3TS2A

Mouse lin28a in complex with let-7g microrna pre-element
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
135
structure length
135
Chain Sequence
QLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSINHMVASCPLKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein lin-28 homolog A
publication title Molecular Basis for Interaction of let-7 MicroRNAs with Lin28.
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein/rna
total genus 27
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00098 zf-CCHC Zinc knuckle
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3ts2A01
4.10.60.10 Few Secondary Structures Irregular HIV-1 Nucleocapsid Protein Zinc finger, CCHC-type 3ts2A02
3TREA 1CUKA 3B6YA 4UP7A 1IBKQ 4JBKA 1E1OA 4YY3L 4A3FH 2HT1A 3HOYH 1Y1VG 1XJVA 1Q3YA 1EQRA 3I4OA 1YHQA 1K0RA 4BBRG 1JE5A 1N32L 3KYHC 2JEAI 4DUZL 3RLNA 3K80C 4LFBQ 1IL2A 2BH8A 5FLMG 1IBLL 4A4IA 4JI8Q 4JOIC 5M3FH 4LF4L 4P74A 1BVSA 1K83H 3PUXA 1KAWA 3PUYA 1JJ2A 2WAQG 2UUBL 2E5LL 2UXDQ 1SR3A 1VQAA 3M7NA 3FHWA 1EYGA 4X62L 4JOIA 3H0GG 4HJ7A 1JJCB 3AQQA 1SN8A 4X65Q 2M3ZA 4UPAA 4AYBG 3JAMc 1KRSA 3DLLA 4A3LH 4B3RQ 3RN5A 4JI0L 2R7DA 4L5QA 3CCEA 2JA5H 3CC4A 3PO2H 4A3MH 2HHHQ 1CSPA 4K0KQ 3ZJYC 4KHPQ 2NZOA 2I5LX 2VQEL 1SRUA 2PQAA 4DR1L 4A3EG 2PNHA 4LWCA 3UDIA 1JB7A 4DV4Q 3CPWA 4AQYQ 1Q7YC 5HY6A 5IWAL 5E7NA 1GVPA 4A3BH 5C4XG 2WB1E 4GLAC 3T1YL 1YEZA 2WP8J 5AJ3Q 4DV5L 1Q81C 1PH3A 3ERSX 4IO9A 1WOCA 3HKZG 3K8AA 3PF5A 4HJ9A 1ESKA 2AMCB 2YTYA 3ULLA 1ASYA 2F3IA 2VNUD 4LF7Q 3NELA 4R4CA 3U4VA 4NXML 1PH4A 1G291 1MJEA 1CSQA 2YSAA 3EN2A 4A93H 1AE2A 1K3RA 1PH2A 4YWKA 1L0WA 1CKOA 4DR2L 1I6HH 3WWVA 1XNQL 2B3GA 1Q1BA 2GN5A 3L2PA 2VQFQ 2ALYB 1EOVA 4KHZA 4YCUA 1QZGA 3HOWG 3KJPA 4JI2Q 4JC0A 1R9TH 2Q2HA 4A3KG 1CKNA 3OYYA 2FXQA 2R93G 4YWMA 1D8LA 1XPOA 4DR4Q 4WJ3M 5HGQA 1SLJA 3K7AH 3FP9A 4XIGS 1X9NA 1VQ4A 3M85A 4A3DG 4JI1Q 4JYAQ 2UXBQ 3CCSA 4LF8Q 2CWAA 3L7ZC 3PCOB 1WWFA 5EAYA 3TEHB 1PH6A 2A19A 4DV7L 1D7QA 4BBSH 1O7IA 2CCZA 3T1HQ 2K50A 4LUOA 3KDFA 5GQOA 4DK6C 2CWPA 3CXCA 3GTOH 2Y0SG 3I7FA 3GO5A 1VQ6A 2F52A 4DUYL 4GNXB 3CCUA 5C0XG 3E0EA 4B3MQ 4IFDJ 3J81c 2UU9Q 1UE5A 3ER0A 4BA2I 2L4LA 4DR7L 3TRZA 4JG2A 2B63G 1Y1WH 3M3YH 1QVCA 3LGJA 1N34Q 3H15A 1CKMA 4DV6Q 5IP7H 3GTMH 4GKKQ 1M90C 1IBML 3S1RH 4A3GH 4NB3A 1OXXK 2XGTA 4HIMA 1B8AA 5IYBG 1DGSA 2JA7H 4QQBX 2NZHA 1BBWA 1YHBA 5DLQE 4QJFA 1WCMG 4NPSA 4LFAQ 3OTOQ 5IE8A 4JCVE 3U50C 3PSIA 1GKHA 3RZOH 4IPHA 3PIPA 1NY4A 1A6BB 3GDEA 3I55A 4DV1L 1FL0A 4PMWA 1X65A 3S1MH 3W1BA 1HNZL 4TVAB 4IPGA 5GROA 2RHQB 5M5YH 1XMQL 3GTLH 2UXCQ 2JZWA 1XPUA 3AEVA 4WJ4A 2N3SA 5LMNL 3AYHB 1VQEA 1Q3ZA 4JI6Q 4DV2L 4GN4B 2VW9A 3HOUH 1U0LA 4A75A 3TS2A 5M3MH 3CAMA 2NN6I 1HJPA 2D0PA 2I0QA 4B3TQ 1S3OA 4X64Q 3A74A 3EBEA 3I56A 2MO1A 3J80i 4AH6A 2KCTA 1QVFA 1YVCA 1WWGA 5IYCG 4LUVA 4POFA 1QUQB 4BY1H 2NVYH 3CW2C 4X65L 2RF4A 3I4NG 3CP0A 1B70B 1W3SA 1X3GA 4A3CH 3M4QA 3HOXG 5LMUL 1J5EQ 1I94L 3GTQH 3G48A 3GTJH 1V43A 4HJ5A 3I4MH 2N78A 1S72A 4QY7A 1Q1EA 1MJCA 1VQIA 2EXFA 4OX9L 1I5FA 4C3IH 3H0GH 4X6AH 4L5TA 4P72A 4YCWA 1P8LA 1VQFA 4GLXA 4GKJL 1N36Q 4DV0Q 1KQSA 1VQ5A 2R92G 1YI2A 4R1JA 1Q82C 4IFDI 2OQKA 4DR6Q 1HR0L 1FVIA 1NMGA 2BA1A 4DAYB 2IHFA 4C2MH 5IP9H 1FJGQ 2VUMG 3A5ZB 5BR8Q 2ZM6Q 1UWVA 1PH8A 5M5WH 2EC7A 1AAFA 1P16A 1LM0A 3PV0A 4OO1G 4IPCA 1EWIA 3M4PA 2UUCL 3S2HH 1SMXA 2IX0A 1UE7A 5IYDG 1KHIA 2Q2IA 4DK3C 1QZHA 5GADC 4DV3Q 1NE3A 5GAHC 2D62A 2JE6I 3J7A5 5FLXc 4LF6L 2Q2TA 3MXNB 1HNWL 1HZCA 4L5SA 4YHHL 1YITA 1S40A 2IHXA 4IJLA 5C0XJ 4YY3Q 4EQ5A 4A3JH 2YV5A 3HKSA 3J7ZC 5JJIA 1YIJA 2MO0A 4DUZQ 4UY8C 1C0AA 2LI8A 4JI3Q 2AHOB 2K5NA 2XTIA 2WAQE 1WWDA 1IBLQ 4A3LG 3NENA 4YWLA 4LF4Q 2JA5G 2A8VA 4JI1L 1RL2A 2ID0A 4A3MG 2UXBL 1X6OA 1Z47A 3EIVA 4EX5A 1SFOH 4JI7L 5C44H 2YYZA 4LUZA 4X66L 2UUAQ 2AKWB 2E5LQ 1PYSB 2H5XA 4O2DA 4X62Q 3Q8DA 2K52A 1YNXA 3K81C 4PZ6A 3AFQA 1MFSA 2IHEA 2IY5B 3CCVA 3M9BA 4JI0Q 4GNXC 4A3BG 4A3DH 4B3ML 1YZ6A 1LYLA 4XTCS 2CQFA 4LF9L 1AE3A 2HIVA 2F4VL 3GTPH 4B3SQ 1TWCH 1HNXL 4Y7NH 2VQEQ 4DR1Q 4Y52H 5K36G 1PYBA 2JA6H 4GNXA 4GKKL 4NXNQ 3BZKA 3HKZE 4DPGA 3JC66 2ASBA 5IWAQ 1QVGA 1OTCA 1U6PA 3NYBB 4LFAL 2I5MX 2N49A 2JQOA 2B63H 2OTJA 5J3BA 2EXDA 4HIDA 4GN5A 4JI4L 4BA1I 4LF5L 2LXJA 3CCJA 4NXMQ 1UE6A 1VQDA 3G6EA 1J6QA 3PO3G 3PIOA 4DR5L 3KOJA 1HZAA 4PG3A 1PH1A 1WCMH 3HOVH 3AFPA 4DR2Q 2E2IH 1OXTA 2JA8H 1LTLA 3J81j 1XNQQ 4JBMA 2JJQA 1TXYA 2GVBA 4BY7H 2DUDA 1XMOL 5JJLA 2R7ZH 3H3VH 1X54A 1VQKA 2C35B 3MEFA 2MNAA 3CC7A 4BBSG 1SROA 1A1TA 1T9HA 1YBYA 3CC2A 4JBWA 1EIFA 4JI5L 2IX1A 1N33L 3PF4A 4JV5L 5GAEC 5C3EH 5JEAG 4FDBA 5IY0A 3F2BA 1GD7A 1WYDA 4X64L 3L0OA 3HOZH 1XNRL 2RCNA 5C0XI 3RR5A 1U5KA 1VQ8A 3S24A 5JJKA 3UDGA 3S1NH 3S2DH 4P75A 2Y0SE 4DV7Q 4DR3Q 2B29A 3CD6A 1WWEA 3FKIH 1IBKL 1X56A 4IPDA 1Y1WG 1EFWA 3PUVA 1A62A 4A3GG 3UE1A 5IP7G 2LSSA 1OXSC 1VQMA 1Z9FA 2PI2E 1NMFA 3HFZB 1J5EL 4LFBL 1JJGA 5FJ8G 4DUYQ 4TQUS 1K8AC 2Z0SA 4JI8L 1QUQA 3K7UC 1IXRA 1VQGA 2GVAA 3BU2A 2ZJQA 4DR7Q 5IYCH 2EQSA 1KL9A 4HJ8A 3CCMA 2VS1A 4PZ7A 4HIKA 1Y1VH 1MKHA 2UXDL 3H3VI 1PA6A 4R4IA 4BBRH 4QL5A 4C3HH 1L2FA 4KI0A 4POGA 5FLMH 2ZJRA 3JAMi 1Q86C 2OTLA 4DR6L 4B3RL 1GO3E 3CMAA 1YJWA 4J15A 2KHIA 4LFCQ 4OWWB 3GD7A 1N8RC 1FJGL 3IRBA 4O0AA 1VQ7A 3F2CA 2HHHL 1E1TA 4K0KL 1YHAA 1YJ9A 4KHPL 4GOPB 3PGZA 2R92H 4DV1Q 1L1OC 2AWNA 4IFDG 1K8GA 3CCQA 4LW1A 3GTGH 4DV4L 3F8TA 4AQYL 1RIPA 1HNZQ 1VQCA 5M5XH 3CCLA 2OWOA 2VUMH 1XMQQ 1PH9A 1VQBA 1F6UA 1UE1A 5AJ3L 1NBWA 4A3IG 5LMNQ 4ME3A 3UDFA 3CMEA 3F2DA 1L1OA 2VL6A 4GN3B 1PFSA 4DV2Q 4BXXG 4APVA 4A3EH 5IYDH 2WB1G 4A3FG 4BY1G 4JI3L 3CCRA 4LF7L 3HOYG 3S1QH 1TWGH 1EUJA 1VQ9A 1WI5A 1A63A 1G6PA 2ATWA 4A3CG 4PZ8A 1Y14B 3NEMA 1FGUA 5C4XH 3I4MG 1L1OB 2VZAA 3ULPA 2E2JH 3J80c 3CPFA 5M3FG 2UUAL 2IT1A 2JEBI 3KJOA 2VQFL 4IOAA 3S16H 3M4OH 1MIUA 1B7YB 1UEBA 1X55A 4JI2L 1NJIC 5ELOA 3RLFA 5ELNA 1N32Q 1I50H 4GLVB 5LMUQ 1I94Q 1HZBA 1SE8A 2WFWA 3K0XA 4DR4L 2KENA 1IZ6A 4OONA 1VQNA 2JK8A 4DAMA 3ICEA 5LMNW 4OXPA 1KC8C 3RNUA 1JMCA 5IP9G 2D0OA 2L15A 4B3SL 4OX9Q 3PO2G 2NVQH 4AIMA 4JYAL 1X3FA 3NBHB 1Q12A 4LF8L 2EIFA 2UUBQ 3HOWH 4AYBE 2N8NA 4OO1I 3KF6A 4NXNL 1IYJB 3SGIA 2ZTCA 5GAGC 4A3KH 4QGUA 2R93H 1I3QH 1ASZA 4GKJQ 3T1HL 2RHSB 2BA0A 2K5HA 3VDYA 5JEAJ 3STBC 2PQAB 1HR0Q 2E2HH 3TS0A 3KF8B 3KLWA 2K14A 2DGYA 5C4JH 1KXLA 1C9OA 3KF6B 3J81i 2UU9L 1BKBA 2K75A 2UUCQ 4A3JG 3A0JA 4QIWE 1N34L 3PUZA 4DV6L 2I5HA 3G71A 2MFIA 1C7YA 4LF6Q 4A76A 3BZCA 2K4KA 4UP9A 1HNWQ 1XTDA 3I2ZA 1TWHH 1BBUA 3DM3A 1VQJA 4YHHQ 3T1YQ 4A93G 2K5VA 4DNIA 4DV5Q 5C44G 4GS3A 3OTOL 4MTNA 2QEXA 1JT8A 1A8VA 4IJHA 4MZ9A 2Q2UA 3PO3H 2YTXA 4JBJA 2YTVA 3RZDH 2AWOA 1GM5A 1HR0W 4P71A 4IOCA 1VQHA 5IYBH 2QA4A 1HZ9A 2A1AA 1TWFH 4JI7Q 1CKNB 4LNQA 3UE0A 1K9MC 2UXCL 4DR3L 4X66Q 4R4QA 2ES2A 3G4SA 4ALPA 3S17H 2HQLA 2JA6G 3U4ZA 1NTGA 4JI6L 3S15H 4OWXB 1E3PA 1EQQA 2ZTDA 1TWAH 1Q46A 1V1QA 1KD1C 1HH2P 1OXVA 1E22A 3RN2A 4B3TL 4LF9Q 2F4VQ 4C3JH 1A0IA 1Q8KA 1WFQA 1BJ6A 3KDFB 1HNXQ 2KBNA 1VCIA 2R6GA 1K73C 1AH9A 2HIXA 3F1ZA 1G51A 3TQYA 3W1GA 1EIYB 3RLOA 2NVXH 2PI2A 2CKZB 4P73A 5FJ8H 4UP8A 4HIOA 1PH5A 3S14H 2Z6KC 2NN6G 3U58A 1W2BA 4DKAC 3HOVG 3CQZH 4LFCL 4RG1A 1YJNA 2JA7G 2JA8G 2KCMA 2NVTH 3ULJA 1LUZA 4BY7G 2VY3A 2ZTEA 3E9IA 4MNOA 4HJAA 2R7ZG 4LF5Q 1M1KC 4GOPC 4RMFA 2JA9A 2Z6KA 1VQLA 2YU9H 4JI4Q 1H95A 1E24A 1PHJA 1OXUA 1E7ZA 4DR5Q 1XPRA 1X3EA 5C3EG 3I4NH 3KFUA 1IBMQ 3HOXH 1KIXA 1VQPA 4DV0L 1N36L 3D31A 4R4TA 2KHJA 3E9HA 3PUWA 4GOPA 5H1SE 2R7FA 4H02A 3STBD 2V1CC 3GTKH 3HOZG 3A5UA 1KRTA 1XMOQ 2ZM6L 5BR8L 4YCVA 3W5OA 2ZJPA 2QGQA 3FKIG 1N9WA 2BH2A 4JV5Q 1PV4A 4OWTB 4JI5Q 4L5RC 1N33Q 2CQOA 2OCEA 5IT9c 3D0FA 3BJUA 3HOUG 4R4OA 1WJJA 2MQHA 4DV3L 2OQ0A 5M3MG 1V9PA 4KLKA 2LXKA 2E8GA 3UDXA 3CF5A 3OW2A 4A3IH 1VS0A 1VQOA 1PH7A 2PMZE 1XNRQ 1PVOA 2CFMA 4BXXH
chains in the Genus database with same CATH superfamily
