA 4AQYL 2Z8LA 1L0XB 1R4QB 2IT1A 4CBVA 1D2BA 1RD9D 4GNXA 1YNND 4LNQA 2NVTH 1LLRD 4L8JA 4JYAQ 3SXHA 1FNVA 2F0DA 4DV4Q 1ZYRC 1S5FD 1OXUA 5M5YH 4A3FG 4DR7L 4IOAA 4HIKA 1NR4A 3FEWX 2E2JB 1U6PA 1X56A 1YJNA 3A0JA 3AU7A 4X3SA 1G91A 4IPDA 3K8AA 3VR6A 4JBKA 1Q3YA 1WWDA 3T13A 4JI3Q 2NZOA 4KKTA 2BCOA 5IWAL 2R7ZB 1D1KA 5K5PA 1UWVA 2NYZD 5JPMC 1B1ZA 2UUAL 1HRJA 3I2ZA 1I3QB 1WVLA 3S24A 4P73A 1X54A 2VQEL 5J1ZA 2QCPX 4H13C 4JI2L 3R3OA 1WFQA 4CDCC 1DYQA 1EWIA 1TY0A 3E6ZX 4GKJL 1EIYB 4P2CB 2AWNA 3GV3A 2VNUD 3HOUB 4DFAA 4FVMA 1M4VA 4QIWE 1SMYD 1ZKOA 3A54A 2HQEA 3PCOB 1A3VA 4BBSH 4JI8Q 4M1UB 4A3DB 2R93B 5IP7G 1PH7A 2I5LX 2F52A 4DV2Q 3KLRA 1O7ZA 1L0YB 3RZDB 1Q3ZA 3IL8A 3A5UA 2BDOA 1SYFA 4C3HG 3AYHB 3CRKC 3V2TA 5ELNA 1XNRL 4RGNA 3UI2A 1QZHA 1WYDA 3HG9A 2MQHA 3U9SA 5CORA 1R9TB 1K9MC 3A55A 4JI0Q 3D6CA 2HIVA 1WTHA 4NXNL 5IOCA 1CM9A 4WFN3 1IW7C 3CP0A 1OXTA 1KAAA 2F0EA 1EWHA 1PHJA 1A1TA 1PH2A 1JE5A 4DNIA 1GOZA 2DNEA 4ZUJA 5EBCA 1GD7A 1Y8NB 2N88A 1VQCA 2Z4IA 2O5IC 2HDLA 4DNTB 4A76A 1AW7A 4A3BB 4IFDH 5CR3A 2F0IA 4FP5D 1BBUA 1XXGA 4BA1I 3HOWB 3RUZA 3DUZA 1SE3A 2WB1G 1I6HH 2EQSA 2AUKA 1N34L 1QNKA 5E4WC 1IYUA 1YVCA 1KLGD 1K8AC 2FXQA 3I4LA 4X65L 1YJ9A 3W1GA 3TS2A 1FD7D 1PZJD 1VQIA 5CV7A 1PMRA 2B2TA 1PTOC 5GAGC 1QVFA 3M4PA 1ILPA 4L5SA 1AAFA 4OONA 5EAYA 1O7LA 1EY4A 3I90A 4NB3A 1FVIA 2RQXA 3T53B 4C1NI 5KRUA 1H9KA 1B3AA 4QL5A 4ZQ3A 1Y8OB 2VS1A 2E2IB 2Y0SG 2HHHQ 2CQFA 1X6OA 2NVXH 3WDNA 2F0GA 2WIIB 1DCZA 3MTSA 4GN3B 4DV5Q 2PYKA 4OXPA 1MHWC 2M3ZA 1OTCA 1JR0D 1MJEA 2HCCA 2DNCA 4RHSA 4LF4L 3RD4A 3SK4A 4Y7NH 4LF6L 1JWSD 1UE7A 2BOSA 3I73A 1KC8C 1XPUA 1VQEA 1RIPA 2BDNA 1W6KA 3CPFA 4CJ2C 1HUMA 4N8X1 5FO8B 2PQAB 3NTHA 4XYQA 1LTID 3D31A 1CKOA 5FK9C 3PQIA 1ILQA 2L4NA 4GNXC 4OEMB 1LT5D 4KKUA 2XSCA 4DF7A 3RN2A 2IW3A 3CCEA 5C44B 4RMFA 5AJ3Q 4EGVA 2UUCL 4LFBQ 1HUNA 2G9HD 4IN3A 2B8FA 2NN6H 1TWCH 2EPBA 2F4VL 1STYA 1TVXA 3HOYH 3HOVB 1VQJA 3G71A 4C3HB 4LF7Q 1TWFH 4DV3Q 1D8LA 2KBNA 1STBA 4HN7A 2V4DA 3PIP3 3BVMA 2R6GA 4DV6L 1RF2D 1F2LA 4BY1H 3KK7A 3U4VA 1VF7A 4R9WA 5C5MA 4X65Q 2B2VC 2K33A 3K5LA 3VA5A 2R7ZG 2ZM6L 1EZ6A 1F6UA 4ULLA 3GTQB 4XT3B 4YHHQ 1OO9B 1JC7A 4A3IH 1IBMQ 4KY5A 1JOKA 3N6RA 2ICIA 1IYVA 4LFCL 4FXDA 2NWGA 3PO3B 2C35B 2C5CA 3GTKH 1RTNA 3CF5A 4OGQC 3STBD 3GTGH 4PZ7A 3RR5A 3NK9A 1CFMA 1TWFB 4GKKQ 1SN8A 2F0QA 4GOPC 3OPOA 4N9PA 4A3CG 5C5LA 2VUMG 2YTXA 3M7NA 1BVSA 2Q8IB 1E7ZA 1V1OA 4KHZA 3CC4A 2B8GA 4YWLA 2K01A 1V9PA 4LFCQ 2LXKA 2RDGA 2NVYB 1GHKA 1ICFB 2FINB 1WWEA 2EXDA 2CWAA 4FYDA 5JVG3 5A2QE 3D4DA 4POFA 2B39A 3BDCA 1NY4A 3M4OH 1J9OA 1LUZA 3ZJYC 3KDFA 3F8TA 5FKAC 2A6EC 2Q8TA 3G6JB 1V8QA 5FLXc 1MJCA 1GM5A 5K36H 2A68C 3D4RA 1HA6A 3K0XA 2HQLA 2D9UA 2F0OA 1B70B 4DAMA 3A7AB 4J15A 4JI2Q 3MAQA 1ML0D 3K57A 1VQOA 3JAMc 1SNCA 1BF4A 2ENBA 4HJ7A 1B7YB 5FLMH 3GDEA 5GQOA 4FXGC 4DR3Q 1VQ9A 4F7XA 1MSHA 4GOPB 3S1NH 4CJ1B 3UDXA 2TSSA 2J7ZA 5JJZA 1UNSA 2QILA 2XVSA 3CAMA 2EC7A 3SVMA 3TDQA 4RAUC 3AMUA 3S16H 2OTJA 1B3QA 2L11A 1Z9FA 3U9OA 1BQQT 2PZUA 5IIFA 2YU9B 1RJTA 1NBWA 1VF5C 1Z47A 3S17B 3AQQA 3NELA 4AYBB 3ULJA 2R3ZA 4DV0L 1X9NA 2F0UA 3PUVA 5I6YA 3QIAA 2WACA 1X55A 3HOZG 3S1QB 5LMUQ 1O7YA 4KJNA 4IALA 4P75A 2X69A 3FKIG 3OTOL 2CW0C 4BA2I 1D5MC 3C1FA 4MNOA 3CQZH 1LTBD 1M1KC 4KN4C 1IZ6A 5C4XB 2BE5C 4IUUA 3NBHB 3HOXG 4IFDJ 4XQNA 2JJQA 4PMWA 3MC0B 1K73C 3K7AH 3S1RH 1EY0A 1YHBA 2ASBA 4DAYA 1HZBA 1KRSA 3CCUA 3T16A 3BZDB 4H0LC 4XQQA 5AFWA 5IP7H 1G291 2KHJA 3FRPB 4P71A 3TEHB 5M5XB 2VY3A 3GTQH 1S3OA 2VL6A 4A3JB 4YY3Q 1BJ6A 4H02A 2RDFA 3FVQA 4B3ML 4X3TA 3SDZA 5KNCA 4PG3A 3A74A 1Q81C 2ZTDA 2I5HA 4GKKL 1I3QH 2QF7A 3KF8B 3OMCA 1EY9A 1BOSA 2NZHA 1IKLA 2EYHA 1NSNS 1AN8A 5KNBA 4OWTB 1PTOB 1OXSC 1QZGA 1T5XD 1TS3A 2F3WA 3KUPA 1QVCA 1PFMA 5IT9E 1I4PA 2QEJC 5IGDA 2CWPA 3J7AV 1U5KA 1TR5A 1KIXA 2EY2A 4DV2L 2B3GA 4DR5Q 4LFAQ 5FLXL 1QB5D 1EY5A 3I91A 4EQPA 1PRTC 5F2DA 5EPLA 4R4QA 4ZUIA 3S1MB 1ET6A 3G48A 5KIXA 4JG2A 4B3RQ 4A3LG 1YHAA 3L9AX 3U58A 4KY6A 2LFNA 5CV4A 1JWUD 2A5HA 4A93B 4A3DH 2FHTA 3KF6A 1W2BA 5HGQA 1XTCD 3HOYB 4KN7C 3NSWA
chains in the Genus database with same CATH topology
4BY7H 1IXRA 2Z6KC 4IPHA 2UUBQ 4EQ5A 5C0XJ 1FGUA 5H1SE 3GTOH 2AKWB 1PH9A 3H0GH 1YZ6A 3D0FA 4OX9L 3K80C 3UDIA 2E2IH 2YU9H 4R4IA 3E9HA 1PH4A 5LMUL 1YJWA 3U4ZA 5FLMG 3H0GG 3PUYA 3CCSA 4AQYL 2N78A 3K7UC 1G6PA 2IT1A 2E8GA 1A62A 4NPSA 4GNXA 4LNQA 2NVTH 1YITA 3KYHC 1KAWA 4JYAQ 5LMNL 5M3FG 4DV4Q 1L0WA 4A3EH 3PGZA 1XPRA 2B29A 1OXUA 5M5YH 1U0LA 4P74A 4A3FG 4DR7Q 4JOIC 3EBEA 3MXNB 4DR7L 4HIKA 4IOAA 5JJLA 2UUBL 1JMCA 2Y0SE 1U6PA 1X56A 3B6YA 2F3IA 3A0JA 1LYLA 1PYBA 1YJNA 1JJGA 2ATWA 2Q2HA 4IPDA 5JEAJ 4YCWA 3K8AA 2OWOA 4JBKA 4DR6L 1JT8A 1Q3YA 2JA5G 1WWDA 4JI3Q 2UXCQ 2NZOA 3T1HL 4EX5A 2VQFQ 2QGQA 1E1TA 4HIMA 1IBLL 4B3TL 1XNQL 1VQPA 4GN4B 5IWAL 5IYBG 3NYBB 1UWVA 3J80c 3I7FA 2UUAL 4JBWA 2R7FA 3I2ZA 1S72A 1WI5A 4LWCA 4RG1A 1N32Q 4YCVA 4A3JG 2L15A 3S24A 4P73A 1X54A 2VQEL 1Q82C 1KXLA 3TS2A 4WJ4A 1VQLA 2BA1A 4JI2L 4JI3L 2UXCL 1WFQA 1J5EQ 1EWIA 4GKJL 1X3GA 1EIYB 4A3CH 2AWNA 2JK8A 3CPWA 1Q86C 4BXXH 2VNUD 2LSSA 4DK3C 4QGUA 3E9IA 2AWOA 4DK6C 3DLLA 3SGIA 4BBRH 4QIWE 2QEXA 1C0AA 4DR4L 1XTDA 1N9WA 3PCOB 5J3BA 2JA6G 4BBSH 4JI8Q 5BR8L 2ZJRA 5IYDG 5IP7G 1XMQQ 5M3FH 2CFMA 1PH7A 1HNZL 3CD6A 2I5LX 2F52A 4DV2Q 4LF8Q 1PH6A 1HNZQ 3RLFA 4NXML 3GTLH 1GKHA 1NMGA 2PI2A 3PO2H 2A8VA 1Q3ZA 3A5UA 3KF6B 1PH1A 3AYHB 4A3JH 4LF4Q 1K0RA 4IOCA 5ELNA 1EIFA 1W3SA 1XNRL 3PIPA 4FDBA 2ZTCA 1XNRQ 1QZHA 1WYDA 2GN5A 2MQHA 2QA4A 1K9MC 4JI0Q 4KLKA 2UUCQ 4LFBL 3F2BA 1VQ5A 3GD7A 2HIVA 2ZM6Q 1WOCA 4KHPQ 1A8VA 4BY7G 5C44H 3M4QA 4NXNL 1PA6A 1CUKA 3GO5A 4ALPA 3IRBA 5M5XH 4A3GG 3OYYA 2F4VQ 4APVA 1Q1BA 2UU9Q 1C7YA 3CP0A 1CKMA 1OXTA 2IHFA 1EUJA 1V1QA 2K5HA 1PHJA 4DV3L 1X3EA 2XTIA 1A1TA 1PH2A 1JE5A 4DNIA 2Q2UA 4TVAB 5IYDH 3RLOA 4YWMA 1GD7A 2CCZA 5IP9G 2UXDQ 4DUYQ 2Q2TA 2R93H 1VQCA 2ID0A 1MFSA 4X6AH 1K3RA 2XGTA 5AJ3L 3CCJA 1P8LA 4A76A 4A3KG 1I94Q 5JJKA 4OX9Q 5IYCG 4BBSG 1BBUA 2D0PA 2I0QA 1IL2A 3OTOQ 2KCMA 4BA1I 1Y1VG 2MNAA 1NE3A 4DPGA 2WB1G 4GLXA 3S1QH 3CXCA 1I6HH 2EQSA 5C44G 2LI8A 1VQHA 3UE0A 3W5OA 1N34L 3CCLA 5FJ8H 3G4SA 1YVCA 4JYAL 4A3BG 1K8AC 4DV4L 2JA8G 2FXQA 2CQOA 2Q2IA 4X65L 4JOIA 3W1GA 1YJ9A 1XMOQ 4B3SQ 3ULLA 1NTGA 2R92G 3HOWG 3CW2C 4DV5L 1X65A 2K14A 4AIMA 1VQIA 4LW1A 4DR6Q 5GAGC 1QVFA 4LUVA 3M4PA 4DV1L 4HIOA 4L5SA 3RLNA 2B63H 1AAFA 4OONA 4LF5Q 5EAYA 3J7ZC 1A63A 4O0AA 4NB3A 1N36Q 1FVIA 3HOUH 4DUZQ 2RHQB 4UP7A 2YV5A 5IWAQ 5K36G 5JEAG 1VQKA 1BBWA 4QL5A 1PH8A 2AMCB 4DR2Q 4JI1Q 3L2PA 5C0XI 3GTPH 2VS1A 1Y1VH 2Y0SG 3MEFA 1T9HA 3HKSA 4YY3L 4DV7L 2HHHQ 2RF4A 1X6OA 2YTYA 2NVXH 1EQRA 4A3DG 2PI2E 4JV5L 2CQFA 2JZWA 4C3JH 4GN3B 1KRTA 4DV5Q 4A3KH 1Y1WG 1UE6A 4OXPA 1Q7YC 1M90C 1PYSB 2JQOA 3M9BA 5IP9H 1N8RC 2M3ZA 5C4XG 1QUQA 1OTCA 3AEVA 1L1OA 3HKZE 1MJEA 4IPGA 3EN2A 3BZCA 3K81C 3PO3G 1VQ8A 3E0EA 4LF4L 2OCEA 4Y7NH 3AFPA 4K0KQ 2DUDA 4LF6L 1UE7A 1K8GA 1KC8C 1XPUA 1Q46A 2K5VA 4O2DA 4JBJA 1VQEA 1HR0Q 1RIPA 3CPFA 1EQQA 5BR8Q 2R92H 1CKNB 4A3IG 4NXNQ 3J7A5 1E3PA 2D0OA 4DR4Q 1VQNA 1YNXA 4JI8L 3FP9A 2PQAB 1VQMA 1XMQL 1AE2A 1VQAA 2E2JH 