1CUKA 2L4NA 4UP7A 5EBCA 4A3FH 3HOYH 1Y1VG 3SE0A 1AFPA 2JEAI 3A8KE 1T5EA 2B39A 5FLMG 4K14A 5M3FH 4LF4L 1S4ZA 3FRPB 1WVLA 1LTSD 2UXDQ 1SR3A 1VQAA 1F9QA 2OF1A 1SMYD 1QNUA 4X65Q 5JPNC 4UPAA 3S1MB 4AYBG 1KRSA 4OEMB 2R7DA 2NYZD 1NR2A 4K0KQ 4CHTB 3D4RA 2I5LX 2PZUA 2PNHA 3UDIA 3FDTA 4AQYQ 1Q7YC 3NPPA 2WB1E 1YEZA 1STBA 3PF5A 2BCOA 4HJ9A 2WIIB 1I4RA 2WB1B 2AMCB 2FMCA 1ASYA 1O78A 3L3OC 2VNUD 1STAA 3A56A 4R4CA 3U4VA 4NXML 2GA4B 4MIUA 4A93H 1LT5D 1PH2A 4DR2L 1CKOA 3PQIA 1FNUA 1I6HH 1XNQL 1Q1BA 3L2PA 4KHZA 2NZ1D 2HD3A 1SJED 4JI2Q 2FXQA 5D3DA 1BCPB 4DR4Q 4WJ3M 3K7AH 3T4AC 2DJFC 3UI2A 3LWUA 1IW7C 1F77A 5EAYA 1PH6A 2H1EA 4BBSH 4CKCA 2CQAA 3KDFA 4CDCC 4DK6C 4G7ZC 2Y0SG 4N9PA 2UU9Q 5FO9B 2L4LA 4BA2I 5JOBA 4A3JB 4DR7L 3BG3A 1KDAA 3TRZA 1B4OA 3F2UA 1QVCA 4DV6Q 4A3GH 2EJMA 2SNSA 1OXXK 4HIMA 5IYBG 1AEXA 2JA7H 1YHBA 5DLQE 5E4WC 2KUMA 3OTOQ 1HQMC 3PSIA 3DWPA 3R2IA 1PTOB 3BYTB 1FL0A 4PMWA 2I07B 1G2SA 4TVAB 4IPGA 3VR2A 2RHQB 5M5YH 2DJGC 3GTLH 5I2YA 2UXCQ 2JA6B 5NUCA 1VQEA 1Q3ZA 1PLFA 2VW9A 4RKBA 3HOUH 4A75A 1RD9D 4IQZA 3CAMA 2NN6I 3K5LA 4B3TQ 1S3OA 3G7LA 4H0LC 4X64Q 2SEBD 4U68A 4F87A 1F9SA 1QVFA 2XWJB 1LTAD 2R61A 1QUQB 4BY1H 2NVYH 2DY7A 3GTMB 3I4NG 3CP0A 1B70B 1X3GA 3HOXG 1H9JA 5LMUL 1J5EQ 1D2BA 4MN3A 3GTJH 2N78A 4HMJA 5IGCA 2R7ZB 2ICEC 2AQ1B 2Z4HA 1GXDC 4L5TA 1HHVA 4P72A 4FO2A 4YCWA 1RTOA 1VQFA 5FO8B 1N36Q 1KQSA 1WTOA 4R1JA 1Z7TA 1FVIA 1SE2A 2IHFA 1FJGQ 4KY5A 1GHKA 2MGSA 1JCKB 1O80A 1EWIA 3M4PA 5JAVA 1UE7A 2Q2IA 5M3MB 1QZHA 2EXZA 3J7A5 2KJXA 1AZQA 3H09A 2Q2TA 1B9NA 3N6RA 1UUPA 3L9AX 3HRZC 1SDFA 1JWSD 1BNZA 2F0JA 1BCPC 1QG7A 4X3SA 1ICFB 3I4MB 1B3QA 2UXBL 4JI7L 1PXUA 1U9RA 1S5BD 4C3IB 3H0GB 3K81C 1MFSA 2IHEA 1KDCA 2IY5B 2K32A 4A3BG 4A3DH 4XTCS 4ZUIA 4LF9L 3OMGA 4NW2A 4B3SQ 2VQEQ 3S1QB 5KNBA 1L0XB 4C1NK 4GKKL 1A3VA 5IWAQ 5C0XH 3EFXD 5C5LA 4B9XA 1CK1A 5KYIA 1E0BA 2EXDA 5J3BA 1DXMA 1Q3LA 4HIDA 4GN5A 2M9VA 1VQDA 1J6QA 3PO3G 3PIOA 1JQYD 1HZAA 4FNFA 1KTKA 3HOVH 1RKNA 1NR4A 1OXTA 2LKVA 5C44B 3HOWB 4FF1A 1X54A 1EIFA 1Z6HA 4JI5L 2PPBC 2KA7A 4FP5D 2A74C 5C4JB 2RCNA 3BVGA 3UDGA 5CR3A 4DV7Q 3CD6A 3I4LA 4WJWA 1IBKL 1X56A 1Y1WG 2L11A 1G2TA 1A62A 1EZ8A 1SNOA 1QCBD 1VQMA 2PI2E 1NMFA 3HFZB 3KUPA 1JJGA 4DUYQ 3LX0A 4KKSA 2B63B 3TBIB 4HJ8A 1KL9A 4OELB 4HIKA 1Y1VH 3V05A 1K8OA 2XWBB 3H3VI 1VDZA 2IX3A 2K05A 4KI0A 5CV6A 5FLMH 4DR6L 1WCMB 3CMAA 2JSOA 2F03A 2KHIA 3F2CA 2HHHL 1E1TA 1YJ9A 1ET9A 4DNTB 1WTPA 3GP7A 4DAYA 1B2TA 3PGZA 1L1OC 2FFKB 4LW1A 1YNJD 5M5XH 5KGUA 1MHWC 2Z6BA 1UE1A 1NBWA 3S1NB 5LMNQ 3S2DB 3CMEA 4OO1H 3VA5A 4GN3B 4DV2Q 2VXWA 3SK4A 4APVA 3MXNA 4A3FG 3CCRA 3HOYG 4LF7L 3NTKA 3TP6A 1G6PA 1Y14B 2QCPX 4ID6A 2VZAA 2E2JH 2B2YA 5M3FG 4RGTA 2B2UA 2IT1A 5IGBA 4TSSA 2JEBI 3KJOA 1S5FD 3R8BA 4IOAA 2PQEA 4ME5A 1KNEA 3NWTA 1NJIC 3RLFA 4C3HB 5ELNA 1N32Q 1SE8A 3K0XA 2F0VA 1TS3A 3ICEA 3I73A 2QDLA 5LMNW 4F8MA 2MUYA 4JYAL 2DNCA 1G91A 3AB9A 5C4ZA 1KLGD 1BXTA 3KF6A 4NXNL 2R92B 3GTGB 2K5HA 4ABNA 3K0YA 2E2HH 5D14A 3KF8B 2DGYA 3C1FA 4JPBW 1KXLA 5K36H 4DN4M 1BKBA 2K75A 2FINB 4E6IA 3G71A 1ONLA 3T13A 3K6OA 2AUJD 4UP9A 1A2UA 2KOLA 4YHHQ 4HCSA 4A93G 2A69D 5TSSA 4N9TA 2QEXA 1XYIA 1JT8A 3HS0C 5J39A 4IJHA 4IUPA 1LLRD 4KK7A 2YTVA 2AWOA 3T16A 4P71A 1H9SA 1VQHA 4IN3A 5IYBH 3QOJA 1HZ9A 2EY1A 3IAYA 4LNQA 4XYQA 3A7LA 3G4SA 4L63B 3U4ZA 1SMYC 4KN4C 4JI6L 3S15H 5JEAH 5J1ZA 5I6YA 2O4XA 1V1QA 1XWEA 2Z4IA 1E22A 3RN2A 4FVMA 1Q8KA 1BJ6A 3NBIA 2F0DA 3F1ZA 5D65A 3W1GA 3RLOA 2NVXH 2XSCA 4DKAC 4LFCL 1EY4A 1H9MA 1X3PA 2JA7G 2JA8G 2NVTH 3BYYB 4ZCKA 3EROA 2VY3A 3E9IA 4BY7G 4QCLA 4LF5Q 1H95A 1VQLA 2Z6KA 4IURA 5CBEE 3SK6A 1RTNA 3I72A 3I4NH 1E7ZA 2BDNA 1X3EA 1IBMQ 1MI2A 3HOXH 3ERQA 2Z8LA 3BZDB 4R4TA 4GOPA 2FMMA 3A5UA 1KRTA 4BBSB 2BH2A 3FKIG 3MXUA 1PV4A 4OWTB 1E2WA 4CKBA 2A73B 3BJUA 3HOUG 1TWAB 2MQHA 4KLKA 3NHHA 5C5MA 2LXKA 1HTPA 3UDXA 3P1HA 4A3IH 1XNRQ 1VQOA 2K01A 1JORA 1Q12A 1HA6A 4BXXH 3TREA 3MVVA 4G7OC 4YY3L 1EEID 4PNYA 4A3GB 4IZ8A 1YHQA 4DUZL 3RLNA 2BOSA 2ZXOA 4JI8Q 4JOIC 2AQ2B 3CKIB 1D1IA 1K83H 3PUXA 4B9WA 1KAWA 2WAQG 2YU9B 3M7NA 3FHWA 1EYGA 4X62L 3QG1A 2OT2A 4HJ7A 1JJCB 3AQQA 1CA5A 3JAMc 1SYCA 1TVXA 4L5QA 3GTKB 2FHTA 5EKIA 2F0MA 5EPJA 4NMZA 2IWHA 2NZOA 1C48A 2N55A 5C6AA 1V1PB 2PZWA 4DV4Q 3KBGA 2N88A 5HY6A 4A3BH 4U673 1G6ZA 3C46A 3T1YL 5I9PA 3RUZA 1YNND 5AJ3Q 3T56B 3ERSX 3HKZG 1ESKA 3CRKC 2YTYA 3ULLA 2F3IA 1LABA 3Q6SA 4J1MA 2F0LA 4BWGB 1CSQA 2YSAA 3WWVA 2GN5A 2O5JC 4YCUA 1R4PB 4XDXA 4JC0A 2Q2HA 5IGFA 1CKNA 3V2TA 5CGKA 2HQEA 3KK7A 1D8LA 1XPOA 5ELCA 3FP9A 1GUSA 3PO2B 4A3DG 3CCSA 2AUKA 2CWAA 4LF8Q 3TEHB 5JVH3 1O7IA 1B1ZA 2TSSA 3T1HQ 2K50A 4LUOA 2CWPA 3GTOH 5EBDA 2JYOA 3CCUA 5C0XG 3E0EA 4X3TA 4B3MQ 3ER0A 1KABA 2KVMA 2MJ8A 4JG2A 1Y1WH 2EYFA 3QOLA 1N34Q 3H15A 1F2MA 3T51B 2EZVA 2EE1A 4G57A 1M90C 3NQIA 3OSOA 2XGTA 4QQBX 3DEOA 1DGSA 1BBWA 3V96A 4LFAQ 5IE8A 4K2KA 2EYJA 4G4KA 4IPHA 1NY4A 2EYMA 3GDEA 1EOTA 2JXMB 1HNZL 5EQ0A 5GROA 2RCFA 1CHPD 4C3JG 1XMQL 5IT9E 1I4HA 2N3SA 3I70A 1PFMA 3A7AB 2BE5C 3WDNA 4KV6A 1WTVA 3TS2A 1VMPA 1SYDA 5ISRA 1FR3A 4KKUA 2D0PA 1STNA 2F0OA 4N8X1 4FF4A 2MO1A 3I91A 1UEAB 1YVCA 2K6AA 3EJIA 4POFA 3VR4A 3BVZA 4X65L 1W3SA 3S1RB 1FD7D 3M4QA 1I94L 5FO7B 1LACA 3TSSA 2EXFA 1WTQA 1EU3A 2EOTA 2Q8IB 4X6AH 3RZOB 1SNMA 5DM73 1QWYA 4GKJL 1VQ5A 4DV0Q 2F0IA 2A68C 3E3XA 3PIP3 2OQKA 1HFNA 1HR0L 1DYQA 2ZM6Q 5BR8Q 2F3WA 2HDLA 4M8AA 1PH8A 4OO1G 4RGNA 2UUCL 3S2HH 2IX0A 1KHIA 3NUCA 2EPBA 5GAHC 2D62A 1X3QA 4R9WA 1PRTF 1RJTA 1HNWL 1HZCA 1NUCA 5C0XJ 1Y1VB 2F0SA 1XXGA 3MC0B 3HKSA 3J7ZC 5JJIA 4QF4A 1ESRA 2MO0A 2AHOB 3URYA 2XIWA 2NTTA 3OW7A 3GTQB 2NTSA 3EA6A 4WRDA 4YWLA 4LF4Q 2JA5G 4RGMA 4A3MG 2A8VA 2UUAQ 4HTHA 2AKWB 1YNXA 2XRSD 4KY6A 5IGEA 3AFQA 1II3A 2EYOA 1U4LA 5M5XB 3NTIA 1TS5A 4DU9A 1WTWA 1YZ6A 5IODA 1LYLA 2X6GA 2CQFA 1AN8A 4V190 2F4VL 3DXJC 4RH6A 4Y7NH 5K36G 4GNXA 4K5VA 4R8IA 3OIQA 3I90A 5C3XA 1JC7A 1YNJC 1OTCA 5FKAC 1U6PA 1RF2D 4OGQC 4NDXA 2JQOA 3DWAA 5CORA 3MTSA 1ZYRD 4JI4L 4BA1I 1AZPA 5BN4A 4NXMQ 4HEDA 4K6DA 1SYGA 3KOJA 4PG3A 4FYDA 3AFPA 3E0JA 4DR2Q 2JA8H 3J81j 1XNQQ 4JBMA 2QW7A 1TXYA 2GVBA 4BY7H 1VQKA 2IX1A 1N33L 5JEAG 1SNPA 3MAQA 1C8CA 2E75C 2E2HB 1GD7A 4X64L 3L0OA 3K59A 5C0XI 3RR5A 1U5KA 1VQ8A 3S24A 3GTPB 5JJKA 2Y0SE 1TWCB 4KJNA 4DR3Q 1DOMA 3FKIH 4IPDA 1TU2B 3PUVA 4CDFC 1KAAA 3UE1A 2Y0SB 1Z9FA 1J5EL 4LFBL 4ZKCB 4DF7A 3VYRA 1K8AC 5CMDA 4PQXA 5CBAE 3K7UC 3IL8A 1IXRA 1VQGA 3I8ZA 1DD2A 3BU2A 4DR7Q 4O42A 3CCMA 5K5PA 2VS1A 2QEJC 4PZ7A 4DAPA 1MKHA 1PA6A 5CYUA 4R4IA 1D5ZC 4QL5A 2KECA 1L2FA 4POGA 1Q86C 3JAMi 2OTLA 4B3RL 4Q5VA 2E2IB 1FJGL 2A69C 4OWWB 1N8RC 4IUVA 1TT2A 4KHPL 4XXEA 2AWNA 4IFDG 1K8GA 1RIPA 1EWCA 5JJZA 5T1IA 2VUMH 3HOZB 3MWYW 2B2VA 4A3IG 3F2DA 2OXPA 3HEJA 4BXXG 1EL0A 1PFSA 1K0SA 1EIGA 3QB3A 5FLXE 5IYDH 3VYUA 1TWGH 1WI5A 3VYSA 2ATWA 4A3CG 1XTCD 3NEMA 4PMCA 3I4MG 4QB4A 1L1OB 2F4IA 4RAUC 3J80c 1TIID 2G5DA 2KQ3A 2L12A 2VQFL 3I4NB 3M4OH 4BBRB 2EY2A 2PW5A 2F3VA 3HOXB 5LMUQ 2WFWA 1S5ED 2KENA 1SYBA 4DAMA 5IIFA 4RCOA 4B3SL 4KTAA 4AIMA 1EQTA 1ENCA 2UUBQ 2I46A 4OO1I 4EQNA 4QGUA 1I3QH 1ASZA 1T5XD 2BE5D 2RHSB 3D6WA 1HFGA 5JEAJ 2D5DA 2K14A 1C9OA 4RCNA 2MHVA 3ITPA 4ZUJA 3NP8A 1CT1D 2G9HD 2MFIA 4XQNA 3NE5B 3K58A 2K4KA 5C4XB 3A54A 1XTDA 5I2XA 1BBXC 2B2TA 3DM3A 4DV5Q 5C44G 1EY0A 2Q2UA 4QMGA 2YTXA 5LHY1 1MSHA 1I50B 4IOCA 3G6JB 1GUOA 4JI7Q 2A68D 1K9MC 4DK1A 3D4WA 1HUMA 4KJOA 2NVQB 3S17H 3DEPA 1HRJA 1NTGA 4RHRA 4A3KB 4ZLTF 4OWXB 2R93B 1PRTD 1EQQA 4A3BB 1JOOA 1GJXA 2D9UA 1ML0D 4LF9Q 4LK1C 4CJ0B 4C3JH 3TZDA 1WFQA 3KDFB 1VCIA 1NSNS 2HIXA 1G51A 1GUGA 4P73A 1PTOF 1PH5A 1F2LA 2Z9HA 3U58A 3NQTA 1YNNC 3BS1A 2KCMA 2K7VA 1LUZA 5KIXA 3H3VC 2NUCA 4MNOA 4RMFA 2JA9A 2F0GA 4DXFA 3PO3B 1SAPA 1JWMD 1PHJA 3E5SA 1OXUA 3KFUA 5C3EG 2C5CA 3RZDB 4RGOS 1VQPA 3DWQA 3PUWA 4IALA 1TWFB 3D8GA 3STBD 1M4VA 3W5OA 3Q22A 4WORA 3DM1A 3DHQA 4JI5Q 2CQOA 2IL8A 4R4OA 4ZKBB 4DV3L 3KLRA 4X3UA 4R8NA 1WTRA 3VYTA 1PVOA 1STGA 1ESFA 4HN7A 1C4QA 1ICWA 3B6YA 1Y1WB 1HUNA 4OL7A 1IBKQ 1E1OA 2HT1A 1XJVA 1EQRA 3I4OA 1K0RA 1JE5A 1N32L 3K80C 4DAVA 4KD3A 1IBLL 3CQZB 2IPKD 3K5NA 1BVSA 1IYUA 1TS2A 3JAME 3PUYA 1JJ2A 5KEEA 2E5LL 5ELDA 5IT9L 3HG9A 1IKMA 1SN8A 5COYA 4FXKC 3Q24A 3NBHA 2LMCB 3RN5A 4JI0L 1L0YB 3CCEA 2JA5H 3CC4A 2K5WA 4A3MH 2HHHQ 1WD0A 1DJRD 5E4XA 4I65A 3ZJYC 1STHA 2KCCA 1BQQT 4DR1L 4A3EG 2PQAA 4LWCA 1IHZA 1CQFA 1JB7A 5CV9A 2LS01 3CPWA 3OIPA 3J7AV 1Q90A 5E7NA 3LNNA 1ET6A 2WP8J 1ILPA 1PH3A 4IO9A 1F2YA 3K8AA 3OWFA 3I3CA 2PW7A 4A3FB 2LY7A 3HOYB 3SDZA 4FF2A 2QDBA 4LF7Q 4HSPA 2V4DA 5IGDA 1LT4D 1OO9B 1G291 1V1OA 2CH4W 4H7BA 1MJEA 3EN2A 5M3FB 4YWKA 1L0WA 4ZQ3A 2B3GA 1EOVA 3BDCA 1VF5C 3KJPA 2BDOA 1R9TH 1PTOH 4YWMA 3ND9A 3S9WA 1X9NA 1VQ4A 3M85A 4JI1Q 4JYAQ 1QOHA 3L7ZC 1WWFA 2RSOA 2A19A 2EVBA 1D7QA 2CCZA 4K8IA 4C56C 2CH4A 1GUNA 2EJFC 3I7FA 1VQ6A 2RKSA 2RA4A 1GUWA 1J8IA 3J81c 1UE5A 3OPOA 1S5DD 3M3YH 2K04A 3LGJA 2NWGA 3GTMH 1IBML 1VMCA 4NB3A 1W6JA 2A6HD 2NZHA 4A93B 1JICA 1I6VC 3WOFA 2SNMA 1I6HB 3RD4A 1SJHD 1Y69U 4JCVE 3U50C 3NWSA 3C2PA 1GKHA 4F7XA 3PIPA 1LO5D 5EPKA 4DV1L 3CHBD 3K7AB 1X65A 3W1BA 1XPUA 3A8JE 3AEVA 1ZEQX 4JI6Q 4GN4B 1FNVA 5M3MH 4ILWA 4IFDH 4H13C 2I0QA 5FOBB 1BDOA 1GUTA 2IJ0A 2KEEA 1CTMA 3EBEA 4TKOB 3J80i 4AH6A 2KCTA 2ICIA 1EIHA 2PNRC 2NB0A 3CW2C 2RF4A 1F9PA 1KLUD 4A3CH 2WACA 3P20A 3G48A 3I4MH 1V43A 4HJ5A 2JA8B 2JA7B 1HA5A 4QY7A 2CVRA 2L5TA 4CBVA 1Q1EA 1EYCA 1MJCA 1VF7A 3CU7A 5I9OA 4OX9L 1ZYRC 4PV1C 1NCVA 4C3IH 3H0GH 3MA2B 4GLXA 4WFN3 1YI2A 1Q82C 1PZID 5M5YB 4KN7C 4JW0A 2BA1A 4DAYB 4C2MH 3GTLB 4KMUC 2VUMG 3A5ZB 2ZXRA 3FKIB 1UWVA 5M5WH 1AAFA 1PTOD 3PV0A 4IPCA 1KNAA 3HOUB 1SMXA 1MD2D 5IYDG 4DA2A 5GADC 1NE3A 1R4QB 2JE6I 3SVMA 2L0CA 4LF6L 3MXNB 4IUUA 4L5SA 1TY0A 1YITA 2VB3X 2IHXA 4IJLA 1SNCA 4YY3Q 1YIJA 4BY1B 2NVYB 4DUZQ 4UY8C 2LI8A 4JI3Q 1PRTB 2K5NA 3A8IE 2WAQE 1WWDA 1A3TA 4RWSC 4DGZA 2K28A 3SHLA 3GTJB 4A3LG 3FPUB 1QILA 1RL2A 2ID0A 1X6OA 1Z47A 2WAQB 3EIVA 4EX5A 1SFOH 5C44H 1CZWA 4X66L 1PYSB 1TQOA 2H5XA 5I6WA 4O2DA 4X62Q 3Q8DA 3DUZA 1RHPA 4IUTA 5FLXL 1WTXA 3CCVA 4PMBA 1SBBB 4ZYSA 5C4HA 4B3ML 2B2TC 1HNXL 2WKDA 1B3AA 1PYBA 2NBFA 3HKZE 3JC66 2P5ZX 1WD1A 1MSGA 3HKZB 3NYBB 4LFAL 4LJZC 2B63H 2OTJA 3M4OB 4K2LA 2E2DC 1SE3A 1BR9A 4DR5L 1O7LA 5BN3A 3TP5A 1WCMH 1LT3D 1LTLA 2JJQA 4I7AA 2DUDA 1XMOL 4L6TB 4ZAIA 1H9SB 2C35B 3MEFA 2Q8TA 2MNAA 3CC2A 4JV5L 4JBWA 5C3EH 1I4PA 1JWUD 4FDBA 2F0WA 3F2BA 1WYDA 4A3DB 2RVLA 3BDLA 2HCCA 3VA7A 2F0HA 4KD4A 1CHQD 5EGTA 3S1NH 2A5HA 3S2DH 2B29A 5DNFA 4IUNA 3VR3A 3WOEA 4I7ZC 5IP7G 2LSSA 1OXSC 3O13A 2Z0SA 1EEFD 1QUQA 3U9OA 4CJ2C 5A2QE 2GVAA 5IYCH 2KHSA 1QJOA 2H4OA 2UXDL 4J6HA 3MZ5A 4C3HH 2ZJRA 3HOVB 1GO3E 3A55A 4J15A 4UDUC 4HR7B 2F0NA 4O0AA 1VQ7A 2PO4A 4K0KL 1AW7A 2B8GA 4GOPB 1D5MC 1KDBA 2R92H 3M7GA 1K28A 3GTGH 4AQYL 3F8TA 1O7YA 1HNZQ 1EY8A 1EYAA 3NTHA 1SNDA 5D3IB 5EKKA 5EJWA 3PMFA 4C3JB 1XMQQ 2OWOA 1I4GA 2J0TD 1F6UA 4ME3A 3UDFA 5JVG3 1L1OA 2VL6A 1BOSA 2TMPA 4YIJA 2B2YC 2KEDA 3J80E 4A3EH 2WB1G 1PRTC 2B2UC 1EWHA 3MXGA 1VQ9A 2K5QA 5IOCA 1HQRD 5CV4A 4PZ8A 1RODA 4KY7A 2C9OA 2Q8RE 3GQBA 2DN8A 3CPFA 3J7AF 2UUAL 3IKJA 4P2CB 3S16H 3TDQA 5E3FA 1EYDA 1UEBA 1X55A 1DOKA 5EPLA 4JI2L 3R2TA 2ENBA 1S5CD 1QNKA 4EQPA 1I94Q 2X69A 3J7YW 4DR4L 1IZ6A 1VQNA 4OONA 1JMCA 1SEBD 5IP9G 2D0OA 4HAEA 3P7JA 4AYBE 1DONA 2HDMA 3ND8A 2ZTCA 4HCEA 4F88A 4GKJQ 2EYHA 3MFGA 5L37A 4X3KA 4AYBB 2XN9C 4S3SA 3VDYA 2F0TA 3STBC 1HR0Q 1HTLD 3J81i 1EFID 2UU9L 2RSNA 2UUCQ 4A3JG 1EU4A 3A0JA 5F2DA 3JAML 3PUZA 4DV6L 2PCFB 1LTID 1HNWQ 3I2ZA 2E2JB 1TWHH 2K5VA 4DNIA 1STEA 3TP7A 3OTOL 4MTNA 1PDQA 1A8VA 3SR1A 1A3UA 4CGYB 3KLSA 3GV6A 2OEOA 5ELFA 1GM5A 1HR0W 4KHVA 2JA5B 4A3MB 1LTGD 5BN5A 1RCVD 2HUGA 2A1AA 3FVQA 1AP0A 1CKNB 1XX8A 2CW0D 2UXCL 4DR3L 3K5OA 5DAUA 2ES2A 4ALPA 1ZKOA 1JE4A 1U4PA 2JA6G 3P75A 4RKLA 4QUCA 2RBMA 1E3PA 1TWAH 1PFNA 1Q46A 2RDGA 4NP5A 3K57A 4B3TL 3MFYA 2F4VQ 2R3ZA 2EYPA 2XRQD 5T1GA 2R6GA 3QWNA 1K73C 4CDEC 1AH9A 3TQYA 3BVMA 1RDPD 4LAAA 4UHVA 2PI2A 1LV9A 5FJ8H 1EY5A 2KCNA 3S14H 2EY6A 2Z6KC 3X3MA 1W2BA 4B08A 4RG1A 1YJNA 2F0UA 3ULJA 3NK9A 4HJAA 2R7ZG 1R9TB 4GOPC 2YU9H 4JI4Q 2HCIA 2E76C 2PZTA 5DEHA 1N36L 3HOZG 4H02A 3GTKH 2RQXA 2V1CC 3FPPA 4YCVA 4JVZA 2ZJPA 2QGQA 1N9WA 1D5XC 3S15B 4L5RC 1N33Q 5IT9c 5AFWA 1Q8IA 1UAPA 5M3MG 1SNQA 3CF5A 1PH7A 2B2WA 1VS0A 5G3LF 2PMZE 1K8MA 1G8ZD 4XQQA 5JPMC 3M3YB 4JBKA 3OWEB 2PMZB 1Q3YA 4BBRG 2NVXB 3KYHC 1U4RA 4LFBQ 1IL2A 2BH8A 4A4IA 2A6ED 4P74A 2B8FA 4C1NI 2NVTB 4TRDA 1EY9A 1QE6A 2CHBD 2UUBL 1LTBD 4JOIA 3H0GG 4XT3B 4C3IG 2A6HC 2M3ZA 1PFBA 3DLLA 5ELBA 2O2LD 4B3RQ 4A3LH 1IYVA 1SE4A 3PO2H 1CSPA 3IFTA 1BUVT 3SK8A 4KHPQ 2ZXPA 2VQEL 1SRUA 2D2CC 2XNAC 3KF8A 1B9MA 2J7ZA 5KNCA 1K3BC 1Y8OB 4CJ1B 1A15A 5HGTA 4FXGC 5IWAL 1GVPA 5C4XG 4GLAC 4A3IB 4XT1B 4XQJA 1Q81C 4DV5L 1CFMA 1GHJA 1WOCA 1ENAA 4Z9CB 1H9KA 2L1BA 3H91A 3NELA 1PH4A 3SXHA 2QKIC 5EKLA 5LL6X 4RFBA 1AE2A 1BCPF 1K3RA 3D6CA 1CI3M 1K83B 1I4QA 1NNXA 2SDFA 2ALYB 2VQFQ 1QZGA 2EY5A 3TP8A 3QO2A 3GV3A 5CC4A 3HOWG 4A3KG 3OYYA 4ODGA 2R93G 3FEWX 2DNEA 2F0QA 5HGQA 1SLJA 4K8JA 3Q0AA 2K33A 2M00A 4H44C 2F1MA 4XIGS 3VR5A 4C2MB 5M5WB 4IUQA 2UXBQ 3M4YA 3PCOB 5CV8A 4DV7L 5E1FA 4CDDC 4EQOA 3J81E 1D6EC 2EDGA 2WINB 5GQOA 1B53A 3CXCA 2XVSA 5M9OA 3GO5A 1PZJD 1I4XA 2F52A 4DUYL 4GNXB 4IFDJ 3HGBA 1PTOC 2B63G 1CA6A 2SOBA 1X32A 2RDHA 1CKMA 5I4DA 5IP7H 2NN6H 4GKKQ 3C1EA 4ZRZA 1FGBD 3S1RH 5FK9C 4BS9A 4OHJA 1F2ZA 3D4DA 1B8AA 1W6KA 1SFOB 4QJFA 3AMUA 1WCMG 4NPSA 4ZK9B 3OMCA 4K5XA 3RZOH 1A6BB 3TN2A 3I55A 3ZYYX 3S1MH 1DM0B 3IFDA 2JZWA 4WJ4A 5LL6S 5LMNL 3AYHB 4J8QA 1ENFA 4DV2L 4O1NA 1FYCA 1U0LA 3LWEA 2K03A 3R3OA 3GTOB 3EQLC 1HJPA 3T53B 5DM63 3A74A 1WTHA 3I56A 4Q0FA 5J22A 1WWGA 5IYCG 4LUVA 3ONAB 1EY7A 2F0KA 5KYLA 4G7HC 1JOQA 4C3HG 1CQVA 3GTQH 1V8QA 1J9OA 3MEHA 1S72A 1CM9A 1VQIA 3HZXA 2JN4A 3R93A 1I5FA 1IW7D 2AQ3B 5KRUA 5C3EB 1MGSA 1P8LA 4N8FA 3X3NA 2MP1A 3CCLA 4EGVA 1JR0D 1LTRD 2R92G 4IFDI 5CV7A 4DR6Q 1NMGA 1V1PA 5IP9H 3H6MA 2EC7A 1P16A 1GOZA 1LM0A 5A2QL 4DK3C 4DV3Q 3NXWA 5FLXc 4YHHL 1S40A 2L9HA 4EQ5A 2F0EA 2YV5A 3FMCA 4A3JH 1C0AA 2ZT9C 2XTIA 3C3LA 1E2ZA 1IBLQ 4QUFA 3NENA 3QJYA 4GZYC 4JI1L 2WKCA 1ZXTA 1PZKD 2YYZA 4LUZA 1TS4A 2FJ2A 2E5LQ 4KKTA 2MPMA 2K52A 5C3WA 4PZ6A 3J80L 5G3LD 3M9BA 4JI0Q 1ILQA 4GNXC 4LMQD 3TZUA 3NSWA 1AE3A 2HIVA 3GTPH 4Y52H 1TWCH 3W2DA 1EZ6A 4A3EB 4DR1Q 1U4MA 2JA6H 3S2HB 1STYA 4NXNQ 3BZKA 3U9SA 4DPGA 2O5IC 2ASBA 1QVGA 2M2LA 3QIAA 2QF7A 2I5MX 2N49A 3S16B 1QB5D 4L8JA 4LF5L 2LXJA 3CCJA 1Y8PB 4MHEA 1UE6A 3G6EA 4JK1C 2X6LA 1PH1A 1H9RA 2F0PA 1HCZA 1HXYD 2E2IH 3KBXA 1PMRA 5JJLA 4RA8A 4FXDA 2R7ZH 3H3VH 3D3RA 4BBSG 3CC7A 1SROA 3K5MA 3BDOA 1T9HA 1YBYA 3EVQA 3PF4A 1A1TA 1PYWD 5GAEC 4UAIA 5IY0A 5A35A 3HOZH 1XNRL 3AU7A 2WV6D 1B44D 4P75A 3SEBA 4FF3A 4Y7NB 1SYFA 1WWEA 1EFWA 1UNSA 2G9DA 3H94A 1LTTD 4A3GG 1BCPD 3OOCA 1D1KA 4K6LA 5FJ8G 1TWHB 4MTKA 4TQUS 1IL8A 1M8AA 3QR8A 4JI8L 2QILA 1TKWB 1E2VA 2ZJQA 3N52A 2EQSA 2DY8A 4HSVA 4BBRH 1JOKA 1DZ1A 2EYLA 1EY6A 3PIO3 1YJWA 4LFCQ 3GD7A 4K5WA 3IRBA 2B2WC 4BY7B 1YHAA 2B2VC 4DV1Q 3CCQA 4DV4L 1VQCA 2Z1CA 2CW0C 1PH9A 1VQBA 5HURA 1IKLA 5AJ3L 1DCZA 4BY1G 4JI3L 3S1QH 3S14B 1EUJA 1A63A 1CZGA 3E6ZX 1FGUA 5C4XH 3ULPA 1MIUA 1B7YB 1JB3A 5ELOA 1I50H 4GLVB 3RMHA 1HZBA 1DOLA 1F9RA 4ULLA 2JK8A 2PYKA 3MHBA 1KC8C 1TR5A 4OXPA 3RNUA 2LFNA 2L15A 3PO2G 4OX9Q 2NVQH 1X3FA 3NBHB 2J4XA 4LF8L 2EIFA 3HOWH 1FNWA 2N8NA 3SGIA 1IYJB 5GAGC 4A3KH 2R93H 3T1HL 2BA0A 2PQAB 4CKEA 1BF4A 2VUMB 3TS0A 3KLWA 5C4JH 4DFAA 1NAPA 3KF6B 2K5DA 2K1BA 4EVOA 2VB2X 4QIWE 4DNRB 1N34L 1TWGB 2I5HA 1C7YA 1LT6D 4LF6Q 4A76A 3BZCA 4QIWB 4OIJA 1BBUA 1VQJA 3T1YQ 4GS3A 4DXGA 5KNDA 3W3AA 4MZ9A 3PO3H 4JBJA 1SSOA 4HMIA 1A6XA 3RZDH 2A6EC 2L55A 2QA4A 1TWFH 2JP1A 3UE0A 1HPCA 3MXPA 4X66Q 4R4QA 1A2TA 2HQLA 1B50A 4OIKA 1I3QB 3KLSX 2RDFA 2ZTDA 1KD1C 1HH2P 1EQVA 1OXVA 3Q23A 1MBYA 1A0IA 1HNXQ 2KBNA 3TMEA 3CRLC 1EIYB 2CKZB 4UP8A 4HIOA 3DMUA 2EJGC 2NN6G 3HOVG 3CQZH 1TY2A 4RHSA 2F0FA 5IGGA 4NKLA 2ZTEA 1M1KC 3VR6A 2E74C 1E24A 4V0BA 4DR5Q 1XPRA 3J81L 1KIXA 5CV5A 4DV0L 3D31A 4XYOA 1Y8NB 3OHXC 2KHJA 3E9HA 3SK5A 5H1SE 2R7FA 3HP3A 1XMOQ 2ZM6L 5BR8L 3S17B 1SXTA 4M1UB 4JV5Q 2IW3A 2OCEA 1BO0A 3D0FA 1SYEA 1WJJA 2OQ0A 5ELEA 4DK0A 1V9PA 3OW2A 2E8GA 1O7ZA 2CFMA
chains in the Genus database with same CATH topology
3TREA 1CUKA 3B6YA 4UP7A 1IBKQ 4JBKA 1E1OA 4YY3L 4A3FH 2HT1A 3HOYH 1Y1VG 1XJVA 1Q3YA 1EQRA 3I4OA 1YHQA 1K0RA 4BBRG 1JE5A 1N32L 3KYHC 2JEAI 4DUZL 3RLNA 3K80C 4LFBQ 1IL2A 2BH8A 5FLMG 1IBLL 4A4IA 4JI8Q 4JOIC 5M3FH 4LF4L 4P74A 1BVSA 1K83H 3PUXA 1KAWA 3PUYA 1JJ2A 2WAQG 2UUBL 2E5LL 2UXDQ 1SR3A 1VQAA 3M7NA 3FHWA 1EYGA 4X62L 4JOIA 3H0GG 4HJ7A 1JJCB 3AQQA 1SN8A 4X65Q 2M3ZA 4UPAA 4AYBG 3JAMc 1KRSA 3DLLA 4A3LH 4B3RQ 3RN5A 4JI0L 2R7DA 4L5QA 3CCEA 2JA5H 3CC4A 3PO2H 4A3MH 2HHHQ 1CSPA 4K0KQ 3ZJYC 4KHPQ 2NZOA 2I5LX 2VQEL 1SRUA 2PQAA 4DR1L 4A3EG 2PNHA 4LWCA 3UDIA 1JB7A 4DV4Q 3CPWA 4AQYQ 1Q7YC 5HY6A 5IWAL 5E7NA 1GVPA 4A3BH 5C4XG 2WB1E 4GLAC 3T1YL 1YEZA 2WP8J 5AJ3Q 4DV5L 1Q81C 1PH3A 3ERSX 4IO9A 1WOCA 3HKZG 3K8AA 3PF5A 4HJ9A 1ESKA 2AMCB 2YTYA 3ULLA 1ASYA 2F3IA 2VNUD 4LF7Q 3NELA 4R4CA 3U4VA 4NXML 1PH4A 1G291 1MJEA 1CSQA 2YSAA 3EN2A 4A93H 1AE2A 1K3RA 1PH2A 4YWKA 1L0WA 1CKOA 4DR2L 1I6HH 3WWVA 1XNQL 2B3GA 1Q1BA 2GN5A 3L2PA 2VQFQ 2ALYB 1EOVA 4KHZA 4YCUA 1QZGA 3HOWG 3KJPA 4JI2Q 4JC0A 1R9TH 2Q2HA 4A3KG 1CKNA 3OYYA 2FXQA 2R93G 4YWMA 1D8LA 1XPOA 4DR4Q 4WJ3M 5HGQA 1SLJA 3K7AH 3FP9A 4XIGS 1X9NA 1VQ4A 3M85A 4A3DG 4JI1Q 4JYAQ 2UXBQ 3CCSA 4LF8Q 2CWAA 3L7ZC 3PCOB 1WWFA 5EAYA 3TEHB 1PH6A 2A19A 4DV7L 1D7QA 4BBSH 1O7IA 2CCZA 3T1HQ 2K50A 4LUOA 3KDFA 5GQOA 4DK6C 2CWPA 3CXCA 3GTOH 2Y0SG 3I7FA 3GO5A 1VQ6A 2F52A 4DUYL 4GNXB 3CCUA 5C0XG 3E0EA 4B3MQ 4IFDJ 3J81c 2UU9Q 1UE5A 3ER0A 4BA2I 2L4LA 4DR7L 3TRZA 4JG2A 2B63G 1Y1WH 3M3YH 1QVCA 3LGJA 1N34Q 3H15A 1CKMA 4DV6Q 5IP7H 3GTMH 4GKKQ 1M90C 1IBML 3S1RH 4A3GH 4NB3A 1OXXK 2XGTA 4HIMA 1B8AA 5IYBG 1DGSA 2JA7H 4QQBX 2NZHA 1BBWA 1YHBA 5DLQE 4QJFA 1WCMG 4NPSA 4LFAQ 3OTOQ 5IE8A 4JCVE 3U50C 3PSIA 1GKHA 3RZOH 4IPHA 3PIPA 1NY4A 1A6BB 3GDEA 3I55A 4DV1L 1FL0A 4PMWA 1X65A 3S1MH 3W1BA 1HNZL 4TVAB 4IPGA 