2N49A 4UP8A 3D31A 1CKOA 4TQUS 1A6BB 4GNXC 4JI5Q 4XIGS 4K0KL 1N33L 4JI0L 4A3FH 1WJJA 3STBC 4X66Q 1CSPA 3RN2A 4LF9L 2BA0A 3CCEA 4A3MG 4UY8C 1K83H 4RMFA 3J81c 2UXBL 4LF9Q 5AJ3Q 1WWFA 1CKNA 2UUCL 4LFBQ 1I94L 1QVGA 3GTJH 1IBKQ 2K52A 1TWCH 2F4VL 2K4KA 3CCRA 3S17H 4GN5A 3HOYH 1VQJA 3G71A 1O7IA 1SR3A 4LF7Q 2LXJA 2VZAA 4NXMQ 1TWFH 4DV3Q 4IJLA 1D8LA 2KBNA 1HNXQ 4MZ9A 1NMFA 2R6GA 1HNXL 4AYBG 4DV6L 4BY1H 3U4VA 1HH2P 4GS3A 1A0IA 4HJAA 3KLWA 2RCNA 4X65Q 2R7DA 2L4LA 3F2CA 2PNHA 2MO0A 2OTLA 2UXDL 1LM0A 4DV0Q 2ZM6L 2R7ZG 1CSQA 1F6UA 4KHPL 4R4OA 4YHHQ 1VQFA 4A3IH 1IBMQ 2R7ZH 2VW9A 4XTCS 3PUXA 1PV4A 1H95A 4IFDI 1PH3A 2JA9A 3H3VH 1HZ9A 4UPAA 1YBYA 4BY1G 4A4IA 1HJPA 3EIVA 3TQYA 1BKBA 1VS0A 3G6EA 3HOZH 1RL2A 2E5LQ 4LFCL 1UEBA 4QJFA 5C4XH 3RZDH 2PMZE 2C35B 3GTKH 3CF5A 3I4NH 3GTGH 3STBD 3I56A 4PZ7A 3RR5A 4HIDA 2WP8J 2VQEQ 5GROA 4GKKQ 1SN8A 4YCUA 4GOPC 1VQ6A 1R9TH 3PV0A 3ICEA 3M3YH 4A3CG 4DUZL 3OW2A 2K5NA 3NENA 2VUMG 2YTXA 4OWXB 1OXXK 3M7NA 4L5TA 1BVSA 2KCTA 4PZ6A 1IBLQ 1E7ZA 2BH2A 4KHZA 3M85A 3NEMA 3CC4A 4YWLA 1V9PA 2HHHL 1VQGA 2GVBA 3T1YQ 1HR0L 4R1JA 4LFCQ 3T1YL 2LXKA 1XMOL 1P16A 2ZTEA 1E24A 4A93H 4JV5Q 1N32L 3FHWA 1VQBA 4R4TA 2IY5B 1L2FA 1XJVA 1KL9A 1Q12A 5IYBH 1WWEA 1D7QA 4MTNA 2EXDA 2CWAA 3CCQA 3J81i 1YHQA 2VUMH 3S15H 1SROA 2ALYB 4A3BH 2VQFL 1J5EL 1JJ2A 4B3TQ 2YTVA 5IT9c 1XNQQ 5JJIA 4POFA 3M4OH 1NY4A 3UDGA 3I4MH 1LUZA 3ZJYC 2JA6H 2CKZB 4X66L 3KDFA 1QUQB 3F8TA 4KI0A 2B63G 2R93G 1OXVA 2UXBQ 1TXYA 5FLXc 2JA7H 1MJCA 5LMNW 1EOVA 1Q1EA 4GOPA 1UE1A 1GM5A 4WJ3M 4P72A 1LTLA 1G51A 2HQLA 3K0XA 3RNUA 2I5MX 1B70B 4DAMA 1C9OA 1EYGA 4JI4L 4OWWB 1YIJA 2YYZA 4J15A 4JI2Q 3WWVA 1VQOA 4OO1G 3A5ZB 3JAMc 1SLJA 4DR5L 4PZ8A 4HJ7A 1X3FA 1B7YB 1SRUA 3PUZA 5FLMH 1TWHH 3GDEA 3CCMA 1WCMG 5GQOA 3W1BA 4X64L 1VQ7A 3CC2A 3S14H 4DR3Q 3JC66 1VQ9A 1MIUA 4POGA 2JA8H 5GADC 2H5XA 4GOPB 3S1NH 3UDXA 3S2HH 2YSAA 1EFWA 1KQSA 3CAMA 2JE6I 4C3HH 4DR1L 2EC7A 1I50H 4AYBE 3S16H 2OTJA 3H15A 3VDYA 3CC7A 4LF7L 1Z9FA 1XPOA 2RHSB 2NN6I 4IPCA 3PF5A 2ZJPA 5C0XG 3BJUA 3PO3H 2WFWA 1NBWA 4JI5L 1Z47A 3LGJA 3AQQA 3NELA 2MO1A 1Y14B 4DUYL 2HT1A 3ULJA 4DV0L 3CCVA 3UE1A 1X9NA 3PUVA 4LUOA 2WAQG 4BBRG 4B3SL 4AH6A 3PF4A 1X55A 3HOZG 4DKAC 4B3RL 4GLAC 5LMUQ 3TS0A 2JA5H 5IYCH 1AH9A 2EIFA 2N8NA 1IBML 3RZOH 3KDFB 4IFDG 4P75A 4DR1Q 1SFOH 1SE8A 2JA7G 2A1AA 3FKIG 1Q8KA 4GLVB 3ER0A 3OTOL 4LUZA 4A3GH 1MKHA 4BA2I 4MNOA 3F2DA 3CQZH 3UDFA 4HJ8A 4DV6Q 4BXXG 4DR2L 1M1KC 1IYJB 3H3VI 2E5LL 1IZ6A 4L5QA 1VCIA 1PVOA 2DGYA 5C4JH 5LMNQ 2BH8A 3DM3A 3NBHB 4DV7Q 2EXFA 3HOXG 2K75A 4IFDJ 2JJQA 4PMWA 1K73C 2KHIA 1ASYA 3K7AH 5IY0A 3S1RH 3JAMi 3AFQA 2IHEA 1YHBA 2AHOB 4LF5L 2ASBA 1HZBA 1KRSA 3CCUA 1JJCB 2V1CC 4DV1Q 1N36L 3Q8DA 3HKZG 3HFZB 1ASZA 1J6QA 1DGSA 4X62L 4JI6L 2IHXA 3BZKA 5FJ8G 5IP7H 2E2HH 1G291 2KHJA 4GKJQ 4X62Q 1WCMH 3PUWA 2IX0A 1E1OA 4GNXB 4IO9A 4IJHA 4JI1L 3TREA 2KENA 3CMEA 1N34Q 4LF6Q 1B8AA 4DAYB 2WB1E 4P71A 3TEHB 4UP9A 1AE3A 2VY3A 3GTQH 1S3OA 1GVPA 2VL6A 3FKIH 1I5FA 1Y1WH 3S2DH 4HJ9A 3J80i 4YY3Q 1HNWL 2UUAQ 1BJ6A 1E22A 4H02A 4B3ML 2Z6KA 3RN5A 3PIOA 3CMAA 3S1MH 4B3MQ 4PG3A 1GO3E 3A74A 4A75A 2ZTDA 3L7ZC 2I5HA 1Q81C 1PH5A 4GKKL 3ERSX 3I4NG 1I3QH 4ME3A 3KF8B 3U50C 4QQBX 3I4OA 1YEZA 2NZHA 4JI6Q 4LFAL 1KHIA 3T1HQ 1HNWQ 3GTMH 2OQ0A 1TWGH 2WAQE 4OWTB 5HY6A 5C3EG 4X64Q 3ULPA 1NJIC 3KJOA 1WWGA 1L1OB 1OXSC 4JCVE 1QZGA 2JEBI 1JB7A 4JI7L 1QVCA 2NVQH 2IX1A 5M3MG 3HOXH 2ES2A 4JBMA 1FL0A 3L0OA 2CWPA 4OO1I 3KJPA 4Y52H 3TRZA 4JI4Q 1U5KA 1VQDA 4A93G 4C2MH 2K50A 1KIXA 4L5RC 1YI2A 1SMXA 3KOJA 2HIXA 1VQ4A 4DV2L 4LF8L 1S40A 2B3GA 2N3SA 3F1ZA 2JEAI 4DR5Q 5DLQE 4LFAQ 3HOYG 4C3IH 1HZAA 3KFUA 3I55A 4QY7A 4R4CA 5E7NA 3PO2G 5ELOA 5M5WH 5C3EH 1N33Q 1HR0W 1ESKA 2MFIA 5IE8A 3HOVH 5GAEC 4A3MH 1PFSA 4R4QA 4JI7Q 4DR3L 4YWKA 3G48A 1TWAH 4JG2A 4B3RQ 3HOVG 4A3LG 1YHAA 3U58A 4YHHL 2ZJQA 2NN6G 1IBKL 2UU9L 5GAHC 2D62A 4A3LH 2Z0SA 3PSIA 4AQYQ 1L1OC 2A19A 1KD1C 3J81j 3HOUG 3BU2A 2NVYH 1FJGL 1HZCA 3I4MG 4A3DH 3KF6A 1W2BA 5HGQA 4A3EG 1FJGQ 2OQKA 1UE5A 4HJ5A 1V43A 5M3MH 2GVAA 3HOWH 4JC0A 2PQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY7 H;  1IXR A;  2Z6K C;  4IPH A;  2UUB Q;  4EQ5 A;  5C0X J;  1FGU A;  5H1S E;  3GTO H;  2AKW B;  1PH9 A;  3H0G H;  1YZ6 A;  3D0F A;  4OX9 L;  3K80 C;  3UDI A;  2E2I H;  2YU9 H;  4R4I A;  3E9H A;  1PH4 A;  5LMU L;  1YJW A;  3U4Z A;  5FLM G;  3H0G G;  3PUY A;  3CCS A;  4AQY L;  2N78 A;  3K7U C;  1G6P A;  2IT1 A;  2E8G A;  1A62 A;  4NPS A;  4GNX A;  4LNQ A;  2NVT H;  1YIT A;  3KYH C;  1KAW A;  4JYA Q;  5LMN L;  5M3F G;  4DV4 Q;  1L0W A;  4A3E H;  3PGZ A;  1XPR A;  2B29 A;  1OXU A;  5M5Y H;  1U0L A;  4P74 A;  4A3F G;  4DR7 Q;  4JOI C;  3EBE A;  3MXN B;  4DR7 L;  4HIK A;  4IOA A;  5JJL A;  2UUB L;  1JMC A;  2Y0S E;  1U6P A;  1X56 A;  3B6Y A;  2F3I A;  3A0J A;  1LYL A;  1PYB A;  1YJN A;  1JJG A;  2ATW A;  2Q2H A;  4IPD A;  5JEA J;  4YCW A;  3K8A A;  2OWO A;  4JBK A;  4DR6 L;  1JT8 A;  1Q3Y A;  2JA5 G;  1WWD A;  4JI3 Q;  2UXC Q;  2NZO A;  3T1H L;  4EX5 A;  2VQF Q;  2QGQ A;  1E1T A;  4HIM A;  1IBL L;  4B3T L;  1XNQ L;  1VQP A;  4GN4 B;  5IWA L;  5IYB G;  3NYB B;  1UWV A;  3J80 c;  3I7F A;  2UUA L;  4JBW A;  2R7F A;  3I2Z A;  1S72 A;  1WI5 A;  4LWC A;  4RG1 A;  1N32 Q;  4YCV A;  4A3J G;  2L15 A;  3S24 A;  4P73 A;  1X54 A;  2VQE L;  1Q82 C;  1KXL A;  3TS2 A;  4WJ4 A;  1VQL A;  2BA1 A;  4JI2 L;  4JI3 L;  2UXC L;  1WFQ A;  1J5E Q;  1EWI A;  4GKJ L;  1X3G A;  1EIY B;  4A3C H;  2AWN A;  2JK8 A;  3CPW A;  1Q86 C;  4BXX H;  2VNU D;  2LSS A;  4DK3 C;  4QGU A;  3E9I A;  2AWO A;  4DK6 C;  3DLL A;  3SGI A;  4BBR H;  4QIW E;  2QEX A;  1C0A A;  4DR4 L;  1XTD A;  1N9W A;  3PCO B;  5J3B A;  2JA6 G;  4BBS H;  4JI8 Q;  5BR8 L;  2ZJR A;  5IYD G;  5IP7 G;  1XMQ Q;  5M3F H;  2CFM A;  1PH7 A;  1HNZ L;  3CD6 A;  2I5L X;  2F52 A;  4DV2 Q;  4LF8 Q;  1PH6 A;  1HNZ Q;  3RLF A;  4NXM L;  3GTL H;  1GKH A;  1NMG A;  2PI2 A;  3PO2 H;  2A8V A;  1Q3Z A;  3A5U A;  3KF6 B;  1PH1 A;  3AYH B;  4A3J H;  4LF4 Q;  1K0R A;  4IOC A;  5ELN A;  1EIF A;  1W3S A;  1XNR L;  3PIP A;  4FDB A;  2ZTC A;  1XNR Q;  1QZH A;  1WYD A;  2GN5 A;  2MQH A;  2QA4 A;  1K9M C;  4JI0 Q;  4KLK A;  2UUC Q;  4LFB L;  3F2B A;  1VQ5 A;  3GD7 A;  2HIV A;  2ZM6 Q;  1WOC A;  4KHP Q;  1A8V A;  4BY7 G;  5C44 H;  3M4Q A;  4NXN L;  1PA6 A;  1CUK A;  3GO5 A;  4ALP A;  3IRB A;  5M5X H;  4A3G G;  3OYY A;  2F4V Q;  4APV A;  1Q1B A;  2UU9 Q;  1C7Y A;  3CP0 A;  1CKM A;  1OXT A;  2IHF A;  1EUJ A;  1V1Q A;  2K5H A;  1PHJ A;  4DV3 L;  1X3E A;  2XTI A;  1A1T A;  1PH2 A;  1JE5 A;  4DNI A;  2Q2U A;  4TVA B;  5IYD H;  3RLO A;  4YWM A;  1GD7 A;  2CCZ A;  5IP9 G;  2UXD Q;  4DUY Q;  2Q2T A;  2R93 H;  1VQC A;  2ID0 A;  1MFS A;  4X6A H;  1K3R A;  2XGT A;  5AJ3 L;  3CCJ A;  1P8L A;  4A76 A;  4A3K G;  1I94 Q;  5JJK A;  4OX9 Q;  5IYC G;  4BBS G;  1BBU A;  2D0P A;  2I0Q A;  1IL2 A;  3OTO Q;  2KCM A;  4BA1 I;  1Y1V G;  2MNA A;  1NE3 A;  4DPG A;  2WB1 G;  4GLX A;  3S1Q H;  3CXC A;  1I6H H;  2EQS A;  5C44 G;  2LI8 A;  1VQH A;  3UE0 A;  3W5O A;  