5GROA 2RHQB 5M5YH 1XMQL 3GTLH 2UXCQ 2JZWA 1XPUA 3AEVA 4WJ4A 2N3SA 5LMNL 3AYHB 1VQEA 1Q3ZA 4JI6Q 4DV2L 4GN4B 2VW9A 3HOUH 1U0LA 4A75A 3TS2A 5M3MH 3CAMA 2NN6I 1HJPA 2D0PA 2I0QA 4B3TQ 1S3OA 4X64Q 3A74A 3EBEA 3I56A 2MO1A 3J80i 4AH6A 2KCTA 1QVFA 1YVCA 1WWGA 5IYCG 4LUVA 4POFA 1QUQB 4BY1H 2NVYH 3CW2C 4X65L 2RF4A 3I4NG 3CP0A 1B70B 1W3SA 1X3GA 4A3CH 3M4QA 3HOXG 5LMUL 1J5EQ 1I94L 3GTQH 3G48A 3GTJH 1V43A 4HJ5A 3I4MH 2N78A 1S72A 4QY7A 1Q1EA 1MJCA 1VQIA 2EXFA 4OX9L 1I5FA 4C3IH 3H0GH 4X6AH 4L5TA 4P72A 4YCWA 1P8LA 1VQFA 4GLXA 4GKJL 1N36Q 4DV0Q 1KQSA 1VQ5A 2R92G 1YI2A 4R1JA 1Q82C 4IFDI 2OQKA 4DR6Q 1HR0L 1FVIA 1NMGA 2BA1A 4DAYB 2IHFA 4C2MH 5IP9H 1FJGQ 2VUMG 3A5ZB 5BR8Q 2ZM6Q 1UWVA 1PH8A 5M5WH 2EC7A 1AAFA 1P16A 1LM0A 3PV0A 4OO1G 4IPCA 1EWIA 3M4PA 2UUCL 3S2HH 1SMXA 2IX0A 1UE7A 5IYDG 1KHIA 2Q2IA 4DK3C 1QZHA 5GADC 4DV3Q 1NE3A 5GAHC 2D62A 2JE6I 3J7A5 5FLXc 4LF6L 2Q2TA 3MXNB 1HNWL 1HZCA 4L5SA 4YHHL 1YITA 1S40A 2IHXA 4IJLA 5C0XJ 4YY3Q 4EQ5A 4A3JH 2YV5A 3HKSA 3J7ZC 5JJIA 1YIJA 2MO0A 4DUZQ 4UY8C 1C0AA 2LI8A 4JI3Q 2AHOB 2K5NA 2XTIA 2WAQE 1WWDA 1IBLQ 4A3LG 3NENA 4YWLA 4LF4Q 2JA5G 2A8VA 4JI1L 1RL2A 2ID0A 4A3MG 2UXBL 1X6OA 1Z47A 3EIVA 4EX5A 1SFOH 4JI7L 5C44H 2YYZA 4LUZA 4X66L 2UUAQ 2AKWB 2E5LQ 1PYSB 2H5XA 4O2DA 4X62Q 3Q8DA 2K52A 1YNXA 3K81C 4PZ6A 3AFQA 1MFSA 2IHEA 2IY5B 3CCVA 3M9BA 4JI0Q 4GNXC 4A3BG 4A3DH 4B3ML 1YZ6A 1LYLA 4XTCS 2CQFA 4LF9L 1AE3A 2HIVA 2F4VL 3GTPH 4B3SQ 1TWCH 1HNXL 4Y7NH 2VQEQ 4DR1Q 4Y52H 5K36G 1PYBA 2JA6H 4GNXA 4GKKL 4NXNQ 3BZKA 3HKZE 4DPGA 3JC66 2ASBA 5IWAQ 1QVGA 1OTCA 1U6PA 3NYBB 4LFAL 2I5MX 2N49A 2JQOA 2B63H 2OTJA 5J3BA 2EXDA 4HIDA 4GN5A 4JI4L 4BA1I 4LF5L 2LXJA 3CCJA 4NXMQ 1UE6A 1VQDA 3G6EA 1J6QA 3PO3G 3PIOA 4DR5L 3KOJA 1HZAA 4PG3A 1PH1A 1WCMH 3HOVH 3AFPA 4DR2Q 2E2IH 1OXTA 2JA8H 1LTLA 3J81j 1XNQQ 4JBMA 2JJQA 1TXYA 2GVBA 4BY7H 2DUDA 1XMOL 5JJLA 2R7ZH 3H3VH 1X54A 1VQKA 2C35B 3MEFA 2MNAA 3CC7A 4BBSG 1SROA 1A1TA 1T9HA 1YBYA 3CC2A 4JBWA 1EIFA 4JI5L 2IX1A 1N33L 3PF4A 4JV5L 5GAEC 5C3EH 5JEAG 4FDBA 5IY0A 3F2BA 1GD7A 1WYDA 4X64L 3L0OA 3HOZH 1XNRL 2RCNA 5C0XI 3RR5A 1U5KA 1VQ8A 3S24A 5JJKA 3UDGA 3S1NH 3S2DH 4P75A 2Y0SE 4DV7Q 4DR3Q 2B29A 3CD6A 1WWEA 3FKIH 1IBKL 1X56A 4IPDA 1Y1WG 1EFWA 3PUVA 1A62A 4A3GG 3UE1A 5IP7G 2LSSA 1OXSC 1VQMA 1Z9FA 2PI2E 1NMFA 3HFZB 1J5EL 4LFBL 1JJGA 5FJ8G 4DUYQ 4TQUS 1K8AC 2Z0SA 4JI8L 1QUQA 3K7UC 1IXRA 1VQGA 2GVAA 3BU2A 2ZJQA 4DR7Q 5IYCH 2EQSA 1KL9A 4HJ8A 3CCMA 2VS1A 4PZ7A 4HIKA 1Y1VH 1MKHA 2UXDL 3H3VI 1PA6A 4R4IA 4BBRH 4QL5A 4C3HH 1L2FA 4KI0A 4POGA 5FLMH 2ZJRA 3JAMi 1Q86C 2OTLA 4DR6L 4B3RL 1GO3E 3CMAA 1YJWA 4J15A 2KHIA 4LFCQ 4OWWB 3GD7A 1N8RC 1FJGL 3IRBA 4O0AA 1VQ7A 3F2CA 2HHHL 1E1TA 4K0KL 1YHAA 1YJ9A 4KHPL 4GOPB 3PGZA 2R92H 4DV1Q 1L1OC 2AWNA 4IFDG 1K8GA 3CCQA 4LW1A 3GTGH 4DV4L 3F8TA 4AQYL 1RIPA 1HNZQ 1VQCA 5M5XH 3CCLA 2OWOA 2VUMH 1XMQQ 1PH9A 1VQBA 1F6UA 1UE1A 5AJ3L 1NBWA 4A3IG 5LMNQ 4ME3A 3UDFA 3CMEA 3F2DA 1L1OA 2VL6A 4GN3B 1PFSA 4DV2Q 4BXXG 4APVA 4A3EH 5IYDH 2WB1G 4A3FG 4BY1G 4JI3L 3CCRA 4LF7L 3HOYG 3S1QH 1TWGH 1EUJA 1VQ9A 1WI5A 1A63A 1G6PA 2ATWA 4A3CG 4PZ8A 1Y14B 3NEMA 1FGUA 5C4XH 3I4MG 1L1OB 2VZAA 3ULPA 2E2JH 3J80c 3CPFA 5M3FG 2UUAL 2IT1A 2JEBI 3KJOA 2VQFL 4IOAA 3S16H 3M4OH 1MIUA 1B7YB 1UEBA 1X55A 4JI2L 1NJIC 5ELOA 3RLFA 5ELNA 1N32Q 1I50H 4GLVB 5LMUQ 1I94Q 1HZBA 1SE8A 2WFWA 3K0XA 4DR4L 2KENA 1IZ6A 4OONA 1VQNA 2JK8A 4DAMA 3ICEA 5LMNW 4OXPA 1KC8C 3RNUA 1JMCA 5IP9G 2D0OA 2L15A 4B3SL 4OX9Q 3PO2G 2NVQH 4AIMA 4JYAL 1X3FA 3NBHB 1Q12A 4LF8L 2EIFA 2UUBQ 3HOWH 4AYBE 2N8NA 4OO1I 3KF6A 4NXNL 1IYJB 3SGIA 2ZTCA 5GAGC 4A3KH 4QGUA 2R93H 1I3QH 1ASZA 4GKJQ 3T1HL 2RHSB 2BA0A 2K5HA 3VDYA 5JEAJ 3STBC 2PQAB 1HR0Q 2E2HH 3TS0A 3KF8B 3KLWA 2K14A 2DGYA 5C4JH 1KXLA 1C9OA 3KF6B 3J81i 2UU9L 1BKBA 2K75A 2UUCQ 4A3JG 3A0JA 4QIWE 1N34L 3PUZA 4DV6L 2I5HA 3G71A 2MFIA 1C7YA 4LF6Q 4A76A 3BZCA 2K4KA 4UP9A 1HNWQ 1XTDA 3I2ZA 1TWHH 1BBUA 3DM3A 1VQJA 4YHHQ 3T1YQ 4A93G 2K5VA 4DNIA 4DV5Q 5C44G 4GS3A 3OTOL 4MTNA 2QEXA 1JT8A 1A8VA 4IJHA 4MZ9A 2Q2UA 3PO3H 2YTXA 4JBJA 2YTVA 3RZDH 2AWOA 1GM5A 1HR0W 4P71A 4IOCA 1VQHA 5IYBH 2QA4A 1HZ9A 2A1AA 1TWFH 4JI7Q 1CKNB 4LNQA 3UE0A 1K9MC 2UXCL 4DR3L 4X66Q 4R4QA 2ES2A 3G4SA 4ALPA 3S17H 2HQLA 2JA6G 3U4ZA 1NTGA 4JI6L 3S15H 4OWXB 1E3PA 1EQQA 2ZTDA 1TWAH 1Q46A 1V1QA 1KD1C 1HH2P 1OXVA 1E22A 3RN2A 4B3TL 4LF9Q 2F4VQ 4C3JH 1A0IA 1Q8KA 1WFQA 1BJ6A 3KDFB 1HNXQ 2KBNA 1VCIA 2R6GA 1K73C 1AH9A 2HIXA 3F1ZA 1G51A 3TQYA 3W1GA 1EIYB 3RLOA 2NVXH 2PI2A 2CKZB 4P73A 5FJ8H 4UP8A 4HIOA 1PH5A 3S14H 2Z6KC 2NN6G 3U58A 1W2BA 4DKAC 3HOVG 3CQZH 4LFCL 4RG1A 1YJNA 2JA7G 2JA8G 2KCMA 2NVTH 3ULJA 1LUZA 4BY7G 2VY3A 2ZTEA 3E9IA 4MNOA 4HJAA 2R7ZG 4LF5Q 1M1KC 4GOPC 4RMFA 2JA9A 2Z6KA 1VQLA 2YU9H 4JI4Q 1H95A 1E24A 1PHJA 1OXUA 1E7ZA 4DR5Q 1XPRA 1X3EA 5C3EG 3I4NH 3KFUA 1IBMQ 3HOXH 1KIXA 1VQPA 4DV0L 1N36L 3D31A 4R4TA 2KHJA 3E9HA 3PUWA 4GOPA 5H1SE 2R7FA 4H02A 3STBD 2V1CC 3GTKH 3HOZG 3A5UA 1KRTA 1XMOQ 2ZM6L 5BR8L 4YCVA 3W5OA 2ZJPA 2QGQA 3FKIG 1N9WA 2BH2A 4JV5Q 1PV4A 4OWTB 4JI5Q 4L5RC 1N33Q 2CQOA 2OCEA 5IT9c 3D0FA 3BJUA 3HOUG 4R4OA 1WJJA 2MQHA 4DV3L 2OQ0A 5M3MG 1V9PA 4KLKA 2LXKA 2E8GA 3UDXA 3CF5A 3OW2A 4A3IH 1VS0A 1VQOA 1PH7A 2PMZE 1XNRQ 1PVOA 2CFMA 4BXXH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TRE A;  1CUK A;  3B6Y A;  4UP7 A;  1IBK Q;  4JBK A;  1E1O A;  4YY3 L;  4A3F H;  2HT1 A;  3HOY H;  1Y1V G;  1XJV A;  1Q3Y A;  1EQR A;  3I4O A;  1YHQ A;  1K0R A;  4BBR G;  1JE5 A;  1N32 L;  3KYH C;  2JEA I;  4DUZ L;  3RLN A;  3K80 C;  4LFB Q;  1IL2 A;  2BH8 A;  5FLM G;  1IBL L;  4A4I A;  4JI8 Q;  4JOI C;  5M3F H;  4LF4 L;  4P74 A;  1BVS A;  1K83 H;  3PUX A;  1KAW A;  3PUY A;  1JJ2 A;  2WAQ G;  2UUB L;  2E5L L;  2UXD Q;  1SR3 A;  1VQA A;  3M7N A;  3FHW A;  1EYG A;  4X62 L;  4JOI A;  3H0G G;  4HJ7 A;  1JJC B;  3AQQ A;  1SN8 A;  4X65 Q;  2M3Z A;  4UPA A;  4AYB G;  3JAM c;  1KRS A;  3DLL A;  4A3L H;  4B3R Q;  3RN5 A;  4JI0 L;  2R7D A;  4L5Q A;  3CCE A;  2JA5 H;  3CC4 A;  3PO2 H;  4A3M H;  2HHH Q;  1CSP A;  4K0K Q;  3ZJY C;  4KHP Q;  2NZO A;  2I5L X;  2VQE L;  1SRU A;  2PQA A;  4DR1 L;  4A3E G;  2PNH A;  4LWC A;  3UDI A;  1JB7 A;  4DV4 Q;  3CPW A;  4AQY Q;  1Q7Y C;  5HY6 A;  5IWA L;  5E7N A;  1GVP A;  4A3B H;  5C4X G;  2WB1 E;  4GLA C;  3T1Y L;  1YEZ A;  2WP8 J;  5AJ3 Q;  4DV5 L;  1Q81 C;  1PH3 A;  3ERS X;  4IO9 A;  1WOC A;  3HKZ G;  3K8A A;  3PF5 A;  4HJ9 A;  1ESK A;  2AMC B;  2YTY A;  3ULL A;  1ASY A;  2F3I A;  2VNU D;  4LF7 Q;  3NEL A;  4R4C A;  3U4V A;  4NXM L;  1PH4 A;  1G29 1;  1MJE A;  1CSQ A;  2YSA A;  3EN2 A;  4A93 H;  1AE2 A;  1K3R A;  1PH2 A;  4YWK A;  1L0W A;  1CKO A;  4DR2 L;  1I6H H;  3WWV A;  1XNQ L;  2B3G A;  1Q1B A;  2GN5 A;  3L2P A;  2VQF Q;  2ALY B;  1EOV A;  4KHZ A;  4YCU A;  1QZG A;  3HOW G;  3KJP A;  4JI2 Q;  4JC0 A;  1R9T H;  2Q2H A;  4A3K G;  1CKN A;  3OYY A;  2FXQ A;  2R93 G;  4YWM A;  1D8L A;  1XPO A;  4DR4 Q;  4WJ3 M;  5HGQ A;  1SLJ A;  3K7A H;  3FP9 A;  4XIG S;  1X9N A;  1VQ4 A;  3M85 A;  4A3D G;  4JI1 Q;  4JYA Q;  2UXB Q;  3CCS A;  4LF8 Q;  2CWA A;  3L7Z C;  3PCO B;  1WWF A;  5EAY A;  3TEH B;  1PH6 A;  2A19 A;  4DV7 L;  1D7Q A;  4BBS H;  1O7I A;  2CCZ A;  3T1H Q;  2K50 A;  4LUO A;  3KDF A;  5GQO A;  4DK6 C;  2CWP A;  3CXC A;  3GTO H;  2Y0S G;  3I7F A;  3GO5 A;  1VQ6 A;  2F52 A;  4DUY L;  4GNX B;  3CCU A;  5C0X G;  3E0E A;  4B3M Q;  4IFD J;  3J81 c;  2UU9 Q;  1UE5 A;  3ER0 A;  4BA2 I;  2L4L A;  4DR7 L;  3TRZ A;  4JG2 A;  2B63 G;  1Y1W H;  3M3Y H;  1QVC A;  3LGJ A;  1N34 Q;  3H15 A;  1CKM A;  4DV6 Q;  5IP7 H;  3GTM H;  4GKK Q;  1M90 C;  1IBM L;  3S1R H;  4A3G H;  4NB3 A;  1OXX K;  2XGT A;  4HIM A;  1B8A A;  5IYB G;  1DGS A;  2JA7 H;  4QQB X;  2NZH A;  1BBW A;  1YHB A;  5DLQ E;  4QJF A;  1WCM G;  4NPS A;  4LFA Q;  3OTO Q;  5IE8 A;  4JCV E;  3U50 C;  3PSI A;  1GKH A;  3RZO H;  4IPH A;  3PIP A;  1NY4 A;  1A6B B;  3GDE A;  3I55 A;  4DV1 L;  1FL0 A;  4PMW A;  1X65 A;  3S1M H;  3W1B A;  1HNZ L;  4TVA B;  4IPG A;  5GRO A;  2RHQ B;  5M5Y H;  1XMQ L;  3GTL H;  2UXC Q;  2JZW A;  1XPU A;  3AEV A;  4WJ4 A;  2N3S A;  5LMN L;  3AYH B;  1VQE A;  1Q3Z A;  4JI6 Q;  4DV2 L;  4GN4 B;  2VW9 A;  3HOU H;  1U0L A;  4A75 A;  3TS2 A;  5M3M H;  3CAM A;  2NN6 I;  1HJP A;  2D0P A;  2I0Q A;  4B3T Q;  1S3O A;  4X64 Q;  3A74 A;  3EBE A;  3I56 A;  2MO1 A;  3J80 i;  4AH6 A;  2KCT A;  1QVF A;  1YVC A;  1WWG A;  5IYC G;  4LUV A;  4POF A;  1QUQ B;  4BY1 H;  2NVY H;  3CW2 C;  4X65 L;  2RF4 A;  3I4N G;  3CP0 A;  1B70 B;  1W3S A;  1X3G A;  4A3C H;  3M4Q A;  3HOX G;  5LMU L;  1J5E Q;  1I94 L;  3GTQ H;  3G48 A;  