1N34 L;  3CCL A;  5FJ8 H;  3G4S A;  1YVC A;  4JYA L;  4A3B G;  1K8A C;  4DV4 L;  2JA8 G;  2FXQ A;  2CQO A;  2Q2I A;  4X65 L;  4JOI A;  3W1G A;  1YJ9 A;  1XMO Q;  4B3S Q;  3ULL A;  1NTG A;  2R92 G;  3HOW G;  3CW2 C;  4DV5 L;  1X65 A;  2K14 A;  4AIM A;  1VQI A;  4LW1 A;  4DR6 Q;  5GAG C;  1QVF A;  4LUV A;  3M4P A;  4DV1 L;  4HIO A;  4L5S A;  3RLN A;  2B63 H;  1AAF A;  4OON A;  4LF5 Q;  5EAY A;  3J7Z C;  1A63 A;  4O0A A;  4NB3 A;  1N36 Q;  1FVI A;  3HOU H;  4DUZ Q;  2RHQ B;  4UP7 A;  2YV5 A;  5IWA Q;  5K36 G;  5JEA G;  1VQK A;  1BBW A;  4QL5 A;  1PH8 A;  2AMC B;  4DR2 Q;  4JI1 Q;  3L2P A;  5C0X I;  3GTP H;  2VS1 A;  1Y1V H;  2Y0S G;  3MEF A;  1T9H A;  3HKS A;  4YY3 L;  4DV7 L;  2HHH Q;  2RF4 A;  1X6O A;  2YTY A;  2NVX H;  1EQR A;  4A3D G;  2PI2 E;  4JV5 L;  2CQF A;  2JZW A;  4C3J H;  4GN3 B;  1KRT A;  4DV5 Q;  4A3K H;  1Y1W G;  1UE6 A;  4OXP A;  1Q7Y C;  1M90 C;  1PYS B;  2JQO A;  3M9B A;  5IP9 H;  1N8R C;  2M3Z A;  5C4X G;  1QUQ A;  1OTC A;  3AEV A;  1L1O A;  3HKZ E;  1MJE A;  4IPG A;  3EN2 A;  3BZC A;  3K81 C;  3PO3 G;  1VQ8 A;  3E0E A;  4LF4 L;  2OCE A;  4Y7N H;  3AFP A;  4K0K Q;  2DUD A;  4LF6 L;  1UE7 A;  1K8G A;  1KC8 C;  1XPU A;  1Q46 A;  2K5V A;  4O2D A;  4JBJ A;  1VQE A;  1HR0 Q;  1RIP A;  3CPF A;  1EQQ A;  5BR8 Q;  2R92 H;  1CKN B;  4A3I G;  4NXN Q;  3J7A 5;  1E3P A;  2D0O A;  4DR4 Q;  1VQN A;  1YNX A;  4JI8 L;  3FP9 A;  2PQA B;  1VQM A;  1XMQ L;  1AE2 A;  1VQA A;  2E2J H;  2N49 A;  4UP8 A;  3D31 A;  1CKO A;  4TQU S;  1A6B B;  4GNX C;  4JI5 Q;  4XIG S;  4K0K L;  1N33 L;  4JI0 L;  4A3F H;  1WJJ A;  3STB C;  4X66 Q;  1CSP A;  3RN2 A;  4LF9 L;  2BA0 A;  3CCE A;  4A3M G;  4UY8 C;  1K83 H;  4RMF A;  3J81 c;  2UXB L;  4LF9 Q;  5AJ3 Q;  1WWF A;  1CKN A;  2UUC L;  4LFB Q;  1I94 L;  1QVG A;  3GTJ H;  1IBK Q;  2K52 A;  1TWC H;  2F4V L;  2K4K A;  3CCR A;  3S17 H;  4GN5 A;  3HOY H;  1VQJ A;  3G71 A;  1O7I A;  1SR3 A;  4LF7 Q;  2LXJ A;  2VZA A;  4NXM Q;  1TWF H;  4DV3 Q;  4IJL A;  1D8L A;  2KBN A;  1HNX Q;  4MZ9 A;  1NMF A;  2R6G A;  1HNX L;  4AYB G;  4DV6 L;  4BY1 H;  3U4V A;  1HH2 P;  4GS3 A;  1A0I A;  4HJA A;  3KLW A;  2RCN A;  4X65 Q;  2R7D A;  2L4L A;  3F2C A;  2PNH A;  2MO0 A;  2OTL A;  2UXD L;  1LM0 A;  4DV0 Q;  2ZM6 L;  2R7Z G;  1CSQ A;  1F6U A;  4KHP L;  4R4O A;  4YHH Q;  1VQF A;  4A3I H;  1IBM Q;  2R7Z H;  2VW9 A;  4XTC S;  3PUX A;  1PV4 A;  1H95 A;  4IFD I;  1PH3 A;  2JA9 A;  3H3V H;  1HZ9 A;  4UPA A;  1YBY A;  4BY1 G;  4A4I A;  1HJP A;  3EIV A;  3TQY A;  1BKB A;  1VS0 A;  3G6E A;  3HOZ H;  1RL2 A;  2E5L Q;  4LFC L;  1UEB A;  4QJF A;  5C4X H;  3RZD H;  2PMZ E;  2C35 B;  3GTK H;  3CF5 A;  3I4N H;  3GTG H;  3STB D;  3I56 A;  4PZ7 A;  3RR5 A;  4HID A;  2WP8 J;  2VQE Q;  5GRO A;  4GKK Q;  1SN8 A;  4YCU A;  4GOP C;  1VQ6 A;  1R9T H;  3PV0 A;  3ICE A;  3M3Y H;  4A3C G;  4DUZ L;  3OW2 A;  2K5N A;  3NEN A;  2VUM G;  2YTX A;  4OWX B;  1OXX K;  3M7N A;  4L5T A;  1BVS A;  2KCT A;  4PZ6 A;  1IBL Q;  1E7Z A;  2BH2 A;  4KHZ A;  3M85 A;  3NEM A;  3CC4 A;  4YWL A;  1V9P A;  2HHH L;  1VQG A;  2GVB A;  3T1Y Q;  1HR0 L;  4R1J A;  4LFC Q;  3T1Y L;  2LXK A;  1XMO L;  1P16 A;  2ZTE A;  1E24 A;  4A93 H;  4JV5 Q;  1N32 L;  3FHW A;  1VQB A;  4R4T A;  2IY5 B;  1L2F A;  1XJV A;  1KL9 A;  1Q12 A;  5IYB H;  1WWE A;  1D7Q A;  4MTN A;  2EXD A;  2CWA A;  3CCQ A;  3J81 i;  1YHQ A;  2VUM H;  3S15 H;  1SRO A;  2ALY B;  4A3B H;  2VQF L;  1J5E L;  1JJ2 A;  4B3T Q;  2YTV A;  5IT9 c;  1XNQ Q;  5JJI A;  4POF A;  3M4O H;  1NY4 A;  3UDG A;  3I4M H;  1LUZ A;  3ZJY C;  2JA6 H;  2CKZ B;  4X66 L;  3KDF A;  1QUQ B;  3F8T A;  4KI0 A;  2B63 G;  2R93 G;  1OXV A;  2UXB Q;  1TXY A;  5FLX c;  2JA7 H;  1MJC A;  5LMN W;  1EOV A;  1Q1E A;  4GOP A;  1UE1 A;  1GM5 A;  4WJ3 M;  4P72 A;  1LTL A;  1G51 A;  2HQL A;  3K0X A;  3RNU A;  2I5M X;  1B70 B;  4DAM A;  1C9O A;  1EYG A;  4JI4 L;  4OWW B;  1YIJ A;  2YYZ A;  4J15 A;  4JI2 Q;  3WWV A;  1VQO A;  4OO1 G;  3A5Z B;  3JAM c;  1SLJ A;  4DR5 L;  4PZ8 A;  4HJ7 A;  1X3F A;  1B7Y B;  1SRU A;  3PUZ A;  5FLM H;  1TWH H;  3GDE A;  3CCM A;  1WCM G;  5GQO A;  3W1B A;  4X64 L;  1VQ7 A;  3CC2 A;  3S14 H;  4DR3 Q;  3JC6 6;  1VQ9 A;  1MIU A;  4POG A;  2JA8 H;  5GAD C;  2H5X A;  4GOP B;  3S1N H;  3UDX A;  3S2H H;  2YSA A;  1EFW A;  1KQS A;  3CAM A;  2JE6 I;  4C3H H;  4DR1 L;  2EC7 A;  1I50 H;  4AYB E;  3S16 H;  2OTJ A;  3H15 A;  3VDY A;  3CC7 A;  4LF7 L;  1Z9F A;  1XPO A;  2RHS B;  2NN6 I;  4IPC A;  3PF5 A;  2ZJP A;  5C0X G;  3BJU A;  3PO3 H;  2WFW A;  1NBW A;  4JI5 L;  1Z47 A;  3LGJ A;  3AQQ A;  3NEL A;  2MO1 A;  1Y14 B;  4DUY L;  2HT1 A;  3ULJ A;  4DV0 L;  3CCV A;  3UE1 A;  1X9N A;  3PUV A;  4LUO A;  2WAQ G;  4BBR G;  4B3S L;  4AH6 A;  3PF4 A;  1X55 A;  3HOZ G;  4DKA C;  4B3R L;  4GLA C;  5LMU Q;  3TS0 A;  2JA5 H;  5IYC H;  1AH9 A;  2EIF A;  2N8N A;  1IBM L;  3RZO H;  3KDF B;  4IFD G;  4P75 A;  4DR1 Q;  1SFO H;  1SE8 A;  2JA7 G;  2A1A A;  3FKI G;  1Q8K A;  4GLV B;  3ER0 A;  3OTO L;  4LUZ A;  4A3G H;  1MKH A;  4BA2 I;  4MNO A;  3F2D A;  3CQZ H;  3UDF A;  4HJ8 A;  4DV6 Q;  4BXX G;  4DR2 L;  1M1K C;  1IYJ B;  3H3V I;  2E5L L;  1IZ6 A;  4L5Q A;  1VCI A;  1PVO A;  2DGY A;  5C4J H;  5LMN Q;  2BH8 A;  3DM3 A;  3NBH B;  4DV7 Q;  2EXF A;  3HOX G;  2K75 A;  4IFD J;  2JJQ A;  4PMW A;  1K73 C;  2KHI A;  1ASY A;  3K7A H;  5IY0 A;  3S1R H;  3JAM i;  3AFQ A;  2IHE A;  1YHB A;  2AHO B;  4LF5 L;  2ASB A;  1HZB A;  1KRS A;  3CCU A;  1JJC B;  2V1C C;  4DV1 Q;  1N36 L;  3Q8D A;  3HKZ G;  3HFZ B;  1ASZ A;  1J6Q A;  1DGS A;  4X62 L;  4JI6 L;  2IHX A;  3BZK A;  5FJ8 G;  5IP7 H;  2E2H H;  1G29 1;  2KHJ A;  4GKJ Q;  4X62 Q;  1WCM H;  3PUW A;  2IX0 A;  1E1O A;  4GNX B;  4IO9 A;  4IJH A;  4JI1 L;  3TRE A;  2KEN A;  3CME A;  1N34 Q;  4LF6 Q;  1B8A A;  4DAY B;  2WB1 E;  4P71 A;  3TEH B;  4UP9 A;  1AE3 A;  2VY3 A;  3GTQ H;  1S3O A;  1GVP A;  2VL6 A;  3FKI H;  1I5F A;  1Y1W H;  3S2D H;  4HJ9 A;  3J80 i;  4YY3 Q;  1HNW L;  2UUA Q;  1BJ6 A;  1E22 A;  4H02 A;  4B3M L;  2Z6K A;  3RN5 A;  3PIO A;  3CMA A;  3S1M H;  4B3M Q;  4PG3 A;  1GO3 E;  3A74 A;  4A75 A;  2ZTD A;  3L7Z C;  2I5H A;  1Q81 C;  1PH5 A;  4GKK L;  3ERS X;  3I4N G;  1I3Q H;  4ME3 A;  3KF8 B;  3U50 C;  4QQB X;  3I4O A;  1YEZ A;  2NZH A;  4JI6 Q;  4LFA L;  1KHI A;  3T1H Q;  1HNW Q;  3GTM H;  2OQ0 A;  1TWG H;  2WAQ E;  4OWT B;  5HY6 A;  5C3E G;  4X64 Q;  3ULP A;  1NJI C;  3KJO A;  1WWG A;  1L1O B;  1OXS C;  4JCV E;  1QZG A;  2JEB I;  1JB7 A;  4JI7 L;  1QVC A;  2NVQ H;  2IX1 A;  5M3M G;  3HOX H;  2ES2 A;  4JBM A;  1FL0 A;  3L0O A;  2CWP A;  4OO1 I;  3KJP A;  4Y52 H;  3TRZ A;  4JI4 Q;  1U5K A;  1VQD A;  4A93 G;  4C2M H;  2K50 A;  1KIX A;  4L5R C;  1YI2 A;  1SMX A;  3KOJ A;  2HIX A;  1VQ4 A;  4DV2 L;  4LF8 L;  1S40 A;  2B3G A;  2N3S A;  3F1Z A;  2JEA I;  4DR5 Q;  5DLQ E;  4LFA Q;  3HOY G;  4C3I H;  1HZA A;  3KFU A;  3I55 A;  4QY7 A;  4R4C A;  5E7N A;  3PO2 G;  5ELO A;  5M5W H;  5C3E H;  1N33 Q;  1HR0 W;  1ESK A;  2MFI A;  5IE8 A;  3HOV H;  5GAE C;  4A3M H;  1PFS A;  4R4Q A;  4JI7 Q;  4DR3 L;  4YWK A;  3G48 A;  1TWA H;  4JG2 A;  4B3R Q;  3HOV G;  4A3L G;  1YHA A;  3U58 A;  4YHH L;  2ZJQ A;  2NN6 G;  1IBK L;  2UU9 L;  5GAH C;  2D62 A;  4A3L H;  2Z0S A;  3PSI A;  4AQY Q;  1L1O C;  2A19 A;  1KD1 C;  3J81 j;  3HOU G;  3BU2 A;  2NVY H;  1FJG L;  1HZC A;  3I4M G;  4A3D H;  3KF6 A;  1W2B A;  5HGQ A;  4A3E G;  1FJG Q;  2OQK A;  1UE5 A;  4HJ5 A;  1V43 A;  5M3M H;  2GVA A;  3HOW H;  4JC0 A;  2PQA A; 
#chains in the Genus database with same CATH topology
 1IXR A;  5JEA H;  4IPH A;  2UUB Q;  4EQ5 A;  5H1S E;  2EYF A;  1SEB D;  2F0S A;  2TMP A;  2YU9 H;  1Y1V B;  4R4I A;  4HTH A;  3U4Z A;  1C8C A;  4TSS A;  4B08 A;  1A62 A;  4NW2 A;  1KAW A;  2EE1 A;  1EFI D;  5M3F G;  1XPR A;  4DR7 Q;  1EIH A;  1U0L A;  2UUB L;  5CV8 A;  1RHP A;  2Y0S E;  2F3I A;  1LYL A;  4RCO A;  3MFG A;  4KD3 A;  1NR2 A;  2A69 C;  3W3A A;  5JEA J;  4YCW A;  5JAV A;  1TII D;  4HIM A;  1XNQ L;  3J80 c;  3WOF A;  1S72 A;  4LWC A;  4RG1 A;  3C1E A;  4PNY A;  1Q82 C;  2L0C A;  2RSN A;  5LL6 S;  3R8B A;  5E4X A;  1CHP D;  2BA1 A;  2KED A;  3NUC A;  3QWN A;  2UXC L;  2JA5 B;  1X3G A;  3CPW A;  1Q86 C;  1MBY A;  1H9S B;  1YNN C;  4QGU A;  3GV6 A;  4DK6 C;  1S5D D;  3SGI A;  3H3V C;  1C0A A;  3A8I E;  1XTD A;  4X3K A;  2JA6 G;  4DR4 L;  3FPP A;  3VR3 A;  2DN8 A;  1XMQ Q;  5M3F H;  3CD6 A;  1HNZ L;  1EEF D;  1HNZ Q;  4NXM L;  3GTL H;  3CU7 A;  3TZD A;  4OHJ A;  3HOZ B;  1C4Q A;  5CBA E;  1PH1 A;  1EIF A;  1W3S A;  2HD3 A;  4ZYS A;  1UUP A;  4FDB A;  1XNR Q;  2GN5 A;  2XIW A;  4KLK A;  1WCM B;  3GD7 A;  4QB4 A;  3M4O B;  3SEB A;  3MXU A;  4KHP Q;  1UEA B;  5C44 H;  2KA7 A;  1CUK A;  4ALP A;  5BN5 A;  1JQY D;  1WTW A;  3OWE B;  4A3G G;  2OXP A;  2F4V Q;  3VYT A;  1Q1B A;  2UU9 Q;  1C7Y A;  2KEE A;  2IHF A;  3CKI B;  1GUO A;  4DV3 L;  1X3E A;  3EFX D;  4RH6 A;  1ENC A;  2JN4 A;  1I50 B;  1TQO A;  4X3U A;  2GA4 B;  4DUY Q;  1F9R A;  3T51 B;  1MD2 D;  1MFS A;  1JIC A;  4A3K G;  1PDQ A;  2WAQ B;  4OX9 Q;  2DY7 A;  4NKL A;  2HCI A;  1IL2 A;  3OTO Q;  1LT6 D;  4GLX A;  3S1Q H;  3CXC A;  1ROD A;  2LI8 A;  4A3M B;  3UE0 A;  3W5O A;  1GJX A;  3G4S A;  1PZK D;  1LAB A;  4JYA L;  4A3B G;  2JA8 G;  5IT9 L;  2CQO A;  2F0W A;  2Q2I A;  1XMO Q;  2R92 G;  1NTG A;  3CW2 C;  4RA8 A;  2KOL A;  2KUM A;  2KQ3 A;  4LUV A;  4HIO A;  2F0T A;  5EJW A;  3J7Z C;  3HOU H;  4DUZ Q;  2RHQ B;  4QUF A;  3BDO A;  4BBR B;  5IGF A;  5JEA G;  1PH8 A;  2EJF C;  1RKN A;  2MGS A;  3HRZ C;  4WOR A;  5E1F A;  3MEF A;  1Y1V H;  1HNW Q;  1T9H A;  2JP1 A;  4DV7 L;  2XRQ D;  2YTY A;  1JWM D;  2JZW A;  1YNJ D;  2LY7 A;  1UE6 A;  1Q7Y C;  1PYS B;  2JQO A;  1H9R A;  3M9B A;  4RGM A;  5C4X G;  5CV5 A;  3VR2 A;  1L1O A;  3HKZ E;  2PPB C;  3BZC A;  4G57 A;  1VQ8 A;  2K5V A;  2A68 D;  4C3I G;  1HR0 Q;  1I4R A;  2MJ8 A;  1EQQ A;  5BR8 Q;  3HKZ B;  2EZV A;  1CKN B;  2D0O A;  1VQN A;  4F8M A;  2M00 A;  3Q22 A;  1XMQ L;  1AE2 A;  3F2U A;  1K28 A;  3E0J A;  2K03 A;  2ZXP A;  4XIG S;  4X66 Q;  4B9W A;  4A3K B;  4LF9 L;  2BA0 A;  3J80 L;  4A3M G;  1K83 H;  2UXB L;  4LF9 Q;  1B9M A;  4C3I B;  4FF2 A;  1QVG A;  4RHR A;  1IBK Q;  1E2W A;  5KYI A;  4RGT A;  2XRS D;  4GN5 A;  2WB1 B;  2VZA A;  1CZW A;  3K5N A;  1HNX Q;  4KKS A;  1HNX L;  2IL8 A;  4PMC A;  4N8F A;  4GS3 A;  1BCP C;  3BS1 A;  2A6H C;  2XWB B;  2PNH A;  5T1G A;  3VYS A;  1ESR A;  2OEO A;  2R7Z H;  1PFN A;  3LWU A;  5I2X A;  3KLS X;  1PV4 A;  1BCP B;  4IFD I;  1HCZ A;  4A3F B;  4A4I A;  5IGB A;  1BKB A;  3G6E A;  1IHZ A;  2KVM A;  3RZD H;  1LTR D;  3SHL A;  1ZYR D;  4JK1 C;  3I4N H;  3I56 A;  1Q8I A;  3TZU A;  2VQE Q;  1VQ6 A;  1XX8 A;  3PV0 A;  2AQ2 B;  3ICE A;  2A73 B;  3IAY A;  1EU3 A;  3NEN A;  3DMU A;  2E75 C;  2KCT A;  4PZ6 A;  3SK6 A;  4E6I A;  3M85 A;  3NQI A;  2GVB A;  3T1Y Q;  3MZ5 A;  4R1J A;  2QDL A;  3T1Y L;  1XMO L;  2I07 B;  4DNR B;  2LMC B;  1E24 A;  4A93 H;  3NPP A;  3GTM B;  1N32 L;  1EOT A;  4ZRZ A;  3FHW A;  1VQB A;  4R4T A;  1XJV A;  3P75 A;  1EIG A;  4OEL B;  1EQT A;  4CHT B;  1SRO A;  4A3B H;  1JJ2 A;  3I70 A;  2YTV A;  5JJI A;  4RGO S;  1PLF A;  3UDG A;  3C2P A;  2DY8 A;  4HMI A;  1TWC B;  2CKZ B;  2B63 G;  2R93 G;  2F0F A;  4ID6 A;  2JA7 H;  2NVQ B;  5LMN W;  4MHE A;  4GOP A;  5EKL A;  1UE1 A;  2HUG A;  1D6E C;  1LTL A;  4P72 A;  5CC4 A;  3D3R A;  3MFY A;  2H1E A;  1BR9 A;  1FNU A;  1LO5 D;  2ZXR A;  3A5Z B;  3NBH A;  4OO1 G;  4DR5 L;  4PZ8 A;  2AQ3 B;  3OIQ A;  1SRU A;  1SYC A;  1B9N A;  1TWH H;  3W1B A;  5IGC A;  3S14 H;  2JA8 H;  3IFT A;  3OSO A;  5IOD A;  1A2U A;  2H5X A;  4DGZ A;  2YSA A;  4G4K A;  2NTT A;  1CI3 M;  5FOB B;  1AZQ A;  1C48 A;  4OIJ A;  3A8J E;  4AYB E;  1LTA D;  1BBX C;  1XPO A;  3GTO B;  1JE4 A;  5I6W A;  4IUV A;  2NN6 I;  2ZJP A;  4I65 A;  4JI5 L;  2Z1C A;  2B2U A;  1WD1 A;  3CCV A;  4BBR G;  1QJO A;  1SNQ A;  3ZYY X;  4AH6 A;  3H09 A;  4DKA C;  4B3R L;  3TS0 A;  3N52 A;  2EIF A;  2N8N A;  4IFD G;  4DR1 Q;  1SFO H;  2A1A A;  4A3G H;  4FF1 A;  2EVB A;  3UDF A;  1Y8P B;  2JA8 B;  4GZY C;  4BXX G;  1G2T A;  4L5Q A;  2EYL A;  2B2V A;  1TS5 A;  4H7B A;  2BH8 A;  3K58 A;  3A8K E;  5BN3 A;  2K75 A;  2A69 D;  1S5C D;  1STA A;  1LT3 D;  2KHI A;  3M4Y A;  2AHO B;  4LF5 L;  3AB9 A;  5IGG A;  1N36 L;  3HKZ G;  2E2D C;  3HFZ B;  1DGS A;  1ASZ A;  3ERO A;  3BZK A;  5FJ8 G;  2E2H H;  4KV6 A;  2IX0 A;  1E1O A;  1EY7 A;  2PW5 A;  3I4N B;  4JI1 L;  3PIO 3;  3CME A;  1N34 Q;  1B8A A;  1HTL D;  4UP9 A;  2PQE A;  4DXF A;  3J80 i;  1HNW L;  3RZO B;  2QDB A;  3MEH A;  1S4Z A;  4A75 A;  3H91 A;  2M2L A;  3U50 C;  4QQB X;  1QCB D;  3C3L A;  2EOT A;  1YEZ A;  4JI6 Q;  3V96 A;  1O80 A;  4Z9C B;  2B2W C;  3GTM H;  2CQA A;  2OQ0 A;  1SMY C;  3P7J A;  2CW0 D;  2WAQ E;  3KJO A;  1L1O B;  5IGE A;  1JB7 A;  2I46 A;  1QWY A;  2IX1 A;  1FGB D;  2ES2 A;  4JBM A;  1PZI D;  4CKC A;  5KEE A;  1F2Y A;  2CHB D;  4LJZ C;  4DAV A;  1SJH D;  1SMX A;  4LF8 L;  2JEA I;  4C3J B;  5DLQ E;  5E3F A;  1HZA A;  2JA7 B;  5DEH A;  3NHH A;  3FKI B;  4PV1 C;  4FF3 A;  3PO2 G;  5M5W H;  2L12 A;  3ERQ A;  3HOV H;  5GAE C;  4JI7 Q;  5FO7 B;  1KNA A;  3WOE A;  1VMC A;  1TWA H;  4DXG A;  3S9W A;  1MGS A;  3HOV G;  3R2I A;  2ZJQ A;  3BVZ A;  4A3L H;  3PSI A;  1KD1 C;  1I4Q A;  5T1I A;  3J81 j;  2NVY H;  1G8Z D;  3I4M G;  2EYM A;  2RDH A;  4A3E G;  1NCV A;  3QJY A;  3TP8 A;  1V43 A;  4DV0 Q;  3HOW H;  5JOB A;  5C0X J;  2RVL A;  1D1I A;  2AKW B;  2WIN B;  3H0G H;  4CDE C;  4OX9 L;  1ZXT A;  3K80 C;  3JAM E;  2A6E D;  2E2I H;  1F9S A;  2NVX B;  3H0G G;  2IJ0 A;  2XN9 C;  2G9D A;  3CCS A;  1DJR D;  3K7U C;  5FO9 B;  1G6P A;  2E8G A;  2WKD A;  3FMC A;  4NPS A;  1EL0 A;  3K5O A;  1YIT A;  1DOK A;  3KYH C;  4WJW A;  4FO2 A;  3OWF A;  4YIJ A;  4A3E H;  1L0W A;  4M8A A;  4P74 A;  3IFD A;  5JJL A;  1PTO D;  2F0P A;  3CRL C;  3K7A B;  4JPB W;  1EY6 A;  1Z7T A;  3TN2 A;  1JJG A;  4OL7 A;  2F0V A;  1JT8 A;  4DR6 L;  2JA5 G;  2UXC Q;  