3GTJ H;  1V43 A;  4HJ5 A;  3I4M H;  2N78 A;  1S72 A;  4QY7 A;  1Q1E A;  1MJC A;  1VQI A;  2EXF A;  4OX9 L;  1I5F A;  4C3I H;  3H0G H;  4X6A H;  4L5T A;  4P72 A;  4YCW A;  1P8L A;  1VQF A;  4GLX A;  4GKJ L;  1N36 Q;  4DV0 Q;  1KQS A;  1VQ5 A;  2R92 G;  1YI2 A;  4R1J A;  1Q82 C;  4IFD I;  2OQK A;  4DR6 Q;  1HR0 L;  1FVI A;  1NMG A;  2BA1 A;  4DAY B;  2IHF A;  4C2M H;  5IP9 H;  1FJG Q;  2VUM G;  3A5Z B;  5BR8 Q;  2ZM6 Q;  1UWV A;  1PH8 A;  5M5W H;  2EC7 A;  1AAF A;  1P16 A;  1LM0 A;  3PV0 A;  4OO1 G;  4IPC A;  1EWI A;  3M4P A;  2UUC L;  3S2H H;  1SMX A;  2IX0 A;  1UE7 A;  5IYD G;  1KHI A;  2Q2I A;  4DK3 C;  1QZH A;  5GAD C;  4DV3 Q;  1NE3 A;  5GAH C;  2D62 A;  2JE6 I;  3J7A 5;  5FLX c;  4LF6 L;  2Q2T A;  3MXN B;  1HNW L;  1HZC A;  4L5S A;  4YHH L;  1YIT A;  1S40 A;  2IHX A;  4IJL A;  5C0X J;  4YY3 Q;  4EQ5 A;  4A3J H;  2YV5 A;  3HKS A;  3J7Z C;  5JJI A;  1YIJ A;  2MO0 A;  4DUZ Q;  4UY8 C;  1C0A A;  2LI8 A;  4JI3 Q;  2AHO B;  2K5N A;  2XTI A;  2WAQ E;  1WWD A;  1IBL Q;  4A3L G;  3NEN A;  4YWL A;  4LF4 Q;  2JA5 G;  2A8V A;  4JI1 L;  1RL2 A;  2ID0 A;  4A3M G;  2UXB L;  1X6O A;  1Z47 A;  3EIV A;  4EX5 A;  1SFO H;  4JI7 L;  5C44 H;  2YYZ A;  4LUZ A;  4X66 L;  2UUA Q;  2AKW B;  2E5L Q;  1PYS B;  2H5X A;  4O2D A;  4X62 Q;  3Q8D A;  2K52 A;  1YNX A;  3K81 C;  4PZ6 A;  3AFQ A;  1MFS A;  2IHE A;  2IY5 B;  3CCV A;  3M9B A;  4JI0 Q;  4GNX C;  4A3B G;  4A3D H;  4B3M L;  1YZ6 A;  1LYL A;  4XTC S;  2CQF A;  4LF9 L;  1AE3 A;  2HIV A;  2F4V L;  3GTP H;  4B3S Q;  1TWC H;  1HNX L;  4Y7N H;  2VQE Q;  4DR1 Q;  4Y52 H;  5K36 G;  1PYB A;  2JA6 H;  4GNX A;  4GKK L;  4NXN Q;  3BZK A;  3HKZ E;  4DPG A;  3JC6 6;  2ASB A;  5IWA Q;  1QVG A;  1OTC A;  1U6P A;  3NYB B;  4LFA L;  2I5M X;  2N49 A;  2JQO A;  2B63 H;  2OTJ A;  5J3B A;  2EXD A;  4HID A;  4GN5 A;  4JI4 L;  4BA1 I;  4LF5 L;  2LXJ A;  3CCJ A;  4NXM Q;  1UE6 A;  1VQD A;  3G6E A;  1J6Q A;  3PO3 G;  3PIO A;  4DR5 L;  3KOJ A;  1HZA A;  4PG3 A;  1PH1 A;  1WCM H;  3HOV H;  3AFP A;  4DR2 Q;  2E2I H;  1OXT A;  2JA8 H;  1LTL A;  3J81 j;  1XNQ Q;  4JBM A;  2JJQ A;  1TXY A;  2GVB A;  4BY7 H;  2DUD A;  1XMO L;  5JJL A;  2R7Z H;  3H3V H;  1X54 A;  1VQK A;  2C35 B;  3MEF A;  2MNA A;  3CC7 A;  4BBS G;  1SRO A;  1A1T A;  1T9H A;  1YBY A;  3CC2 A;  4JBW A;  1EIF A;  4JI5 L;  2IX1 A;  1N33 L;  3PF4 A;  4JV5 L;  5GAE C;  5C3E H;  5JEA G;  4FDB A;  5IY0 A;  3F2B A;  1GD7 A;  1WYD A;  4X64 L;  3L0O A;  3HOZ H;  1XNR L;  2RCN A;  5C0X I;  3RR5 A;  1U5K A;  1VQ8 A;  3S24 A;  5JJK A;  3UDG A;  3S1N H;  3S2D H;  4P75 A;  2Y0S E;  4DV7 Q;  4DR3 Q;  2B29 A;  3CD6 A;  1WWE A;  3FKI H;  1IBK L;  1X56 A;  4IPD A;  1Y1W G;  1EFW A;  3PUV A;  1A62 A;  4A3G G;  3UE1 A;  5IP7 G;  2LSS A;  1OXS C;  1VQM A;  1Z9F A;  2PI2 E;  1NMF A;  3HFZ B;  1J5E L;  4LFB L;  1JJG A;  5FJ8 G;  4DUY Q;  4TQU S;  1K8A C;  2Z0S A;  4JI8 L;  1QUQ A;  3K7U C;  1IXR A;  1VQG A;  2GVA A;  3BU2 A;  2ZJQ A;  4DR7 Q;  5IYC H;  2EQS A;  1KL9 A;  4HJ8 A;  3CCM A;  2VS1 A;  4PZ7 A;  4HIK A;  1Y1V H;  1MKH A;  2UXD L;  3H3V I;  1PA6 A;  4R4I A;  4BBR H;  4QL5 A;  4C3H H;  1L2F A;  4KI0 A;  4POG A;  5FLM H;  2ZJR A;  3JAM i;  1Q86 C;  2OTL A;  4DR6 L;  4B3R L;  1GO3 E;  3CMA A;  1YJW A;  4J15 A;  2KHI A;  4LFC Q;  4OWW B;  3GD7 A;  1N8R C;  1FJG L;  3IRB A;  4O0A A;  1VQ7 A;  3F2C A;  2HHH L;  1E1T A;  4K0K L;  1YHA A;  1YJ9 A;  4KHP L;  4GOP B;  3PGZ A;  2R92 H;  4DV1 Q;  1L1O C;  2AWN A;  4IFD G;  1K8G A;  3CCQ A;  4LW1 A;  3GTG H;  4DV4 L;  3F8T A;  4AQY L;  1RIP A;  1HNZ Q;  1VQC A;  5M5X H;  3CCL A;  2OWO A;  2VUM H;  1XMQ Q;  1PH9 A;  1VQB A;  1F6U A;  1UE1 A;  5AJ3 L;  1NBW A;  4A3I G;  5LMN Q;  4ME3 A;  3UDF A;  3CME A;  3F2D A;  1L1O A;  2VL6 A;  4GN3 B;  1PFS A;  4DV2 Q;  4BXX G;  4APV A;  4A3E H;  5IYD H;  2WB1 G;  4A3F G;  4BY1 G;  4JI3 L;  3CCR A;  4LF7 L;  3HOY G;  3S1Q H;  1TWG H;  1EUJ A;  1VQ9 A;  1WI5 A;  1A63 A;  1G6P A;  2ATW A;  4A3C G;  4PZ8 A;  1Y14 B;  3NEM A;  1FGU A;  5C4X H;  3I4M G;  1L1O B;  2VZA A;  3ULP A;  2E2J H;  3J80 c;  3CPF A;  5M3F G;  2UUA L;  2IT1 A;  2JEB I;  3KJO A;  2VQF L;  4IOA A;  3S16 H;  3M4O H;  1MIU A;  1B7Y B;  1UEB A;  1X55 A;  4JI2 L;  1NJI C;  5ELO A;  3RLF A;  5ELN A;  1N32 Q;  1I50 H;  4GLV B;  5LMU Q;  1I94 Q;  1HZB A;  1SE8 A;  2WFW A;  3K0X A;  4DR4 L;  2KEN A;  1IZ6 A;  4OON A;  1VQN A;  2JK8 A;  4DAM A;  3ICE A;  5LMN W;  4OXP A;  1KC8 C;  3RNU A;  1JMC A;  5IP9 G;  2D0O A;  2L15 A;  4B3S L;  4OX9 Q;  3PO2 G;  2NVQ H;  4AIM A;  4JYA L;  1X3F A;  3NBH B;  1Q12 A;  4LF8 L;  2EIF A;  2UUB Q;  3HOW H;  4AYB E;  2N8N A;  4OO1 I;  3KF6 A;  4NXN L;  1IYJ B;  3SGI A;  2ZTC A;  5GAG C;  4A3K H;  4QGU A;  2R93 H;  1I3Q H;  1ASZ A;  4GKJ Q;  3T1H L;  2RHS B;  2BA0 A;  2K5H A;  3VDY A;  5JEA J;  3STB C;  2PQA B;  1HR0 Q;  2E2H H;  3TS0 A;  3KF8 B;  3KLW A;  2K14 A;  2DGY A;  5C4J H;  1KXL A;  1C9O A;  3KF6 B;  3J81 i;  2UU9 L;  1BKB A;  2K75 A;  2UUC Q;  4A3J G;  3A0J A;  4QIW E;  1N34 L;  3PUZ A;  4DV6 L;  2I5H A;  3G71 A;  2MFI A;  1C7Y A;  4LF6 Q;  4A76 A;  3BZC A;  2K4K A;  4UP9 A;  1HNW Q;  1XTD A;  3I2Z A;  1TWH H;  1BBU A;  3DM3 A;  1VQJ A;  4YHH Q;  3T1Y Q;  4A93 G;  2K5V A;  4DNI A;  4DV5 Q;  5C44 G;  4GS3 A;  3OTO L;  4MTN A;  2QEX A;  1JT8 A;  1A8V A;  4IJH A;  4MZ9 A;  2Q2U A;  3PO3 H;  2YTX A;  4JBJ A;  2YTV A;  3RZD H;  2AWO A;  1GM5 A;  1HR0 W;  4P71 A;  4IOC A;  1VQH A;  5IYB H;  2QA4 A;  1HZ9 A;  2A1A A;  1TWF H;  4JI7 Q;  1CKN B;  4LNQ A;  3UE0 A;  1K9M C;  2UXC L;  4DR3 L;  4X66 Q;  4R4Q A;  2ES2 A;  3G4S A;  4ALP A;  3S17 H;  2HQL A;  2JA6 G;  3U4Z A;  1NTG A;  4JI6 L;  3S15 H;  4OWX B;  1E3P A;  1EQQ A;  2ZTD A;  1TWA H;  1Q46 A;  1V1Q A;  1KD1 C;  1HH2 P;  1OXV A;  1E22 A;  3RN2 A;  4B3T L;  4LF9 Q;  2F4V Q;  4C3J H;  1A0I A;  1Q8K A;  1WFQ A;  1BJ6 A;  3KDF B;  1HNX Q;  2KBN A;  1VCI A;  2R6G A;  1K73 C;  1AH9 A;  2HIX A;  3F1Z A;  1G51 A;  3TQY A;  3W1G A;  1EIY B;  3RLO A;  2NVX H;  2PI2 A;  2CKZ B;  4P73 A;  5FJ8 H;  4UP8 A;  4HIO A;  1PH5 A;  3S14 H;  2Z6K C;  2NN6 G;  3U58 A;  1W2B A;  4DKA C;  3HOV G;  3CQZ H;  4LFC L;  4RG1 A;  1YJN A;  2JA7 G;  2JA8 G;  2KCM A;  2NVT H;  3ULJ A;  1LUZ A;  4BY7 G;  2VY3 A;  2ZTE A;  3E9I A;  4MNO A;  4HJA A;  2R7Z G;  4LF5 Q;  1M1K C;  4GOP C;  4RMF A;  2JA9 A;  2Z6K A;  1VQL A;  2YU9 H;  4JI4 Q;  1H95 A;  1E24 A;  1PHJ A;  1OXU A;  1E7Z A;  4DR5 Q;  1XPR A;  1X3E A;  5C3E G;  3I4N H;  3KFU A;  1IBM Q;  3HOX H;  1KIX A;  1VQP A;  4DV0 L;  1N36 L;  3D31 A;  4R4T A;  2KHJ A;  3E9H A;  3PUW A;  4GOP A;  5H1S E;  2R7F A;  4H02 A;  3STB D;  2V1C C;  3GTK H;  3HOZ G;  3A5U A;  1KRT A;  1XMO Q;  2ZM6 L;  5BR8 L;  4YCV A;  3W5O A;  2ZJP A;  2QGQ A;  3FKI G;  1N9W A;  2BH2 A;  4JV5 Q;  1PV4 A;  4OWT B;  4JI5 Q;  4L5R C;  1N33 Q;  2CQO A;  2OCE A;  5IT9 c;  3D0F A;  3BJU A;  3HOU G;  4R4O A;  1WJJ A;  2MQH A;  4DV3 L;  2OQ0 A;  5M3M G;  1V9P A;  4KLK A;  2LXK A;  2E8G A;  3UDX A;  3CF5 A;  3OW2 A;  4A3I H;  1VS0 A;  1VQO A;  1PH7 A;  2PMZ E;  1XNR Q;  1PVO A;  2CFM A;  4BXX H; 
#chains in the Genus database with same CATH topology
 1CUK A;  2L4N A;  4UP7 A;  5EBC A;  4A3F H;  3HOY H;  1Y1V G;  3SE0 A;  1AFP A;  2JEA I;  3A8K E;  1T5E A;  2B39 A;  5FLM G;  4K14 A;  5M3F H;  4LF4 L;  1S4Z A;  3FRP B;  1WVL A;  1LTS D;  2UXD Q;  1SR3 A;  1VQA A;  1F9Q A;  2OF1 A;  1SMY D;  1QNU A;  4X65 Q;  5JPN C;  4UPA A;  3S1M B;  4AYB G;  1KRS A;  4OEM B;  2R7D A;  2NYZ D;  1NR2 A;  4K0K Q;  4CHT B;  3D4R A;  2I5L X;  2PZU A;  2PNH A;  3UDI A;  3FDT A;  4AQY Q;  1Q7Y C;  3NPP A;  2WB1 E;  1YEZ A;  1STB A;  3PF5 A;  2BCO A;  4HJ9 A;  2WII B;  1I4R A;  2WB1 B;  2AMC B;  2FMC A;  1ASY A;  1O78 A;  3L3O C;  2VNU D;  1STA A;  3A56 A;  4R4C A;  3U4V A;  4NXM L;  2GA4 B;  4MIU A;  4A93 H;  1LT5 D;  1PH2 A;  4DR2 L;  1CKO A;  3PQI A;  1FNU A;  1I6H H;  1XNQ L;  1Q1B A;  3L2P A;  4KHZ A;  2NZ1 D;  2HD3 A;  1SJE D;  4JI2 Q;  2FXQ A;  5D3D A;  1BCP B;  4DR4 Q;  4WJ3 M;  3K7A H;  3T4A C;  2DJF C;  3UI2 A;  3LWU A;  1IW7 C;  1F77 A;  5EAY A;  1PH6 A;  2H1E A;  4BBS H;  4CKC A;  2CQA A;  3KDF A;  4CDC C;  4DK6 C;  4G7Z C;  2Y0S G;  4N9P A;  2UU9 Q;  5FO9 B;  2L4L A;  4BA2 I;  5JOB A;  4A3J B;  4DR7 L;  3BG3 A;  1KDA A;  3TRZ A;  1B4O A;  3F2U A;  1QVC A;  4DV6 Q;  4A3G H;  2EJM A;  2SNS A;  1OXX K;  4HIM A;  5IYB G;  1AEX A;  2JA7 H;  1YHB A;  5DLQ E;  5E4W C;  2KUM A;  3OTO Q;  1HQM C;  3PSI A;  3DWP A;  3R2I