1PTO H;  2NTS A;  2QGQ A;  1E1T A;  1S5E D;  4IUR A;  1VQP A;  5IYB G;  3NYB B;  2B2W A;  3PMF A;  3I7F A;  1UAP A;  4JBW A;  2R7F A;  1WI5 A;  2F0K A;  1R4P B;  4YCV A;  4ZLT F;  2L15 A;  4A3J G;  2JYO A;  1X32 A;  1KXL A;  4CDD C;  1K8O A;  2JA6 B;  4WJ4 A;  1VQL A;  1J5E Q;  2RKS A;  1SDF A;  4KMU C;  3ND8 A;  1GUN A;  3X3M A;  3J7Y W;  4A3C H;  3A56 A;  1HPC A;  3DWP A;  4LAA A;  4MTK A;  3E9I A;  1A2T A;  2F0J A;  4EQN A;  1DON A;  5C3W A;  4BBR H;  2QEX A;  3BYY B;  1N9W A;  5J3B A;  3M7G A;  5I9O A;  2ZJR A;  5BR8 L;  5EPJ A;  2CFM A;  3D4W A;  1PH6 A;  3TME A;  3RLF A;  2K32 A;  1GKH A;  2PI2 A;  3NWT A;  3HP3 A;  2A8V A;  3KF6 B;  1CQF A;  3S2D B;  1K0R A;  2C9O A;  1IL8 A;  1CTM A;  1VDZ A;  3PIP A;  2ZTC A;  2QA4 A;  1GUW A;  2UUC Q;  4LFB L;  3NWS A;  3F2B A;  2ZM6 Q;  1WOC A;  4BY7 G;  1K83 B;  1LTG D;  4KD4 A;  3GO5 A;  1QIL A;  5M5X H;  3OYY A;  3BVG A;  3S14 B;  4O42 A;  1CKM A;  3MHB A;  4KHV A;  1EUJ A;  1V1Q A;  4TVA B;  3RLO A;  1JCK B;  4IZ8 A;  4YWM A;  5IP9 G;  2R93 H;  3D8G A;  1II3 A;  3SK8 A;  4MIU A;  4X6A H;  1Z6H A;  2XGT A;  5AJ3 L;  3CCJ A;  1I94 Q;  4RWS C;  1BUV T;  3Q6S A;  5IYC G;  2QW7 A;  1JB3 A;  2I0Q A;  4EVO A;  3TP6 A;  2F0N A;  4ZK9 B;  1SNM A;  4DPG A;  1GUS A;  5BN4 A;  4LK1 C;  5C44 G;  1VQH A;  3ITP A;  5DM7 3;  3T56 B;  4DV4 L;  2MUY A;  3KFU A;  4JOI A;  4NMZ A;  4S3S A;  3ULL A;  4F88 A;  1CK1 A;  2WV6 D;  5L37 A;  4DV5 L;  1X65 A;  2K14 A;  4LW1 A;  1FR3 A;  3P20 A;  4DV1 L;  4HSP A;  2L5T A;  1H9S A;  2L1B A;  3RLN A;  1U4P A;  2MHV A;  4O0A A;  2KCC A;  3SR1 A;  2K28 A;  2E74 C;  3NQT A;  1BDO A;  3DEO A;  5IWA Q;  5K36 G;  1VQK A;  1BBW A;  2DJG C;  4G7Z C;  2IX3 A;  4JI1 Q;  3L2P A;  4DAP A;  3GTP H;  5KND A;  4YY3 L;  3HKS A;  1QE6 A;  2NZ1 D;  4UAI A;  2RF4 A;  3URY A;  1EQR A;  2NBF A;  2PI2 E;  2JXM B;  1Y1W G;  4R8N A;  2PZT A;  4IUN A;  5IP9 H;  1N8R C;  2F0M A;  4L6T B;  3IKJ A;  4XT1 B;  3EN2 A;  3S15 B;  2VUM B;  2OCE A;  1CHQ D;  2CH4 W;  4TRD A;  1D5Z C;  4HCE A;  2PZW A;  1QG7 A;  3J81 L;  5JVH 3;  4A3G B;  4RCN A;  4A3I G;  1E3P A;  4DR4 Q;  3Q23 A;  2SNS A;  3FP9 A;  2B2Y A;  1Y1W B;  3D6W A;  1B2T A;  4XQJ A;  4UP8 A;  2PO4 A;  2CVR A;  4TQU S;  2J0T D;  5LL6 X;  4BBS B;  1PYW D;  4JI5 Q;  2Z6B A;  1NNX A;  5LHY 1;  3S16 B;  4K0K L;  1N33 L;  1WJJ A;  3OHX C;  1NAP A;  3NTI A;  1CKN A;  3I3C A;  1I94 L;  2K52 A;  1DD2 A;  2K4K A;  3MWY W;  4XXE A;  3S17 H;  2L55 A;  1O7I A;  1SR3 A;  4NXM Q;  3DEP A;  3S1R B;  5EKK A;  4MZ9 A;  3Q24 A;  3NTK A;  4AYB G;  1A0I A;  4K6L A;  3KLW A;  2L4L A;  2R7D A;  4CGY B;  3I72 A;  2MO0 A;  2UXD L;  3CQZ B;  1LM0 A;  1CSQ A;  4R4O A;  1VQF A;  1WTR A;  1LT4 D;  1SFO B;  4K8I A;  3PUX A;  4KTA A;  4L63 B;  1WTQ A;  1H95 A;  3H0G B;  1BCP F;  2K5D A;  3H3V H;  4UPA A;  1H9J A;  3KF8 A;  3TQY A;  4PQX A;  3HOZ H;  4N9T A;  1RL2 A;  2E5L Q;  1UEB A;  2KHS A;  2PMZ E;  1WTX A;  1I6H B;  1SYB A;  4HID A;  2WP8 J;  3DWQ A;  4A3E B;  1XYI A;  3M3Y H;  1SE2 A;  1B50 A;  2K5N A;  1KLU D;  1OXX K;  1TWA B;  1U9R A;  1B4O A;  2E2H B;  3X3N A;  2R92 B;  2B63 B;  1K0S A;  1QNU A;  1VQG A;  4WRD A;  1HR0 L;  3VR5 A;  1PRT F;  5CGK A;  3LWE A;  1EYA A;  4Q0F A;  5COY A;  3O13 A;  1W6J A;  3TSS A;  2MP1 A;  1BO0 A;  1KL9 A;  5IYB H;  4K2L A;  4CJ0 B;  4V0B A;  2KJX A;  5JPN C;  5IT9 c;  4U67 3;  5D3D A;  3I4M H;  2QKI C;  3BG3 A;  2JA6 H;  4QUC A;  1QUQ B;  2NUC A;  4KI0 A;  4MN3 A;  2UXB Q;  3PO2 B;  1SND A;  1TXY A;  3E3X A;  1EOV A;  1Q1E A;  3M3Y B;  4K2K A;  4C3J G;  2I5M X;  1EYG A;  1TS2 A;  1YIJ A;  1STG A;  2X6G A;  3WWV A;  2EYP A;  5ELD A;  2L9H A;  1SLJ A;  1STE A;  2BE5 D;  1E2Z A;  2E76 C;  3PUZ A;  2AQ1 B;  1PFB A;  3JC6 6;  1MIU A;  3GTJ B;  5HGT A;  3S2H H;  2VXW A;  1EFW A;  4DR1 L;  1I50 H;  4DK0 A;  3VDY A;  3CC7 A;  1CA6 A;  4LF7 L;  2RHS B;  4CKE A;  1O78 A;  3PF5 A;  1IW7 D;  5C0X G;  2JSO A;  2WFW A;  1EY8 A;  1Q90 A;  3LGJ A;  1TT2 A;  3MXG A;  4DUY L;  3TP5 A;  2Q8R E;  4IQZ A;  4LUO A;  4B3S L;  1DM0 B;  4GLA C;  1KTK A;  1IBM L;  1DZ1 A;  3KDF B;  5C3X A;  4GLV B;  3ER0 A;  1RCV D;  4LUZ A;  1SYE A;  1ZEQ X;  1EZ8 A;  4HJ8 A;  3H94 A;  4DN4 M;  4DV6 Q;  4DR2 L;  3JAM L;  1IYJ B;  4OIK A;  3L3O C;  3H3V I;  1VCI A;  5LMN Q;  1KDC A;  2EXF A;  4HMJ A;  1GUT A;  5ELE A;  2EY5 A;  1BXT A;  3A7L A;  3MVV A;  3JAM i;  1CA5 A;  2LKV A;  2OT2 A;  1JJC B;  2V1C C;  4HR7 B;  4DV1 Q;  3Q8D A;  4BY1 B;  1HFN A;  4X62 L;  2IHX A;  4GKJ Q;  5C4H A;  3PUW A;  4U68 A;  4IJH A;  5D3I B;  3TRE A;  2EJM A;  1HQR D;  3J80 E;  4K8J A;  1NUC A;  1TY2 A;  1GVP A;  1I5F A;  1I4G A;  1BCP D;  2UUA Q;  1E22 A;  2Z6K A;  1ONL A;  1HFG A;  3RN5 A;  3CMA A;  3S1M H;  1GO3 E;  1TU2 B;  1DXM A;  3ERS X;  5ELB A;  4ME3 A;  5KGU A;  2PCF B;  4LFA L;  3HEJ A;  5C3E G;  4X64 Q;  1NJI C;  1WWG A;  5G3L F;  4JCV E;  4JI7 L;  2JEB I;  3DHQ A;  2EY6 A;  2NVQ H;  1SYD A;  3NBI A;  4K5X A;  4C56 C;  1FNW A;  1FL0 A;  3L0O A;  4JVZ A;  4OO1 I;  4Y52 H;  4JI4 Q;  1VQD A;  4ILW A;  3I4M B;  4L5R C;  3KOJ A;  1PRT B;  2HIX A;  3F1Z A;  5CYU A;  2Y0S B;  1RTO A;  4C3I H;  1WD0 A;  1G2S A;  2XWJ B;  2RBM A;  5E7N A;  5ELO A;  1N33 Q;  5C3E H;  2MFI A;  5IE8 A;  2RSO A;  4A3M H;  1PFS A;  3OOC A;  4DR3 L;  4YWK A;  3LNN A;  1LTS D;  1S5B D;  4KY7 A;  1E0B A;  5CBE E;  1U4R A;  2NN6 G;  1IBK L;  2UU9 L;  2D62 A;  5EBD A;  1E2V A;  3MXP A;  4RKB A;  3V05 A;  1SNO A;  1ET9 A;  4K5V A;  3BU2 A;  1T5E A;  2RCF A;  1PXU A;  1FJG Q;  2OQK A;  1UE5 A;  4HJ5 A;  4TKO B;  4JC0 A;  2PQA A;  1ENA A;  1FGU A;  3TP7 A;  1HQM C;  1YZ6 A;  3D0F A;  3UDI A;  5DM6 3;  3ONA B;  3E9H A;  4C1N K;  2ZXO A;  3FDT A;  5KYL A;  2N78 A;  4OO1 H;  1KNE A;  5J39 A;  3MA2 B;  2PNR C;  2D2C C;  5LMN L;  2PW7 A;  3PGZ A;  2B29 A;  4JOI C;  3EBE A;  3MXN B;  3K0Y A;  3QOJ A;  1JMC A;  3B6Y A;  1PYB A;  1M8A A;  2Q2H A;  2ATW A;  3VYU A;  2OWO A;  2K1B A;  1HTP A;  3DWA A;  1STN A;  5M3F B;  2SDF A;  3T1H L;  4EX5 A;  2VQF Q;  2X6L A;  1IBL L;  4B3T L;  4G7O C;  4QIW B;  4I7Z C;  4GN4 B;  4UHV A;  2EYJ A;  1SSO A;  2B2U C;  1X3Q A;  1SJE D;  1N32 Q;  2A74 C;  4NP5 A;  4FNF A;  1TWH B;  4CKB A;  5DAU A;  4JI3 L;  3GTG B;  2R61 A;  2JK8 A;  5CV9 A;  4BXX H;  2LSS A;  3E5S A;  4DK3 C;  2AWO A;  3DLL A;  1FYC A;  4A3I B;  4J6H A;  2K7V A;  2F1M A;  3K59 A;  4BS9 A;  5IYD G;  1GXD C;  5C4J B;  4LF8 Q;  4ME5 A;  4FF4 A;  3J7A F;  1NMG A;  3PO2 H;  3J81 E;  2F3V A;  3Q0A A;  3R2T A;  4A3J H;  4LF4 Q;  4IOC A;  1SNP A;  2WKC A;  1VQ5 A;  4QMG A;  4Y7N B;  1A8V A;  3M4Q A;  1PA6 A;  1DOM A;  3IRB A;  4APV A;  1F2M A;  2K5H A;  3S2H B;  2XTI A;  3OIP A;  2Q2U A;  3H6M A;  5IYD H;  1F9Q A;  1SBB B;  2IPK D;  2CCZ A;  3QG1 A;  1EQV A;  3BDL A;  2K5W A;  4J8Q A;  2Q2T A;  2UXD Q;  2ID0 A;  4K6D A;  1V1P B;  1K3R A;  5D14 A;  1P8L A;  1LTT D;  3GTL B;  5JJK A;  1XWE A;  2F03 A;  2K6A A;  4BBS G;  4J1M A;  2D0P