A;  1PTO B;  3BYT B;  1FL0 A;  4PMW A;  2I07 B;  1G2S A;  4TVA B;  4IPG A;  3VR2 A;  2RHQ B;  5M5Y H;  2DJG C;  3GTL H;  5I2Y A;  2UXC Q;  2JA6 B;  5NUC A;  1VQE A;  1Q3Z A;  1PLF A;  2VW9 A;  4RKB A;  3HOU H;  4A75 A;  1RD9 D;  4IQZ A;  3CAM A;  2NN6 I;  3K5L A;  4B3T Q;  1S3O A;  3G7L A;  4H0L C;  4X64 Q;  2SEB D;  4U68 A;  4F87 A;  1F9S A;  1QVF A;  2XWJ B;  1LTA D;  2R61 A;  1QUQ B;  4BY1 H;  2NVY H;  2DY7 A;  3GTM B;  3I4N G;  3CP0 A;  1B70 B;  1X3G A;  3HOX G;  1H9J A;  5LMU L;  1J5E Q;  1D2B A;  4MN3 A;  3GTJ H;  2N78 A;  4HMJ A;  5IGC A;  2R7Z B;  2ICE C;  2AQ1 B;  2Z4H A;  1GXD C;  4L5T A;  1HHV A;  4P72 A;  4FO2 A;  4YCW A;  1RTO A;  1VQF A;  5FO8 B;  1N36 Q;  1KQS A;  1WTO A;  4R1J A;  1Z7T A;  1FVI A;  1SE2 A;  2IHF A;  1FJG Q;  4KY5 A;  1GHK A;  2MGS A;  1JCK B;  1O80 A;  1EWI A;  3M4P A;  5JAV A;  1UE7 A;  2Q2I A;  5M3M B;  1QZH A;  2EXZ A;  3J7A 5;  2KJX A;  1AZQ A;  3H09 A;  2Q2T A;  1B9N A;  3N6R A;  1UUP A;  3L9A X;  3HRZ C;  1SDF A;  1JWS D;  1BNZ A;  2F0J A;  1BCP C;  1QG7 A;  4X3S A;  1ICF B;  3I4M B;  1B3Q A;  2UXB L;  4JI7 L;  1PXU A;  1U9R A;  1S5B D;  4C3I B;  3H0G B;  3K81 C;  1MFS A;  2IHE A;  1KDC A;  2IY5 B;  2K32 A;  4A3B G;  4A3D H;  4XTC S;  4ZUI A;  4LF9 L;  3OMG A;  4NW2 A;  4B3S Q;  2VQE Q;  3S1Q B;  5KNB A;  1L0X B;  4C1N K;  4GKK L;  1A3V A;  5IWA Q;  5C0X H;  3EFX D;  5C5L A;  4B9X A;  1CK1 A;  5KYI A;  1E0B A;  2EXD A;  5J3B A;  1DXM A;  1Q3L A;  4HID A;  4GN5 A;  2M9V A;  1VQD A;  1J6Q A;  3PO3 G;  3PIO A;  1JQY D;  1HZA A;  4FNF A;  1KTK A;  3HOV H;  1RKN A;  1NR4 A;  1OXT A;  2LKV A;  5C44 B;  3HOW B;  4FF1 A;  1X54 A;  1EIF A;  1Z6H A;  4JI5 L;  2PPB C;  2KA7 A;  4FP5 D;  2A74 C;  5C4J B;  2RCN A;  3BVG A;  3UDG A;  5CR3 A;  4DV7 Q;  3CD6 A;  3I4L A;  4WJW A;  1IBK L;  1X56 A;  1Y1W G;  2L11 A;  1G2T A;  1A62 A;  1EZ8 A;  1SNO A;  1QCB D;  1VQM A;  2PI2 E;  1NMF A;  3HFZ B;  3KUP A;  1JJG A;  4DUY Q;  3LX0 A;  4KKS A;  2B63 B;  3TBI B;  4HJ8 A;  1KL9 A;  4OEL B;  4HIK A;  1Y1V H;  3V05 A;  1K8O A;  2XWB B;  3H3V I;  1VDZ A;  2IX3 A;  2K05 A;  4KI0 A;  5CV6 A;  5FLM H;  4DR6 L;  1WCM B;  3CMA A;  2JSO A;  2F03 A;  2KHI A;  3F2C A;  2HHH L;  1E1T A;  1YJ9 A;  1ET9 A;  4DNT B;  1WTP A;  3GP7 A;  4DAY A;  1B2T A;  3PGZ A;  1L1O C;  2FFK B;  4LW1 A;  1YNJ D;  5M5X H;  5KGU A;  1MHW C;  2Z6B A;  1UE1 A;  1NBW A;  3S1N B;  5LMN Q;  3S2D B;  3CME A;  4OO1 H;  3VA5 A;  4GN3 B;  4DV2 Q;  2VXW A;  3SK4 A;  4APV A;  3MXN A;  4A3F G;  3CCR A;  3HOY G;  4LF7 L;  3NTK A;  3TP6 A;  1G6P A;  1Y14 B;  2QCP X;  4ID6 A;  2VZA A;  2E2J H;  2B2Y A;  5M3F G;  4RGT A;  2B2U A;  2IT1 A;  5IGB A;  4TSS A;  2JEB I;  3KJO A;  1S5F D;  3R8B A;  4IOA A;  2PQE A;  4ME5 A;  1KNE A;  3NWT A;  1NJI C;  3RLF A;  4C3H B;  5ELN A;  1N32 Q;  1SE8 A;  3K0X A;  2F0V A;  1TS3 A;  3ICE A;  3I73 A;  2QDL A;  5LMN W;  4F8M A;  2MUY A;  4JYA L;  2DNC A;  1G91 A;  3AB9 A;  5C4Z A;  1KLG D;  1BXT A;  3KF6 A;  4NXN L;  2R92 B;  3GTG B;  2K5H A;  4ABN A;  3K0Y A;  2E2H H;  5D14 A;  3KF8 B;  2DGY A;  3C1F A;  4JPB W;  1KXL A;  5K36 H;  4DN4 M;  1BKB A;  2K75 A;  2FIN B;  4E6I A;  3G71 A;  1ONL A;  3T13 A;  3K6O A;  2AUJ D;  4UP9 A;  1A2U A;  2KOL A;  4YHH Q;  4HCS A;  4A93 G;  2A69 D;  5TSS A;  4N9T A;  2QEX A;  1XYI A;  1JT8 A;  3HS0 C;  5J39 A;  4IJH A;  4IUP A;  1LLR D;  4KK7 A;  2YTV A;  2AWO A;  3T16 A;  4P71 A;  1H9S A;  1VQH A;  4IN3 A;  5IYB H;  3QOJ A;  1HZ9 A;  2EY1 A;  3IAY A;  4LNQ A;  4XYQ A;  3A7L A;  3G4S A;  4L63 B;  3U4Z A;  1SMY C;  4KN4 C;  4JI6 L;  3S15 H;  5JEA H;  5J1Z A;  5I6Y A;  2O4X A;  1V1Q A;  1XWE A;  2Z4I A;  1E22 A;  3RN2 A;  4FVM A;  1Q8K A;  1BJ6 A;  3NBI A;  2F0D A;  3F1Z A;  5D65 A;  3W1G A;  3RLO A;  2NVX H;  2XSC A;  4DKA C;  4LFC L;  1EY4 A;  1H9M A;  1X3P A;  2JA7 G;  2JA8 G;  2NVT H;  3BYY B;  4ZCK A;  3ERO A;  2VY3 A;  3E9I A;  4BY7 G;  4QCL A;  4LF5 Q;  1H95 A;  1VQL A;  2Z6K A;  4IUR A;  5CBE E;  3SK6 A;  1RTN A;  3I72 A;  3I4N H;  1E7Z A;  2BDN A;  1X3E A;  1IBM Q;  1MI2 A;  3HOX H;  3ERQ A;  2Z8L A;  3BZD B;  4R4T A;  4GOP A;  2FMM A;  3A5U A;  1KRT A;  4BBS B;  2BH2 A;  3FKI G;  3MXU A;  1PV4 A;  4OWT B;  1E2W A;  4CKB A;  2A73 B;  3BJU A;  3HOU G;  1TWA B;  2MQH A;  4KLK A;  3NHH A;  5C5M A;  2LXK A;  1HTP A;  3UDX A;  3P1H A;  4A3I H;  1XNR Q;  1VQO A;  2K01 A;  1JOR A;  1Q12 A;  1HA6 A;  4BXX H;  3TRE A;  3MVV A;  4G7O C;  4YY3 L;  1EEI D;  4PNY A;  4A3G B;  4IZ8 A;  1YHQ A;  4DUZ L;  3RLN A;  2BOS A;  2ZXO A;  4JI8 Q;  4JOI C;  2AQ2 B;  3CKI B;  1D1I A;  1K83 H;  3PUX A;  4B9W A;  1KAW A;  2WAQ G;  2YU9 B;  3M7N A;  3FHW A;  1EYG A;  4X62 L;  3QG1 A;  2OT2 A;  4HJ7 A;  1JJC B;  3AQQ A;  1CA5 A;  3JAM c;  1SYC A;  1TVX A;  4L5Q A;  3GTK B;  2FHT A;  5EKI A;  2F0M A;  5EPJ A;  4NMZ A;  2IWH A;  2NZO A;  1C48 A;  2N55 A;  5C6A A;  1V1P B;  2PZW A;  4DV4 Q;  3KBG A;  2N88 A;  5HY6 A;  4A3B H;  4U67 3;  1G6Z A;  3C46 A;  3T1Y L;  5I9P A;  3RUZ A;  1YNN D;  5AJ3 Q;  3T56 B;  3ERS X;  3HKZ G;  1ESK A;  3CRK C;  2YTY A;  3ULL A;  2F3I A;  1LAB A;  3Q6S A;  4J1M A;  2F0L A;  4BWG B;  1CSQ A;  2YSA A;  3WWV A;  2GN5 A;  2O5J C;  4YCU A;  1R4P B;  4XDX A;  4JC0 A;  2Q2H A;  5IGF A;  1CKN A;  3V2T A;  5CGK A;  2HQE A;  3KK7 A;  1D8L A;  1XPO A;  5ELC A;  3FP9 A;  1GUS A;  3PO2 B;  4A3D G;  3CCS A;  2AUK A;  2CWA A;  4LF8 Q;  3TEH B;  5JVH 3;  1O7I A;  1B1Z A;  2TSS A;  3T1H Q;  2K50 A;  4LUO A;  2CWP A;  3GTO H;  5EBD A;  2JYO A;  3CCU A;  5C0X G;  3E0E A;  4X3T A;  4B3M Q;  3ER0 A;  1KAB A;  2KVM A;  2MJ8 A;  4JG2 A;  1Y1W H;  2EYF A;  3QOL A;  1N34 Q;  3H15 A;  1F2M A;  3T51 B;  2EZV A;  2EE1 A;  4G57 A;  1M90 C;  3NQI A;  3OSO A;  2XGT A;  4QQB X;  3DEO A;  1DGS A;  1BBW A;  3V96 A;  4LFA Q;  5IE8 A;  4K2K A;  2EYJ A;  4G4K A;  4IPH A;  1NY4 A;  2EYM A;  3GDE A;  1EOT A;  2JXM B;  1HNZ L;  5EQ0 A;  5GRO A;  2RCF A;  1CHP D;  4C3J G;  1XMQ L;  5IT9 E;  1I4H A;  2N3S A;  3I70 A;  1PFM A;  3A7A B;  2BE5 C;  3WDN A;  4KV6 A;  1WTV A;  3TS2 A;  1VMP A;  1SYD A;  5ISR A;  1FR3 A;  4KKU A;  2D0P A;  1STN A;  2F0O A;  4N8X 1;  4FF4 A;  2MO1 A;  3I91 A;  1UEA B;  1YVC A;  2K6A A;  3EJI A;  4POF A;  3VR4 A;  3BVZ A;  4X65 L;  1W3S A;  3S1R B;  1FD7 D;  3M4Q A;  1I94 L;  5FO7 B;  1LAC A;  3TSS A;  2EXF A;  1WTQ A;  1EU3 A;  2EOT A;  2Q8I B;  4X6A H;  3RZO B;  1SNM A;  5DM7 3;  1QWY A;  4GKJ L;  1VQ5 A;  4DV0 Q;  2F0I A;  2A68 C;  3E3X A;  3PIP 3;  2OQK A;  1HFN A;  1HR0 L;  1DYQ A;  2ZM6 Q;  5BR8 Q;  2F3W A;  2HDL A;  4M8A A;  1PH8 A;  4OO1 G;  4RGN A;  2UUC L;  3S2H H;  2IX0 A;  1KHI A;  3NUC A;  2EPB A;  5GAH C;  2D62 A;  1X3Q A;  4R9W A;  1PRT F;  1RJT A;  1HNW L;  1HZC A;  1NUC A;  5C0X J;  1Y1V B;  2F0S A;  1XXG A;  3MC0 B;  3HKS A;  3J7Z C;  5JJI A;  4QF4 A;  1ESR A;  2MO0 A;  2AHO B;  3URY A;  2XIW A;  2NTT A;  3OW7 A;  3GTQ B;  2NTS A;  3EA6 A;  4WRD A;  4YWL A;  4LF4 Q;  2JA5 G;  4RGM A;  4A3M G;  2A8V A;  2UUA Q;  4HTH A;  2AKW B;  1YNX A;  2XRS D;  4KY6 A;  5IGE A;  3AFQ A;  1II3 A;  2EYO A;  1U4L A;  5M5X B;  3NTI A;  1TS5 A;  4DU9 A;  1WTW A;  1YZ6 A;  5IOD A;  1LYL A;  2X6G A;  2CQF A;  1AN8 A;  4V19 0;  2F4V L;  3DXJ C;  4RH6 A;  4Y7N H;  5K36 G;  4GNX A;  4K5V A;  4R8I A;  3OIQ A;  3I90 A;  5C3X A;  1JC7 A;  1YNJ C;  1OTC A;  5FKA C;  1U6P A;  1RF2 D;  4OGQ C;  4NDX A;  2JQO A;  3DWA A;  5COR A;  3MTS A;  1ZYR D;  4JI4 L;  4BA1 I;  1AZP A;  5BN4 A;  4NXM Q;  4HED A;  4K6D A;  1SYG A;  3KOJ A;  4PG3 A;  4FYD A;  3AFP A;  3E0J A;  4DR2 Q;  2JA8 H;  3J81 j;  1XNQ Q;  4JBM A;  2QW7 A;  1TXY A;  2GVB A;  4BY7 H;  1VQK A;  2IX1 A;  1N33 L;  5JEA G;  1SNP A;  3MAQ A;  1C8C A;  2E75 C;  2E2H B;  1GD7 A;  4X64 L;  3L0O A;  3K59 A;  5C0X I;  3RR5 A;  1U5K A;  1VQ8 A;  3S24 A;  3GTP B;  5JJK A;  2Y0S E;  1TWC B;  4KJN A;  4DR3 Q;  1DOM A;  3FKI H;  4IPD A;  1TU2 B;  3PUV A;  4CDF C;  1KAA A;  3UE1 A;  2Y0S B;  1Z9F A;  1J5E L;  4LFB L;  4ZKC B;  4DF7 A;  3VYR A;  1K8A C;  5CMD A;  4PQX A;  5CBA E;  3K7U C;  3IL8 A;  1IXR A;  1VQG A;  3I8Z A;  1DD2 A;  3BU2 A;  4DR7 Q;  4O42 A;  3CCM A;  5K5P A;  2VS1 A;  2QEJ C;  4PZ7 A;  4DAP A;  1MKH A;  1PA6 A;  5CYU A;  4R4I A;  1D5Z C;  4QL5 A;  2KEC A;  1L2F A;  4POG A;  1Q86 C;  3JAM i;  2OTL A;  4B3R L;  4Q5V A;  2E2I B;  1FJG L;  2A69 C;  4OWW B;  1N8R C;  4IUV A;  1TT2 A;  4KHP L;  4XXE A;  2AWN A;  4IFD G;  1K8G A;  1RIP A;  1EWC A;  5JJZ A;  5T1I A;  2VUM H;  3HOZ B;  3MWY W;  2B2V A;  4A3I G;  3F2D A;  2OXP A;  3HEJ A;  4BXX G;  1EL0 A;  1PFS A;  1K0S A;  1EIG A;  3QB3 A;  5FLX E;  5IYD H;  3VYU A;  1TWG H;  1WI5 A;  3VYS A;  2ATW A;  4A3C G;  1XTC D;  3NEM A;  4PMC A;  3I4M G;  4QB4 A;  1L1O B;  2F4I A;  4RAU C;  3J80 c;  1TII D;  2G5D A;  2KQ3 A;  2L12 A;  2VQF L;  3I4N B;  3M4O H;  4BBR B;  2EY2 A;  2PW5 A;  2F3V A;  3HOX B;  5LMU Q;  2WFW A;  1S5E D;  2KEN A;  1SYB A;  4DAM A;  5IIF A;  4RCO A;  4B3S L;  4KTA A;  4AIM A;  1EQT A;  1ENC A;  2UUB Q;  2I46 A;  4OO1 I;  4EQN A;  4QGU A;  1I3Q H;  1ASZ A;  1T5X D;  2BE5 D;  2RHS B;  3D6W A;  1HFG A;  5JEA J;  2D5D A;  2K14 A;  1C9O A;  4RCN A;  2MHV A;  3ITP A;  4ZUJ A;  3NP8 A;  1CT1 D;  2G9H D;  2MFI A;  4XQN A;  3NE5 B;  3K58 A;  2K4K A;  5C4X B;  3A54 A;  1XTD A;  5I2X A;  1BBX C;  2B2T A;  3DM3 A;  4DV5 Q;  5C44 G;  1EY0 A;  2Q2U A;  4QMG A;  2YTX A;  5LHY 1;  1MSH A;  1I50 B;  4IOC A;  3G6J B;  1GUO A;  4JI7 Q;  2A68 D;  1K9M C;  4DK1 A;  3D4W A;  1HUM A;  4KJO A;  2NVQ B;  3S17 H;  3DEP A;  1HRJ A;  1NTG A;  4RHR A;  4A3K B;  4ZLT F;  4OWX B;  2R93 B;  1PRT D;  1EQQ A;  4A3B B;  1JOO A;  1GJX A;  2D9U A;  1ML0 D;  4LF9 Q;  4LK1 C;  4CJ0 B;  4C3J H;  3TZD A;  1WFQ A;  3KDF B;  1VCI A;  1NSN S;  2HIX A;  1G51 A;  1GUG A;  4P73 A;  1PTO F;  1PH5 A;  1F2L A;  2Z9H A;  3U58 A;  3NQT A;  1YNN C;  3BS1 A;  2KCM A;  2K7V A;  1LUZ A;  5KIX A;  3H3V C;  2NUC A;  4MNO A;  4RMF A;  2JA9 A;  2F0G A;  4DXF A;  3PO3 B;  1SAP A;  1JWM D;  1PHJ A;  3E5S A;  1OXU A;  3KFU A;  5C3E G;  2C5C A;  3RZD B;  4RGO S;  1VQP A;  3DWQ A;  3PUW A;  4IAL A;  1TWF B;  3D8G A;  3STB D;  1M4V A;  3W5O A;  3Q22 A;  4WOR A;  3DM1 A;  3DHQ A;  4JI5 Q;  2CQO A;  2IL8 A;  4R4O A;  4ZKB B;  4DV3 L;  3KLR A;  4X3U A;  4R8N A;  1WTR A;  3VYT A;  1PVO A;  1STG A;  1ESF A;  4HN7 A;  1C4Q A;  1ICW A;  3B6Y A;  1Y1W B;  1HUN A;  4OL7 A;  1IBK Q;  1E1O A;  2HT1 A;  1XJV A;  1EQR A;  3I4O A;  1K0R A;  1JE5 A;  1N32 L;  3K80 C;  4DAV A;  4KD3 A;  1IBL L;  3CQZ B;  2IPK D;  3K5N A;  1BVS A;  1IYU A;  1TS2 A;  3JAM E;  3PUY A;  1JJ2 A;  5KEE A;  2E5L L;  5ELD A;  5IT9 L;  3HG9 A;  1IKM A;  1SN8 A;  5COY A;  4FXK C;  3Q24 A;  3NBH A;  2LMC B;  3RN5 A;  4JI0 L;  1L0Y B;  3CCE A;  2JA5 H;  3CC4 A;  2K5W A;  4A3M H;  2HHH Q;  1WD0 A;  1DJR D;  5E4X A;  4I65 A;  3ZJY C;  1STH A;  2KCC A;  1BQQ T;  4DR1 L;  4A3E G;  2PQA A;  4LWC A;  1IHZ A;  1CQF A;  1JB7 A;  5CV9 A;  2LS0 1;  3CPW A;  3OIP A;  3J7A V;  1Q90 A;  5E7N A;  3LNN A;  1ET6 A;  2WP8 J;  1ILP A;  1PH3 A;  4IO9 A;  1F2Y A;  3K8A A;  3OWF A;  3I3C A;  2PW7 A;  4A3F B;  2LY7 A;  3HOY B;  3SDZ A;  4FF2 A;  2QDB A;  4LF7 Q;  4HSP A;  2V4D A;  5IGD A;  1LT4 D;  1OO9 B;  1G29 1;  1V1O A;  2CH4 W;  4H7B A;  1MJE A;  3EN2 A;  5M3F B;  4YWK A;  1L0W A;  4ZQ3 A;  2B3G A;  1EOV A;  3BDC A;  1VF5 C;  3KJP A;  2BDO A;  1R9T H;  1PTO H;  4YWM A;  3ND9 A;  3S9W A;  1X9N A;  1VQ4 A;  3M85 A;  4JI1 Q;  4JYA Q;  1QOH A;  3L7Z C;  1WWF A;  2RSO A;  2A19 A;  2EVB A;  1D7Q A;  2CCZ A;  4K8I A;  4C56 C;  2CH4 A;  1GUN A;  2EJF C;  3I7F A;  1VQ6 A;  2RKS A;  2RA4 A;  1GUW A;  1J8I A;  3J81 c;  1UE5 A;  3OPO A;  1S5D D;  3M3Y H;  2K04 A;  3LGJ A;  2NWG A;  3GTM H;  1IBM L;  1VMC A;  4NB3 A;  1W6J A;  2A6H D;  2NZH A;  4A93 B;  1JIC A;  1I6V C;  3WOF A;  2SNM A;  1I6H B;  3RD4 A;  1SJH D;  1Y69 U;  4JCV E;  3U50 C;  3NWS A;  3C2P A;  1GKH A;  4F7X A;  3PIP A;  1LO5 D;  5EPK A;  4DV1 L;  3CHB D;  3K7A B;  1X65 A;  3W1B A;  1XPU A;  3A8J E;  3AEV A;  1ZEQ X;  4JI6 Q;  4GN4 B;  1FNV A;  5M3M H;  4ILW A;  4IFD H;  4H13 C;  2I0Q A;  5FOB B;  1BDO A;  1GUT A;  2IJ0 A;  2KEE A;  1CTM A;  3EBE A;  4TKO B;  3J80 i;  4AH6 A;  2KCT A;  2ICI A;  1EIH A;  2PNR C;  2NB0 A;  3CW2 C;  2RF4 A;  1F9P A;  1KLU D;  4A3C H;  2WAC A;  3P20 A;  3G48 A;  3I4M H;  1V43 A;  4HJ5 A;  2JA8 B;  2JA7 B;  1HA5 A;  4QY7 A;  2CVR A;  2L5T A;  4CBV A;  1Q1E A;  1EYC A;  1MJC A;  1VF7 A;  3CU7 A;  5I9O A;  4OX9 L;  1ZYR C;  4PV1 C;  1NCV A;  4C3I H;  3H0G H;  3MA2 B;  4GLX A;  4WFN 3;  1YI2 A;  1Q82 C;  1PZI D;  5M5Y B;  4KN7 C;  4JW0 A;  2BA1 A;  4DAY B;  4C2M H;  3GTL B;  4KMU C;  2VUM G;  3A5Z B;  2ZXR A;  3FKI B;  1UWV A;  5M5W H;  1AAF A;  1PTO D;  3PV0 A;  4IPC A;  1KNA A;  3HOU B;  1SMX A;  1MD2 D;  5IYD G;  4DA2 A;  5GAD C;  1NE3 A;  1R4Q B;  2JE6 I;  3SVM A;  2L0C A;  4LF6 L;  3MXN B;  4IUU A;  4L5S A;  1TY0 A;  1YIT A;  2VB3 X;  2IHX A;  4IJL A;  1SNC A;  4YY3 Q;  1YIJ A;  4BY1 B;  2NVY B;  4DUZ Q;  4UY8 C;  2LI8 A;  4JI3 Q;  1PRT B;  2K5N A;  3A8I E;  2WAQ E;  1WWD A;  1A3T A;  4RWS C;  4DGZ A;  2K28 A;  3SHL A;  3GTJ B;  4A3L G;  3FPU B;  1QIL A;  1RL2 A;  2ID0 A;  1X6O A;  1Z47 A;  2WAQ B;  3EIV A;  4EX5 A;  1SFO H;  5C44 H;  1CZW A;  4X66 L;  1PYS B;  1TQO A;  2H5X A;  5I6W A;  4O2D A;  4X62 Q;  3Q8D A;  3DUZ A;  1RHP A;  4IUT A;  5FLX L;  1WTX A;  3CCV A;  4PMB A;  1SBB B;  4ZYS A;  5C4H A;  4B3M L;  2B2T C;  1HNX L;  2WKD A;  1B3A A;  1PYB A;  2NBF A;  3HKZ E;  3JC6 6;  2P5Z X;  1WD1 A;  1MSG A;  3HKZ B;  3NYB B;  4LFA L;  4LJZ C;  2B63 H;  2OTJ A;  3M4O B;  4K2L A;  2E2D C;  1SE3 A;  1BR9 A;  4DR5 L;  1O7L A;  5BN3 A;  3TP5 A;  1WCM H;  1LT3 D;  1LTL A;  2JJQ A;  4I7A A;  2DUD A;  1XMO L;  4L6T B;  4ZAI A;  1H9S B;  2C35 B;  3MEF A;  2Q8T A;  2MNA A;  3CC2 A;  4JV5 L;  4JBW A;  5C3E H;  1I4P A;  1JWU D;  4FDB A;  2F0W A;  3F2B A;  1WYD A;  4A3D B;  2RVL A;  3BDL A;  2HCC A;  3VA7 A;  2F0H A;  4KD4 A;  1CHQ D;  5EGT A;  3S1N H;  2A5H A;  3S2D H;  2B29 A;  5DNF A;  4IUN A;  3VR3 A;  3WOE A;  4I7Z C;  5IP7 G;  2LSS A;  1OXS C;  3O13 A;  2Z0S A;  1EEF D;  1QUQ A;  3U9O A;  4CJ2 C;  5A2Q E;  2GVA A;  5IYC H;  2KHS A;  1QJO A;  2H4O A;  2UXD L;  4J6H A;  3MZ5 A;  4C3H H;  2ZJR A;  3HOV B;  1GO3 E;  3A55 A;  4J15 A;  4UDU C;  4HR7 B;  2F0N A;  4O0A A;  1VQ7 A;  2PO4 A;  4K0K L;  1AW7 A;  2B8G A;  4GOP B;  1D5M C;  1KDB A;  2R92 H;  3M7G A;  1K28 A;  3GTG H;  4AQY L;  3F8T A;  1O7Y A;  1HNZ Q;  1EY8 A;  1EYA A;  3NTH A;  1SND A;  5D3I B;  5EKK A;  5EJW A;  3PMF A;  4C3J B;  1XMQ Q;  2OWO A;  1I4G A;  2J0T D;  1F6U A;  4ME3 A;  3UDF A;  5JVG 3;  1L1O A;  2VL6 A;  1BOS A;  2TMP A;  4YIJ A;  2B2Y C;  2KED A;  3J80 E;  4A3E H;  2WB1 G;  1PRT C;  2B2U C;  1EWH A;  3MXG A;  1VQ9 A;  2K5Q A;  5IOC A;  1HQR D;  5CV4 A;  4PZ8 A;  1ROD A;  4KY7 A;  2C9O A;  2Q8R E;  3GQB A;  2DN8 A;  3CPF A;  3J7A F;  2UUA L;  3IKJ A;  4P2C B;  3S16 H;  3TDQ A;  5E3F A;  1EYD A;  1UEB A;  1X55 A;  1DOK A;  5EPL A;  4JI2 L;  3R2T A;  2ENB A;  1S5C D;  1QNK A;  4EQP A;  1I94 Q;  2X69 A;  3J7Y W;  4DR4 L;  1IZ6 A;  1VQN A;  4OON A;  1JMC A;  1SEB D;  5IP9 G;  2D0O A;  4HAE A;  3P7J A;  4AYB E;  1DON A;  2HDM A;  3ND8 A;  2ZTC A;  4HCE A;  4F88 A;  4GKJ Q;  2EYH A;  3MFG A;  5L37 A;  4X3K A;  4AYB B;  2XN9 C;  4S3S A;  3VDY A;  2F0T A;  3STB C;  1HR0 Q;  1HTL D;  3J81 i;  1EFI D;  2UU9 L;  2RSN A;  2UUC Q;  4A3J G;  1EU4 A;  3A0J A;  5F2D A;  3JAM L;  3PUZ A;  4DV6 L;  2PCF B;  1LTI D;  1HNW Q;  3I2Z A;  2E2J B;  1TWH H;  2K5V A;  4DNI A;  1STE A;  3TP7 A;  3OTO L;  4MTN A;  1PDQ A;  1A8V A;  3SR1 A;  1A3U A;  4CGY B;  3KLS A;  3GV6 A;  2OEO A;  5ELF A;  1GM5 A;  1HR0 W;  4KHV A;  2JA5 B;  4A3M B;  1LTG D;  5BN5 A;  1RCV D;  2HUG A;  2A1A A;  3FVQ A;  1AP0 A;  1CKN B;  1XX8 A;  2CW0 D;  2UXC L;  4DR3 L;  3K5O A;  5DAU A;  2ES2 A;  4ALP A;  1ZKO A;  1JE4 A;  1U4P A;  2JA6 G;  3P75 A;  4RKL A;  4QUC A;  2RBM A;  1E3P A;  1TWA H;  1PFN A;  1Q46 A;  2RDG A;  4NP5 A;  3K57 A;  4B3T L;  3MFY A;  2F4V Q;  2R3Z A;  2EYP A;  2XRQ D;  5T1G A;  2R6G A;  3QWN A;  1K73 C;  4CDE C;  1AH9 A;  3TQY A;  3BVM A;  1RDP D;  4LAA A;  4UHV A;  2PI2 A;  1LV9 A;  5FJ8 H;  1EY5 A;  2KCN A;  3S14 H;  2EY6 A;  2Z6K C;  3X3M A;  1W2B A;  4B08 A;  4RG1 A;  1YJN A;  2F0U A;  3ULJ A;  3NK9 A;  4HJA A;  2R7Z G;  1R9T B;  4GOP C;  2YU9 H;  4JI4 Q;  2HCI A;  2E76 C;  2PZT A;  5DEH A;  1N36 L;  3HOZ G;  4H02 A;  3GTK H;  2RQX A;  2V1C C;  3FPP A;  4YCV A;  4JVZ A;  2ZJP A;  2QGQ A;  1N9W A;  1D5X C;  3S15 B;  4L5R C;  1N33 Q;  5IT9 c;  5AFW A;  1Q8I A;  1UAP A;  5M3M G;  1SNQ A;  3CF5 A;  1PH7 A;  2B2W A;  1VS0 A;  5G3L F;  2PMZ E;  1K8M A;  1G8Z D;  4XQQ A;  5JPM C;  3M3Y B;  4JBK A;  3OWE B;  2PMZ B;  1Q3Y A;  4BBR G;  2NVX B;  3KYH C;  1U4R A;  4LFB Q;  1IL2 A;  2BH8 A;  4A4I A;  2A6E D;  4P74 A;  2B8F A;  4C1N I;  2NVT B;  4TRD A;  1EY9 A;  1QE6 A;  2CHB