A;  5TSS A;  2KCM A;  1Y1V G;  2PMZ B;  2MNA A;  2K5Q A;  2AUJ D;  1NE3 A;  2NVT B;  3C46 A;  5I9P A;  1TKW B;  1B53 A;  1LAC A;  3CCL A;  5M5Y B;  4C2M B;  4ZCK A;  5FJ8 H;  2FJ2 A;  3FPU B;  1AFP A;  4B3S Q;  3HOW G;  3K5M A;  2P5Z X;  1EU4 A;  4AIM A;  3GTK B;  4DR6 Q;  3RMH A;  2ZT9 C;  1TWG B;  4RKL A;  4LF5 Q;  1HA5 A;  1A63 A;  1N36 Q;  4ODG A;  4UP7 A;  2YV5 A;  3S1N B;  4KK7 A;  2AMC B;  4DR2 Q;  2FFK B;  5C0X I;  1AP0 A;  2B63 H;  4CDF C;  4NDX A;  4JV5 L;  5M9O A;  4A3D G;  4RFB A;  5J22 A;  4C3J H;  1KRT A;  4A3K H;  3TBI B;  2FMM A;  1M90 C;  4ZKB B;  2DJF C;  5ELC A;  2K05 A;  1QUQ A;  4F87 A;  3AEV A;  4IPG A;  3K81 C;  3PO3 G;  3E0E A;  5EKI A;  3AFP A;  4K0K Q;  2DUD A;  1K8G A;  1Q46 A;  4O2D A;  4JBJ A;  3LX0 A;  1KAB A;  2R92 H;  4V19 0;  3J7A 5;  4NXN Q;  1CT1 D;  1YNX A;  4JI8 L;  1H9M A;  5M5W B;  1VQM A;  1VQA A;  5CV6 A;  2E2J H;  2N49 A;  4QF4 A;  2EDG A;  4KJO A;  1A6B B;  1WTP A;  3OW7 A;  4JI0 L;  4A3F H;  1B44 D;  3STB C;  1CSP A;  4UY8 C;  1Q3L A;  3J81 c;  1V1P A;  1WWF A;  1K3B C;  3GTJ H;  3CCR A;  1YNJ C;  1AZP A;  4HSV A;  4FXK C;  2LXJ A;  3MXN A;  3VA7 A;  4IJL A;  3GP7 A;  1KDA A;  1NMF A;  5I2Y A;  3NP8 A;  1HH2 P;  4HJA A;  1EEI D;  2RCN A;  3F2C A;  2OTL A;  1WTO A;  1U4L A;  3DM1 A;  3QO2 A;  5C6A A;  4KHP L;  1ESF A;  1A3T A;  2RA4 A;  1J8I A;  5HUR A;  1STH A;  2SEB D;  2EYO A;  4EQO A;  5CMD A;  2VW9 A;  4XTC S;  5ELF A;  4XYO A;  4ZAI A;  1PH3 A;  2JA9 A;  1HZ9 A;  1YBY A;  4BY1 G;  1HJP A;  3EIV A;  1SAP A;  1VS0 A;  3CHB D;  3ND9 A;  1SYG A;  4QJF A;  2NB0 A;  5C4X H;  2SNM A;  3QOL A;  4ZKC B;  4G7H C;  2B2Y C;  2VB3 X;  1F2Z A;  1KDB A;  5DNF A;  5GRO A;  1QOH A;  4YCU A;  2B2T C;  1R9T H;  4DUZ L;  4PMB A;  3OW2 A;  3VYR A;  4OWX B;  4L5T A;  2BH2 A;  1IBL Q;  3EVQ A;  3NEM A;  2ICE C;  4JW0 A;  2HHH L;  4QCL A;  1GUG A;  3DXJ C;  2SOB A;  3G7L A;  3EQL C;  1AEX A;  1P16 A;  2ZTE A;  4JV5 Q;  2F0L A;  3EA6 A;  2IY5 B;  1L2F A;  3I8Z A;  5EPK A;  1Q12 A;  3OMG A;  3P1H A;  1D7Q A;  2K04 A;  4MTN A;  2KCN A;  3CCQ A;  4IUP A;  3J81 i;  5A35 A;  1YHQ A;  2VUM H;  3S15 H;  2ALY B;  3HOX B;  3SE0 A;  4K5W A;  2VQF L;  1J5E L;  4B3T Q;  1XNQ Q;  2KEC A;  2CH4 A;  1G6Z A;  3KBX A;  2EJG C;  4X66 L;  1MSG A;  2H4O A;  3SK5 A;  1OXV A;  3KBG A;  4WJ3 M;  1PTO F;  1G51 A;  3RNU A;  4OWW B;  2J4X A;  1C9O A;  4JI4 L;  1IKM A;  2YYZ A;  2EY1 A;  1A3U A;  2O5J C;  4DU9 A;  1X3F A;  3EJI A;  3CCM A;  1WCM G;  1DOL A;  4X64 L;  1VQ7 A;  4O1N A;  3CC2 A;  3NXW A;  4POG A;  4I7A A;  5C3E B;  5GAD C;  1F9P A;  2OF1 A;  2EXZ A;  4B9X A;  1KQS A;  2JE6 I;  4C3H H;  5M3M B;  4BY7 B;  2LS0 1;  3H15 A;  2F0H A;  2MPM A;  5G3L D;  2N55 A;  4IPC A;  1A6X A;  3PO3 H;  3BJU A;  1RDP D;  2MO1 A;  1Y14 B;  3HZX A;  2HT1 A;  3UE1 A;  2WAQ G;  2Z9H A;  2FMC A;  5EQ0 A;  3PF4 A;  4DK1 A;  2JA5 H;  5IYC H;  1AH9 A;  2A6H D;  3RZO H;  5EGT A;  1JOQ A;  1SE8 A;  2JA7 G;  1D5X C;  1Q8K A;  1Y69 U;  1MKH A;  1JOO A;  1VMP A;  5D65 A;  5FLX E;  3F2D A;  2D5D A;  2E5L L;  1PVO A;  2DGY A;  5C4J H;  3DM3 A;  3QR8 A;  1U4M A;  4DV7 Q;  3GQB A;  2HDM A;  1ASY A;  5IY0 A;  1WTV A;  5ISR A;  3AFQ A;  1CQV A;  2Z4H A;  2IHE A;  3GTP B;  3VR4 A;  1F77 A;  2F4I A;  1J6Q A;  1MI2 A;  4UDU C;  4JI6 L;  3R93 A;  4X62 Q;  1GHJ A;  1WCM H;  4GNX B;  1PRT D;  4IO9 A;  1EWC A;  2KEN A;  1HXY D;  4XDX A;  4DA2 A;  4LF6 Q;  3HGB A;  4DAY B;  1BNZ A;  2WB1 E;  1AE3 A;  1Y1W H;  1JOR A;  3FKI H;  2O2L D;  2XNA C;  3S2D H;  4HJ9 A;  3HS0 C;  2G5D A;  1I6V C;  2O4X A;  3PIO A;  5A2Q L;  4B3M Q;  3L7Z C;  1PH5 A;  3I4N G;  4HAE A;  3I4O A;  5NUC A;  1KHI A;  3T1H Q;  5C0X H;  1TWG H;  1TS4 A;  5HY6 A;  3ULP A;  1EYD A;  3W2D A;  4LMQ D;  1ICW A;  5M3M G;  3HOX H;  3KJP A;  3TRZ A;  4HCS A;  4ABN A;  4A93 G;  3K6O A;  2K50 A;  4HED A;  4C2M H;  1YI2 A;  1VQ4 A;  1EYC A;  1I4H A;  1S40 A;  2N3S A;  2VB2 X;  1ENF A;  3HOY G;  1X3P A;  4QY7 A;  4R4C A;  3I55 A;  3BYT B;  1ESK A;  1HR0 W;  2IWH A;  1CZG A;  4H44 C;  3KLS A;  1K8M A;  4YHH L;  1LV9 A;  5GAH C;  1I4X A;  4K14 A;  2Z0S A;  4AQY Q;  1L1O C;  2A19 A;  1SE4 A;  3HOU G;  4Q5V A;  1FJG L;  1HZC A;  4BWG B;  4R8I A;  3NE5 B;  4IUQ A;  5C4Z A;  5M3M H;  2GVA A;  4IUT A;  1SXT A;  4BY7 H;  2Z6K C;  1HHV A;  3T4A C;  3GTO H;  1PH9 A;  3QB3 A;  1A15 A;  1PH4 A;  5LMU L;  1YJW A;  5FLM G;  3PUY A;  2M9V A;  5I4D A;  4AQY L;  2Z8L A;  1L0X B;  1R4Q B;  2IT1 A;  4CBV A;  1D2B A;  1RD9 D;  4GNX A;  1YNN D;  4LNQ A;  2NVT H;  1LLR D;  4L8J A;  4JYA Q;  3SXH A;  1FNV A;  2F0D A;  4DV4 Q;  1ZYR C;  1S5F D;  1OXU A;  5M5Y H;  4A3F G;  4DR7 L;  4IOA A;  4HIK A;  1NR4 A;  3FEW X;  2E2J B;  1U6P A;  1X56 A;  1YJN A;  3A0J A;  3AU7 A;  4X3S A;  1G91 A;  4IPD A;  3K8A A;  3VR6 A;  4JBK A;  1Q3Y A;  1WWD A;  3T13 A;  4JI3 Q;  2NZO A;  4KKT A;  2BCO A;  5IWA L;  2R7Z B;  1D1K A;  5K5P A;  1UWV A;  2NYZ D;  5JPM C;  1B1Z A;  2UUA L;  1HRJ A;  3I2Z A;  1I3Q B;  1WVL A;  3S24 A;  4P73 A;  1X54 A;  2VQE L;  5J1Z A;  2QCP X;  4H13 C;  4JI2 L;  3R3O A;  1WFQ A;  4CDC C;  1DYQ A;  1EWI A;  1TY0 A;  3E6Z X;  4GKJ L;  1EIY B;  4P2C B;  2AWN A;  3GV3 A;  2VNU D;  3HOU B;  4DFA A;  4FVM A;  1M4V A;  4QIW E;  1SMY D;  1ZKO A;  3A54 A;  2HQE A;  3PCO B;  1A3V A;  4BBS H;  4JI8 Q;  4M1U B;  4A3D B;  2R93 B;  5IP7 G;  1PH7 A;  2I5L X;  2F52 A;  4DV2 Q;  3KLR A;  1O7Z A;  1L0Y B;  3RZD B;  1Q3Z A;  3IL8 A;  3A5U A;  2BDO A;  1SYF A;  4C3H G;  3AYH B;  3CRK C;  3V2T A;  5ELN A;  1XNR L;  4RGN A;  3UI2 A;  1QZH A;  1WYD A;  3HG9 A;  2MQH A;  3U9S A;  5COR A;  1R9T B;  1K9M C;  3A55 A;  4JI0 Q;  3D6C A;  2HIV A;  1WTH A;  4NXN L;  5IOC A;  1CM9 A;  4WFN 3;  1IW7 C;  3CP0 A;  1OXT A;  1KAA A;  2F0E A;  1EWH A;  1PHJ A;  1A1T A;  1PH2 A;  1JE5 A;  4DNI A;  1GOZ A;  2DNE A;  4ZUJ A;  5EBC A;  1GD7 A;  1Y8N B;  2N88 A;  1VQC A;  2Z4I A;  2O5I C;  2HDL A;  4DNT B;  4A76 A;  1AW7 A;  4A3B B;  4IFD H;  5CR3 A;  2F0I A;  4FP5 D;  1BBU A;  1XXG A;  4BA1 I;  3HOW B;  3RUZ A;  3DUZ A;  1SE3 A;  2WB1 G;  1I6H H;  2EQS A;  2AUK A;  1N34 L;  1QNK A;  5E4W C;  1IYU A;  1YVC A;  1KLG D;  1K8A C;  2FXQ A;  3I4L A;  4X65 L;  1YJ9 A;  3W1G A;  3TS2 A;  1FD7 D;  1PZJ D;  1VQI A;  5CV7 A;  1PMR A;  2B2T A;  1PTO C;  5GAG C;  1QVF A;  3M4P A;  1ILP A;  4L5S A;  1AAF A;  4OON A;  5EAY A;  1O7L A;  1EY4 A;  3I90 A;  4NB3 A;  1FVI A;  2RQX A;  3T53 B;  4C1N I;  5KRU A;  1H9K A;  1B3A A;  4QL5 A;  4ZQ3 A;  1Y8O B;  2VS1 A;  2E2I B;  2Y0S G;  2HHH Q;  2CQF A;  1X6O A;  2NVX H;  3WDN A;  2F0G A;  2WII B;  1DCZ A;  3MTS A;  4GN3 B;  4DV5 Q;  2PYK A;  4OXP A;  1MHW C;  2M3Z A;  1OTC A;  1JR0 D;  1MJE A;  2HCC A;  2DNC A;  4RHS A;  4LF4 L;  3RD4 A;  3SK4 A;  4Y7N H;  4LF6 L;  1JWS D;  1UE7 A;  2BOS A;  3I73 A;  1KC8 C;  1XPU A;  1VQE A;  1RIP A;  2BDN A;  1W6K A;  3CPF A;  4CJ2 C;  1HUM A;  4N8X 1;  5FO8 B;  2PQA B;  3NTH A;  4XYQ A;  1LTI D;  3D31 A;  1CKO A;  5FK9 C;  3PQI A;  1ILQ A;  2L4N A;  4GNX C;  4OEM B;  1LT5 D;  4KKU A;  2XSC A;  4DF7 A;  3RN2 A;  2IW3 A;  3CCE A;  5C44 B;  4RMF A;  5AJ3 Q;  4EGV A;  2UUC L;  4LFB Q;  1HUN A;  2G9H D;  4IN3 A;  2B8F A;  2NN6 H;  1TWC H;  2EPB A;  2F4V L;  1STY A;  1TVX A;  3HOY H;  3HOV B;  1VQJ A;  3G71 A;  4C3H B;  4LF7 Q;  1TWF H;  4DV3 Q;  1D8L A;  2KBN A;  1STB A;  4HN7 A;  2V4D A;  3PIP 3;  3BVM A;  2R6G A;  4DV6 L;  1RF2 D;  1F2L A;  4BY1 H;  3KK7 A;  3U4V A;  1VF7 A;  4R9W A;  5C5M A;  4X65 Q;  2B2V C;  2K33 A;  3K5L A;  3VA5 A;  2R7Z G;  2ZM6 L;  1EZ6 A;  1F6U A;  4ULL A;  3GTQ B;  4XT3 B;  4YHH Q;  1OO9 B;  1JC7 A;  4A3I H;  1IBM Q;  4KY5 A;  1JOK A;  3N6R A;  2ICI A;  1IYV A;  4LFC L;  4FXD A;  2NWG A;  3PO3 B;  2C35 B;  2C5C A;  3GTK H;  1RTN A;  3CF5 A;  4OGQ C;  3STB D;  3GTG H;  4PZ7 A;  3RR5 A;  3NK9 A;  1CFM A;  1TWF B;  4GKK Q;  1SN8 A;  2F0Q A;  4GOP C;  3OPO A;  4N9P A;  4A3C G;  5C5L A;  2VUM G;  2YTX A;  3M7N A;  1BVS A;  2Q8I B;  1E7Z A;  1V1O A;  4KHZ A;  3CC4 A;  2B8G A;  4YWL A;  2K01 A;  1V9P A;  4LFC Q;  2LXK A;  2RDG A;  2NVY B;  1GHK A;  1ICF B;  2FIN B;  1WWE A;  2EXD A;  2CWA A;  4FYD A;  5JVG 3;  5A2Q E;  3D4D A;  4POF A;  2B39 A;  3BDC A;  1NY4 A;  3M4O H;  1J9O A;  1LUZ A;  3ZJY C;  3KDF A;  3F8T A;  5FKA C;  2A6E C;  2Q8T A;  3G6J B;  1V8Q A;  5FLX c;  1MJC A;  1GM5 A;  5K36 H;  2A68 C;  3D4R A;  1HA6 A;  3K0X A;  2HQL A;  2D9U A;  2F0O A;  1B70 B;  4DAM A;  3A7A B;  4J15 A;  4JI2 Q;  3MAQ A;  1ML0 D;  3K57 A;  1VQO A;  3JAM c;  1SNC A;  1BF4 A;  2ENB A;  4HJ7 A;  1B7Y B;  5FLM H;  3GDE A;  5GQO A;  4FXG C;  4DR3 Q;  1VQ9 A;  4F7X A;  1MSH A;  4GOP B;  3S1N H;  4CJ1 B;  3UDX A;  2TSS A;  2J7Z A;  5JJZ A;  1UNS A;  2QIL A;  2XVS A;  3CAM A;  2EC7 A;  3SVM A;  3TDQ A;  4RAU C;  3AMU A;  3S16 H;  2OTJ A;  1B3Q A;  2L11 A;  1Z9F A;  3U9O A;  1BQQ T;  2PZU A;  5IIF A;  2YU9 B;  1RJT A;  1NBW A;  1VF5 C;  1Z47 A;  3S17 B;  3AQQ A;  3NEL A;  4AYB B;  3ULJ A;  2R3Z A;  4DV0 L;  1X9N A;  2F0U A;  3PUV A;  5I6Y A;  3QIA A;  2WAC A;  1X55 A;  3HOZ G;  3S1Q B;  5LMU Q;  1O7Y A;  4KJN A;  4IAL A;  4P75 A;  2X69 A;  3FKI G;  3OTO L;  2CW0 C;  4BA2 I;  1D5M C;  3C1F A;  4MNO A;  3CQZ H;  1LTB D;  1M1K C;  4KN4 C;  1IZ6 A;  5C4X B;  2BE5 C;  4IUU A;  3NBH B;  3HOX G;  4IFD J;  4XQN A;  2JJQ A;  4PMW A;  3MC0 B;  1K73 C;  3K7A H;  3S1R H;  1EY0 A;  1YHB A;  2ASB A;  4DAY A;  1HZB A;  1KRS A;  3CCU A;  3T16 A;  3BZD B;  4H0L C;  4XQQ A;  5AFW A;  5IP7 H;  1G29 1;  2KHJ A;  3FRP B;  4P71 A;  3TEH B;  5M5X B;  2VY3 A;  3GTQ H;  1S3O A;  2VL6 A;  4A3J B;  4YY3 Q;  1BJ6 A;  4H02 A;  2RDF A;  3FVQ A;  4B3M L;  4X3T A;  3SDZ A;  5KNC A;  4PG3 A;  3A74 A;  1Q81 C;  2ZTD A;  2I5H A;  4GKK L;  1I3Q H;  2QF7 A;  3KF8 B;  3OMC A;  1EY9 A;  1BOS A;  2NZH A;  1IKL A;  2EYH A;  1NSN S;  1AN8 A;  5KNB A;  4OWT B;  1PTO B;  1OXS C;  1QZG A;  1T5X D;  1TS3 A;  2F3W A;  3KUP A;  1QVC A;  1PFM A;  5IT9 E;  1I4P A;  2QEJ C;  5IGD A;  2CWP A;  3J7A V;  1U5K A;  1TR5 A;  1KIX A;  2EY2 A;  4DV2 L;  2B3G A;  4DR5 Q;  4LFA Q;  5FLX L;  1QB5 D;  1EY5 A;  3I91 A;  4EQP A;  1PRT C;  5F2D A;  5EPL A;  4R4Q A;  4ZUI A;  3S1M B;  1ET6 A;  3G48 A;  5KIX A;  4JG2 A;  4B3R Q;  4A3L G;  1YHA A;  3L9A X;  3U58 A;  4KY6 A;  2LFN A;  5CV4 A;  1JWU D;  2A5H A;  4A93 B;  4A3D H;  2FHT A;  3KF6 A;  1W2B A;  5HGQ A;  1XTC D;  3HOY B;  4KN7 C;  3NSW A; 
#chains in the Genus database with same CATH homology
 4BY7 H;  1IXR A;  2Z6K C;  4IPH A;  2UUB Q;  4EQ5 A;  5C0X J;  1FGU A;  5H1S E;  3GTO H;  2AKW B;  1PH9 A;  3H0G H;  1YZ6 A;  3D0F A;  4OX9 L;  3K80 C;  3UDI A;  2E2I H;  2YU9 H;  4R4I A;  3E9H A;  1PH4 A;  5LMU L;  1YJW A;  3U4Z A;  5FLM G;  3H0G G;  3PUY A;  3CCS A;  4AQY L;  2N78 A;  3K7U C;  1G6P A;  2IT1 A;  2E8G A;  1A62 A;  4NPS A;  4GNX A;  4LNQ A;  2NVT H;  1YIT A;  3KYH C;  1KAW A;  4JYA Q;  5LMN L;  5M3F G;  4DV4 Q;  1L0W A;  4A3E H;  3PGZ A;  1XPR A;  2B29 A;  1OXU A;  5M5Y H;  1U0L A;  4P74 A;  4A3F G;  4DR7 Q;  4JOI C;  3EBE A;  3MXN B;  4DR7 L;  4HIK A;  4IOA A;  5JJL A;  2UUB L;  1JMC A;  2Y0S E;  1U6P A;  1X56 A;  3B6Y A;  2F3I A;  3A0J A;  1LYL A;  1PYB A;  1YJN A;  1JJG A;  2ATW A;  2Q2H A;  4IPD A;  5JEA J;  4YCW A;  3K8A A;  2OWO A;  4JBK A;  4DR6 L;  1JT8 A;  1Q3Y A;  2JA5 G;  1WWD A;  4JI3 Q;  2UXC Q;  2NZO A;  3T1H L;  4EX5 A;  2VQF Q;  2QGQ A;  1E1T A;  4HIM A;  1IBL L;  4B3T L;  1XNQ L;  1VQP A;  4GN4 B;  5IWA L;  5IYB G;  3NYB B;  1UWV A;  3J80 c;  3I7F A;  2UUA L;  4JBW A;  2R7F A;  3I2Z A;  1S72 A;  1WI5 A;  4LWC A;  4RG1 A;  1N32 Q;  4YCV A;  4A3J G;  2L15 A;  3S24 A;  4P73 A;  1X54 A;  2VQE L;  1Q82 C;  1KXL A;  3TS2 A;  4WJ4 A;  1VQL A;  2BA1 A;  4JI2 L;  4JI3 L;  2UXC L;  1WFQ A;  1J5E Q;  1EWI A;  4GKJ L;  1X3G A;  1EIY B;  4A3C H;  2AWN A;  2JK8 A;  3CPW A;  1Q86 C;  4BXX H;  2VNU D;  2LSS A;  4DK3 C;  4QGU A;  3E9I A;  2AWO A;  4DK6 C;  3DLL A;  3SGI A;  4BBR H;  4QIW E;  2QEX A;  1C0A A;  4DR4 L;  1XTD A;  1N9W A;  3PCO B;  5J3B A;  2JA6 G;  4BBS H;  4JI8 Q;  5BR8 L;  2ZJR A;  5IYD G;  5IP7 G;  1XMQ Q;  5M3F H;  2CFM A;  1PH7 A;  1HNZ L;  3CD6 A;  2I5L X;  2F52 A;  4DV2 Q;  4LF8 Q;  1PH6 A;  1HNZ Q;  3RLF A;  4NXM L;  3GTL H;  1GKH A;  1NMG A;  2PI2 A;  3PO2 H;  2A8V A;  1Q3Z A;  3A5U A;  3KF6 B;  1PH1 A;  3AYH B;  4A3J H;  4LF4 Q;  1K0R A;  4IOC A;  5ELN A;  1EIF A;  1W3S A;  1XNR L;  3PIP A;  4FDB A;  2ZTC A;  1XNR Q;  1QZH A;  1WYD A;  2GN5 A;  2MQH A;  2QA4 A;  1K9M C;  4JI0 Q;  4KLK A;  2UUC Q;  4LFB L;  3F2B A;  1VQ5 A;  3GD7 A;  2HIV A;  2ZM6 Q;  1WOC A;  4KHP Q;  1A8V A;  4BY7 G;  5C44 H;  3M4Q A;  4NXN L;  1PA6 A;  1CUK A;  3GO5 A;  4ALP A;  3IRB A;  5M5X H;  4A3G G;  3OYY A;  2F4V Q;  4APV A;  1Q1B A;  2UU9 Q;  1C7Y A;  3CP0 A;  1CKM A;  1OXT A;  2IHF A;  1EUJ A;  1V1Q A;  2K5H A;  1PHJ A;  4DV3 L;  1X3E A;  2XTI A;  1A1T A;  1PH2 A;  1JE5 A;  4DNI A;  2Q2U A;  4TVA B;  5IYD H;  3RLO A;  4YWM A;  1GD7 A;  2CCZ A;  5IP9 G;  2UXD Q;  4DUY Q;  2Q2T A;  2R93 H;  1VQC A;  2ID0 A;  1MFS A;  4X6A H;  1K3R A;  2XGT A;  5AJ3 L;  3CCJ A;  1P8L A;  4A76 A;  4A3K G;  1I94 Q;  5JJK A;  4OX9 Q;  5IYC G;  4BBS G;  1BBU A;  2D0P A;  2I0Q A;  1IL2 A;  3OTO Q;  2KCM A;  4BA1 I;  1Y1V G;  2MNA A;  1NE3 A;  4DPG A;  2WB1 G;  4GLX A;  3S1Q H;  3CXC A;  1I6H H;  2EQS A;  5C44 G;  2LI8 A;  1VQH A;  3UE0 A;  3W5O A;  1N34 L;  3CCL A;  5FJ8 H;  3G4S A;  1YVC A;  4JYA L;  4A3B G;  1K8A C;  4DV4 L;  2JA8 G;  2FXQ A;  2CQO A;  2Q2I A;  4X65 L;  4JOI A;  3W1G A;  1YJ9 A;  1XMO Q;  4B3S Q;  3ULL A;  1NTG A;  2R92 G;  3HOW G;  3CW2 C;  4DV5 L;  1X65 A;  2K14 A;  4AIM A;  1VQI A;  4LW1 A;  4DR6 Q;  5GAG C;  1QVF A;  4LUV A;  3M4P A;  4DV1 L;  4HIO A;  4L5S A;  3RLN A;  2B63 H;  1AAF A;  4OON A;  4LF5 Q;  5EAY A;  3J7Z C;  1A63 A;  4O0A A;  4NB3 A;  1N36 Q;  1FVI A;  3HOU H;  4DUZ Q;  2RHQ B;  4UP7 A;  2YV5 A;  5IWA Q;  5K36 G;  5JEA G;  1VQK A;  1BBW A;  4QL5 A;  1PH8 A;  2AMC B;  4DR2 Q;  4JI1 Q;  3L2P A;  5C0X I;  3GTP H;  2VS1 A;  1Y1V H;  2Y0S G;  3MEF A;  1T9H A;  3HKS A;  4YY3 L;  4DV7 L;  2HHH Q;  2RF4 A;  1X6O A;  2YTY A;  2NVX H;  1EQR A;  4A3D G;  2PI2 E;  4JV5 L;  2CQF A;  2JZW A;  4C3J H;  4GN3 B;  1KRT A;  4DV5 Q;  4A3K H;  1Y1W G;  1UE6 A;  4OXP A;  1Q7Y C;  1M90 C;  1PYS B;  2JQO A;  3M9B A;  5IP9 H;  1N8R C;  2M3Z A;  5C4X G;  1QUQ A;  1OTC A;  3AEV A;  1L1O A;  3HKZ E;  1MJE A;  4IPG A;  3EN2 A;  3BZC A;  3K81 C;  3PO3 G;  1VQ8 A;  3E0E A;  4LF4 L;  2OCE A;  4Y7N H;  3AFP A;  4K0K Q;  2DUD A;  4LF6 L;  1UE7 A;  1K8G A;  1KC8 C;  1XPU A;  1Q46 A;  2K5V A;  4O2D A;  4JBJ A;  1VQE A;  1HR0 Q;  1RIP A;  3CPF A;  1EQQ A;  5BR8 Q;  2R92 H;  1CKN B;  4A3I G;  4NXN Q;  3J7A 5;  1E3P A;  2D0O A;  4DR4 Q;  1VQN A;  1YNX A;  4JI8 L;  3FP9 A;  2PQA B;  1VQM A;  1XMQ L;  1AE2 A;  1VQA A;  2E2J H;  2N49 A;  4UP8 A;  3D31 A;  1CKO A;  4TQU S;  1A6B B;  4GNX C;  4JI5 Q;  4XIG S;  4K0K L;  1N33 L;  4JI0 L;  4A3F H;  1WJJ A;  3STB C;  4X66 Q;  1CSP A;  3RN2 A;  4LF9 L;  2BA0 A;  3CCE A;  4A3M G;  4UY8 C;  1K83 H;  4RMF A;  3J81 c;  2UXB L;  4LF9 Q;  5AJ3 Q;  1WWF A;  1CKN A;  2UUC L;  4LFB Q;  1I94 L;  1QVG A;  3GTJ H;  1IBK Q;  2K52 A;  1TWC H;  2F4V L;  2K4K A;  3CCR A;  3S17 H;  4GN5 A;  3HOY H;  1VQJ A;  3G71 A;  1O7I A;  1SR3 A;  4LF7 Q;  2LXJ A;  2VZA A;  4NXM Q;  1TWF H;  4DV3 Q;  4IJL A;  1D8L A;  2KBN A;  1HNX Q;  4MZ9 A;  1NMF A;  2R6G A;  1HNX L;  4AYB G;  4DV6 L;  4BY1 H;  3U4V A;  1HH2 P;  4GS3 A;  1A0I A;  4HJA A;  3KLW A;  2RCN A;  4X65 Q;  2R7D A;  2L4L A;  3F2C A;  2PNH A;  2MO0 A;  2OTL A;  2UXD L;  1LM0 A;  4DV0 Q;  2ZM6 L;  2R7Z G;  1CSQ A;  1F6U A;  4KHP L;  4R4O A;  4YHH Q;  1VQF A;  4A3I H;  1IBM Q;  2R7Z H;  2VW9 A;  4XTC S;  3PUX A;  1PV4 A;  1H95 A;  4IFD I;  1PH3 A;  2JA9 A;  3H3V H;  1HZ9 A;  4UPA A;  1YBY A;  4BY1 G;  4A4I A;  1HJP A;  3EIV A;  3TQY A;  1BKB A;  1VS0 A;  3G6E A;  3HOZ H;  1RL2 A;  2E5L Q;  4LFC L;  1UEB A;  4QJF A;  5C4X H;  3RZD H;  2PMZ E;  2C35 B;  3GTK H;  3CF5 A;  3I4N H;  3GTG H;  3STB D;  3I56 A;  4PZ7 A;  3RR5 A;  4HID A;  2WP8 J;  2VQE Q;  5GRO A;  4GKK Q;  1SN8 A;  4YCU A;  4GOP C;  1VQ6 A;  1R9T H;  3PV0 A;  3ICE A;  3M3Y H;  4A3C G;  4DUZ L;  3OW2 A;  2K5N A;  3NEN A;  2VUM G;  2YTX A;  4OWX B;  1OXX K;  3M7N A;  4L5T A;  1BVS A;  2KCT A;  4PZ6 A;  1IBL Q;  1E7Z A;  2BH2 A;  4KHZ A;  3M85 A;  3NEM A;  3CC4 A;  4YWL A;  1V9P A;  2HHH L;  1VQG A;  2GVB A;  3T1Y Q;  1HR0 L;  4R1J A;  4LFC Q;  3T1Y L;  2LXK A;  1XMO L;  1P16 A;  2ZTE A;  1E24 A;  4A93 H;  4JV5 Q;  1N32 L;  3FHW A;  1VQB A;  4R4T A;  2IY5 B;  1L2F A;  1XJV A;  1KL9 A;  1Q12 A;  5IYB H;  1WWE A;  1D7Q A;  4MTN A;  2EXD A;  2CWA A;  3CCQ A;  3J81 i;  1YHQ A;  2VUM H;  3S15 H;  1SRO A;  2ALY B;  4A3B H;  2VQF L;  1J5E L;  1JJ2 A;  4B3T Q;  2YTV A;  5IT9 c;  1XNQ Q;  5JJI A;  4POF A;  3M4O H;  1NY4 A;  3UDG A;  3I4M H;  1LUZ A;  3ZJY C;  2JA6 H;  2CKZ B;  4X66 L;  3KDF A;  1QUQ B;  3F8T A;  4KI0 A;  2B63 G;  2R93 G;  1OXV A;  2UXB Q;  1TXY A;  5FLX c;  2JA7 H;  1MJC A;  5LMN W;  1EOV A;  1Q1E A;  4GOP A;  1UE1 A;  1GM5 A;  4WJ3 M;  4P72 A;  1LTL A;  1G51 A;  2HQL A;  3K0X A;  3RNU A;  2I5M X;  1B70 B;  4DAM A;  1C9O A;  1EYG A;  4JI4 L;  4OWW B;  1YIJ A;  2YYZ A;  4J15 A;  4JI2 Q;  3WWV A;  1VQO A;  4OO1 G;  3A5Z B;  3JAM c;  1SLJ A;  4DR5 L;  4PZ8 A;  4HJ7 A;  1X3F A;  1B7Y B;  1SRU A;  3PUZ A;  5FLM H;  1TWH H;  3GDE A;  3CCM A;  1WCM G;  5GQO A;  3W1B A;  4X64 L;  1VQ7 A;  3CC2 A;  3S14 H;  4DR3 Q;  3JC6 6;  1VQ9 A;  1MIU A;  4POG A;  2JA8 H;  5GAD C;  2H5X A;  4GOP B;  3S1N H;  3UDX A;  3S2H H;  2YSA A;  1EFW A;  1KQS A;  3CAM A;  2JE6 I;  4C3H H;  4DR1 L;  2EC7 A;  1I50 H;  4AYB E;  3S16 H;  2OTJ A;  3H15 A;  3VDY A;  3CC7 A;  4LF7 L;  1Z9F A;  1XPO A;  2RHS B;  2NN6 I;  4IPC A;  3PF5 A;  2ZJP A;  5C0X G;  3BJU A;  3PO3 H;  2WFW A;  1NBW A;  4JI5 L;  1Z47 A;  3LGJ A;  3AQQ A;  3NEL A;  2MO1 A;  1Y14 B;  4DUY L;  2HT1 A;  3ULJ A;  4DV0 L;  3CCV A;  3UE1 A;  1X9N A;  3PUV A;  4LUO A;  2WAQ G;  4BBR G;  4B3S L;  4AH6 A;  3PF4 A;  1X55 A;  3HOZ G;  4DKA C;  4B3R L;  4GLA C;  5LMU Q;  3TS0 A;  2JA5 H;  5IYC H;  1AH9 A;  2EIF A;  2N8N A;  1IBM L;  3RZO H;  3KDF B;  4IFD G;  4P75 A;  4DR1 Q;  1SFO H;  1SE8 A;  2JA7 G;  2A1A A;  3FKI G;  1Q8K A;  4GLV B;  3ER0 A;  3OTO L;  4LUZ A;  4A3G H;  1MKH A;  4BA2 I;  4MNO A;  3F2D A;  3CQZ H;  3UDF A;  4HJ8 A;  4DV6 Q;  4BXX G;  4DR2 L;  1M1K C;  1IYJ B;  3H3V I;  2E5L L;  1IZ6 A;  4L5Q A;  1VCI A;  1PVO A;  2DGY A;  5C4J H;  5LMN Q;  2BH8 A;  3DM3 A;  3NBH B;  4DV7 Q;  2EXF A;  3HOX G;  2K75 A;  4IFD J;  2JJQ A;  4PMW A;  1K73 C;  2KHI A;  1ASY A;  3K7A H;  5IY0 A;  3S1R H;  3JAM i;  3AFQ A;  2IHE A;  1YHB A;  2AHO B;  4LF5 L;  2ASB A;  1HZB A;  1KRS A;  3CCU A;  1JJC B;  2V1C C;  4DV1 Q;  1N36 L;  3Q8D A;  3HKZ G;  3HFZ B;  1ASZ A;  1J6Q A;  1DGS A;  4X62 L;  4JI6 L;  2IHX A;  3BZK A;  5FJ8 G;  5IP7 H;  2E2H H;  1G29 1;  2KHJ A;  4GKJ Q;  4X62 Q;  1WCM H;  3PUW A;  2IX0 A;  1E1O A;  4GNX B;  4IO9 A;  4IJH A;  4JI1 L;  3TRE A;  2KEN A;  3CME A;  1N34 Q;  4LF6 Q;  1B8A A;  4DAY B;  2WB1 E;  4P71 A;  3TEH B;  4UP9 A;  1AE3 A;  2VY3 A;  3GTQ H;  1S3O A;  1GVP A;  2VL6 A;  3FKI H;  1I5F A;  1Y1W H;  3S2D H;  4HJ9 A;  3J80 i;  4YY3 Q;  1HNW L;  2UUA Q;  1BJ6 A;  1E22 A;  4H02 A;  4B3M L;  2Z6K A;  3RN5 A;  3PIO A;  3CMA A;  3S1M H;  4B3M Q;  4PG3 A;  1GO3 E;  3A74 A;  4A75 A;  2ZTD A;  3L7Z C;  2I5H A;  1Q81 C;  1PH5 A;  4GKK L;  3ERS X;  3I4N G;  1I3Q H;  4ME3 A;  3KF8 B;  3U50 C;  4QQB X;  3I4O A;  1YEZ A;  2NZH A;  4JI6 Q;  4LFA L;  1KHI A;  3T1H Q;  1HNW Q;  3GTM H;  2OQ0 A;  1TWG H;  2WAQ E;  4OWT B;  5HY6 A;  5C3E G;  4X64 Q;  3ULP A;  1NJI C;  3KJO A;  1WWG A;  1L1O B;  1OXS C;  4JCV E;  1QZG A;  2JEB I;  1JB7 A;  4JI7 L;  1QVC A;  2NVQ H;  2IX1 A;  5M3M G;  3HOX H;  2ES2 A;  4JBM A;  1FL0 A;  3L0O A;  2CWP A;  4OO1 I;  3KJP A;  4Y52 H;  3TRZ A;  4JI4 Q;  1U5K A;  1VQD A;  4A93 G;  4C2M H;  2K50 A;  1KIX A;  4L5R C;  1YI2 A;  1SMX A;  3KOJ A;  2HIX A;  1VQ4 A;  4DV2 L;  4LF8 L;  1S40 A;  2B3G A;  2N3S A;  3F1Z A;  2JEA I;  4DR5 Q;  5DLQ E;  4LFA Q;  3HOY G;  4C3I H;  1HZA A;  3KFU A;  3I55 A;  4QY7 A;  4R4C A;  5E7N A;  3PO2 G;  5ELO A;  5M5W H;  5C3E H;  1N33 Q;  1HR0 W;  1ESK A;  2MFI A;  5IE8 A;  3HOV H;  5GAE C;  4A3M H;  1PFS A;  4R4Q A;  4JI7 Q;  4DR3 L;  4YWK A;  3G48 A;  1TWA H;  4JG2 A;  4B3R Q;  3HOV G;  4A3L G;  1YHA A;  3U58 A;  4YHH L;  2ZJQ A;  2NN6 G;  1IBK L;  2UU9 L;  5GAH C;  2D62 A;  4A3L H;  2Z0S A;  3PSI A;  4AQY Q;  1L1O C;  2A19 A;  1KD1 C;  3J81 j;  3HOU G;  3BU2 A;  2NVY H;  1FJG L;  1HZC A;  3I4M G;  4A3D H;  3KF6 A;  1W2B A;  5HGQ A;  4A3E G;  1FJG Q;  2OQK A;  1UE5 A;  4HJ5 A;  1V43 A;  5M3M H;  2GVA A;  3HOW H;  4JC0 A;  2PQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...