D;  2UUB L;  1LTB D;  4JOI A;  3H0G G;  4XT3 B;  4C3I G;  2A6H C;  2M3Z A;  1PFB A;  3DLL A;  5ELB A;  2O2L D;  4B3R Q;  4A3L H;  1IYV A;  1SE4 A;  3PO2 H;  1CSP A;  3IFT A;  1BUV T;  3SK8 A;  4KHP Q;  2ZXP A;  2VQE L;  1SRU A;  2D2C C;  2XNA C;  3KF8 A;  1B9M A;  2J7Z A;  5KNC A;  1K3B C;  1Y8O B;  4CJ1 B;  1A15 A;  5HGT A;  4FXG C;  5IWA L;  1GVP A;  5C4X G;  4GLA C;  4A3I B;  4XT1 B;  4XQJ A;  1Q81 C;  4DV5 L;  1CFM A;  1GHJ A;  1WOC A;  1ENA A;  4Z9C B;  1H9K A;  2L1B A;  3H91 A;  3NEL A;  1PH4 A;  3SXH A;  2QKI C;  5EKL A;  5LL6 X;  4RFB A;  1AE2 A;  1BCP F;  1K3R A;  3D6C A;  1CI3 M;  1K83 B;  1I4Q A;  1NNX A;  2SDF A;  2ALY B;  2VQF Q;  1QZG A;  2EY5 A;  3TP8 A;  3QO2 A;  3GV3 A;  5CC4 A;  3HOW G;  4A3K G;  3OYY A;  4ODG A;  2R93 G;  3FEW X;  2DNE A;  2F0Q A;  5HGQ A;  1SLJ A;  4K8J A;  3Q0A A;  2K33 A;  2M00 A;  4H44 C;  2F1M A;  4XIG S;  3VR5 A;  4C2M B;  5M5W B;  4IUQ A;  2UXB Q;  3M4Y A;  3PCO B;  5CV8 A;  4DV7 L;  5E1F A;  4CDD C;  4EQO A;  3J81 E;  1D6E C;  2EDG A;  2WIN B;  5GQO A;  1B53 A;  3CXC A;  2XVS A;  5M9O A;  3GO5 A;  1PZJ D;  1I4X A;  2F52 A;  4DUY L;  4GNX B;  4IFD J;  3HGB A;  1PTO C;  2B63 G;  1CA6 A;  2SOB A;  1X32 A;  2RDH A;  1CKM A;  5I4D A;  5IP7 H;  2NN6 H;  4GKK Q;  3C1E A;  4ZRZ A;  1FGB D;  3S1R H;  5FK9 C;  4BS9 A;  4OHJ A;  1F2Z A;  3D4D A;  1B8A A;  1W6K A;  1SFO B;  4QJF A;  3AMU A;  1WCM G;  4NPS A;  4ZK9 B;  3OMC A;  4K5X A;  3RZO H;  1A6B B;  3TN2 A;  3I55 A;  3ZYY X;  3S1M H;  1DM0 B;  3IFD A;  2JZW A;  4WJ4 A;  5LL6 S;  5LMN L;  3AYH B;  4J8Q A;  1ENF A;  4DV2 L;  4O1N A;  1FYC A;  1U0L A;  3LWE A;  2K03 A;  3R3O A;  3GTO B;  3EQL C;  1HJP A;  3T53 B;  5DM6 3;  3A74 A;  1WTH A;  3I56 A;  4Q0F A;  5J22 A;  1WWG A;  5IYC G;  4LUV A;  3ONA B;  1EY7 A;  2F0K A;  5KYL A;  4G7H C;  1JOQ A;  4C3H G;  1CQV A;  3GTQ H;  1V8Q A;  1J9O A;  3MEH A;  1S72 A;  1CM9 A;  1VQI A;  3HZX A;  2JN4 A;  3R93 A;  1I5F A;  1IW7 D;  2AQ3 B;  5KRU A;  5C3E B;  1MGS A;  1P8L A;  4N8F A;  3X3N A;  2MP1 A;  3CCL A;  4EGV A;  1JR0 D;  1LTR D;  2R92 G;  4IFD I;  5CV7 A;  4DR6 Q;  1NMG A;  1V1P A;  5IP9 H;  3H6M A;  2EC7 A;  1P16 A;  1GOZ A;  1LM0 A;  5A2Q L;  4DK3 C;  4DV3 Q;  3NXW A;  5FLX c;  4YHH L;  1S40 A;  2L9H A;  4EQ5 A;  2F0E A;  2YV5 A;  3FMC A;  4A3J H;  1C0A A;  2ZT9 C;  2XTI A;  3C3L A;  1E2Z A;  1IBL Q;  4QUF A;  3NEN A;  3QJY A;  4GZY C;  4JI1 L;  2WKC A;  1ZXT A;  1PZK D;  2YYZ A;  4LUZ A;  1TS4 A;  2FJ2 A;  2E5L Q;  4KKT A;  2MPM A;  2K52 A;  5C3W A;  4PZ6 A;  3J80 L;  5G3L D;  3M9B A;  4JI0 Q;  1ILQ A;  4GNX C;  4LMQ D;  3TZU A;  3NSW A;  1AE3 A;  2HIV A;  3GTP H;  4Y52 H;  1TWC H;  3W2D A;  1EZ6 A;  4A3E B;  4DR1 Q;  1U4M A;  2JA6 H;  3S2H B;  1STY A;  4NXN Q;  3BZK A;  3U9S A;  4DPG A;  2O5I C;  2ASB A;  1QVG A;  2M2L A;  3QIA A;  2QF7 A;  2I5M X;  2N49 A;  3S16 B;  1QB5 D;  4L8J A;  4LF5 L;  2LXJ A;  3CCJ A;  1Y8P B;  4MHE A;  1UE6 A;  3G6E A;  4JK1 C;  2X6L A;  1PH1 A;  1H9R A;  2F0P A;  1HCZ A;  1HXY D;  2E2I H;  3KBX A;  1PMR A;  5JJL A;  4RA8 A;  4FXD A;  2R7Z H;  3H3V H;  3D3R A;  4BBS G;  3CC7 A;  1SRO A;  3K5M A;  3BDO A;  1T9H A;  1YBY A;  3EVQ A;  3PF4 A;  1A1T A;  1PYW D;  5GAE C;  4UAI A;  5IY0 A;  5A35 A;  3HOZ H;  1XNR L;  3AU7 A;  2WV6 D;  1B44 D;  4P75 A;  3SEB A;  4FF3 A;  4Y7N B;  1SYF A;  1WWE A;  1EFW A;  1UNS A;  2G9D A;  3H94 A;  1LTT D;  4A3G G;  1BCP D;  3OOC A;  1D1K A;  4K6L A;  5FJ8 G;  1TWH B;  4MTK A;  4TQU S;  1IL8 A;  1M8A A;  3QR8 A;  4JI8 L;  2QIL A;  1TKW B;  1E2V A;  2ZJQ A;  3N52 A;  2EQS A;  2DY8 A;  4HSV A;  4BBR H;  1JOK A;  1DZ1 A;  2EYL A;  1EY6 A;  3PIO 3;  1YJW A;  4LFC Q;  3GD7 A;  4K5W A;  3IRB A;  2B2W C;  4BY7 B;  1YHA A;  2B2V C;  4DV1 Q;  3CCQ A;  4DV4 L;  1VQC A;  2Z1C A;  2CW0 C;  1PH9 A;  1VQB A;  5HUR A;  1IKL A;  5AJ3 L;  1DCZ A;  4BY1 G;  4JI3 L;  3S1Q H;  3S14 B;  1EUJ A;  1A63 A;  1CZG A;  3E6Z X;  1FGU A;  5C4X H;  3ULP A;  1MIU A;  1B7Y B;  1JB3 A;  5ELO A;  1I50 H;  4GLV B;  3RMH A;  1HZB A;  1DOL A;  1F9R A;  4ULL A;  2JK8 A;  2PYK A;  3MHB A;  1KC8 C;  1TR5 A;  4OXP A;  3RNU A;  2LFN A;  2L15 A;  3PO2 G;  4OX9 Q;  2NVQ H;  1X3F A;  3NBH B;  2J4X A;  4LF8 L;  2EIF A;  3HOW H;  1FNW A;  2N8N A;  3SGI A;  1IYJ B;  5GAG C;  4A3K H;  2R93 H;  3T1H L;  2BA0 A;  2PQA B;  4CKE A;  1BF4 A;  2VUM B;  3TS0 A;  3KLW A;  5C4J H;  4DFA A;  1NAP A;  3KF6 B;  2K5D A;  2K1B A;  4EVO A;  2VB2 X;  4QIW E;  4DNR B;  1N34 L;  1TWG B;  2I5H A;  1C7Y A;  1LT6 D;  4LF6 Q;  4A76 A;  3BZC A;  4QIW B;  4OIJ A;  1BBU A;  1VQJ A;  3T1Y Q;  4GS3 A;  4DXG A;  5KND A;  3W3A A;  4MZ9 A;  3PO3 H;  4JBJ A;  1SSO A;  4HMI A;  1A6X A;  3RZD H;  2A6E C;  2L55 A;  2QA4 A;  1TWF H;  2JP1 A;  3UE0 A;  1HPC A;  3MXP A;  4X66 Q;  4R4Q A;  1A2T A;  2HQL A;  1B50 A;  4OIK A;  1I3Q B;  3KLS X;  2RDF A;  2ZTD A;  1KD1 C;  1HH2 P;  1EQV A;  1OXV A;  3Q23 A;  1MBY A;  1A0I A;  1HNX Q;  2KBN A;  3TME A;  3CRL C;  1EIY B;  2CKZ B;  4UP8 A;  4HIO A;  3DMU A;  2EJG C;  2NN6 G;  3HOV G;  3CQZ H;  1TY2 A;  4RHS A;  2F0F A;  5IGG A;  4NKL A;  2ZTE A;  1M1K C;  3VR6 A;  2E74 C;  1E24 A;  4V0B A;  4DR5 Q;  1XPR A;  3J81 L;  1KIX A;  5CV5 A;  4DV0 L;  3D31 A;  4XYO A;  1Y8N B;  3OHX C;  2KHJ A;  3E9H A;  3SK5 A;  5H1S E;  2R7F A;  3HP3 A;  1XMO Q;  2ZM6 L;  5BR8 L;  3S17 B;  1SXT A;  4M1U B;  4JV5 Q;  2IW3 A;  2OCE A;  1BO0 A;  3D0F A;  1SYE A;  1WJJ A;  2OQ0 A;  5ELE A;  4DK0 A;  1V9P A;  3OW2 A;  2E8G A;  1O7Z A;  2CFM A; 
#chains in the Genus database with same CATH homology
 3TRE A;  1CUK A;  3B6Y A;  4UP7 A;  1IBK Q;  4JBK A;  1E1O A;  4YY3 L;  4A3F H;  2HT1 A;  3HOY H;  1Y1V G;  1XJV A;  1Q3Y A;  1EQR A;  3I4O A;  1YHQ A;  1K0R A;  4BBR G;  1JE5 A;  1N32 L;  3KYH C;  2JEA I;  4DUZ L;  3RLN A;  3K80 C;  4LFB Q;  1IL2 A;  2BH8 A;  5FLM G;  1IBL L;  4A4I A;  4JI8 Q;  4JOI C;  5M3F H;  4LF4 L;  4P74 A;  1BVS A;  1K83 H;  3PUX A;  1KAW A;  3PUY A;  1JJ2 A;  2WAQ G;  2UUB L;  2E5L L;  2UXD Q;  1SR3 A;  1VQA A;  3M7N A;  3FHW A;  1EYG A;  4X62 L;  4JOI A;  3H0G G;  4HJ7 A;  1JJC B;  3AQQ A;  1SN8 A;  4X65 Q;  2M3Z A;  4UPA A;  4AYB G;  3JAM c;  1KRS A;  3DLL A;  4A3L H;  4B3R Q;  3RN5 A;  4JI0 L;  2R7D A;  4L5Q A;  3CCE A;  2JA5 H;  3CC4 A;  3PO2 H;  4A3M H;  2HHH Q;  1CSP A;  4K0K Q;  3ZJY C;  4KHP Q;  2NZO A;  2I5L X;  2VQE L;  1SRU A;  2PQA A;  4DR1 L;  4A3E G;  2PNH A;  4LWC A;  3UDI A;  1JB7 A;  4DV4 Q;  3CPW A;  4AQY Q;  1Q7Y C;  5HY6 A;  5IWA L;  5E7N A;  1GVP A;  4A3B H;  5C4X G;  2WB1 E;  4GLA C;  3T1Y L;  1YEZ A;  2WP8 J;  5AJ3 Q;  4DV5 L;  1Q81 C;  1PH3 A;  3ERS X;  4IO9 A;  1WOC A;  3HKZ G;  3K8A A;  3PF5 A;  4HJ9 A;  1ESK A;  2AMC B;  2YTY A;  3ULL A;  1ASY A;  2F3I A;  2VNU D;  4LF7 Q;  3NEL A;  4R4C A;  3U4V A;  4NXM L;  1PH4 A;  1G29 1;  1MJE A;  1CSQ A;  2YSA A;  3EN2 A;  4A93 H;  1AE2 A;  1K3R A;  1PH2 A;  4YWK A;  1L0W A;  1CKO A;  4DR2 L;  1I6H H;  3WWV A;  1XNQ L;  2B3G A;  1Q1B A;  2GN5 A;  3L2P A;  2VQF Q;  2ALY B;  1EOV A;  4KHZ A;  4YCU A;  1QZG A;  3HOW G;  3KJP A;  4JI2 Q;  4JC0 A;  1R9T H;  2Q2H A;  4A3K G;  1CKN A;  3OYY A;  2FXQ A;  2R93 G;  4YWM A;  1D8L A;  1XPO A;  4DR4 Q;  4WJ3 M;  5HGQ A;  1SLJ A;  3K7A H;  3FP9 A;  4XIG S;  1X9N A;  1VQ4 A;  3M85 A;  4A3D G;  4JI1 Q;  4JYA Q;  2UXB Q;  3CCS A;  4LF8 Q;  2CWA A;  3L7Z C;  3PCO B;  1WWF A;  5EAY A;  3TEH B;  1PH6 A;  2A19 A;  4DV7 L;  1D7Q A;  4BBS H;  1O7I A;  2CCZ A;  3T1H Q;  2K50 A;  4LUO A;  3KDF A;  5GQO A;  4DK6 C;  2CWP A;  3CXC A;  3GTO H;  2Y0S G;  3I7F A;  3GO5 A;  1VQ6 A;  2F52 A;  4DUY L;  4GNX B;  3CCU A;  5C0X G;  3E0E A;  4B3M Q;  4IFD J;  3J81 c;  2UU9 Q;  1UE5 A;  3ER0 A;  4BA2 I;  2L4L A;  4DR7 L;  3TRZ A;  4JG2 A;  2B63 G;  1Y1W H;  3M3Y H;  1QVC A;  3LGJ A;  1N34 Q;  3H15 A;  1CKM A;  4DV6 Q;  5IP7 H;  3GTM H;  4GKK Q;  1M90 C;  1IBM L;  3S1R H;  4A3G H;  4NB3 A;  1OXX K;  2XGT A;  4HIM A;  1B8A A;  5IYB G;  1DGS A;  2JA7 H;  4QQB X;  2NZH A;  1BBW A;  1YHB A;  5DLQ E;  4QJF A;  1WCM G;  4NPS A;  4LFA Q;  3OTO Q;  5IE8 A;  4JCV E;  3U50 C;  3PSI A;  1GKH A;  3RZO H;  4IPH A;  3PIP A;  1NY4 A;  1A6B B;  3GDE A;  3I55 A;  4DV1 L;  1FL0 A;  4PMW A;  1X65 A;  3S1M H;  3W1B A;  1HNZ L;  4TVA B;  4IPG A;  5GRO A;  2RHQ B;  5M5Y H;  1XMQ L;  3GTL H;  2UXC Q;  2JZW A;  1XPU A;  3AEV A;  4WJ4 A;  2N3S A;  5LMN L;  3AYH B;  1VQE A;  1Q3Z A;  4JI6 Q;  4DV2 L;  4GN4 B;  2VW9 A;  3HOU H;  1U0L A;  4A75 A;  3TS2 A;  5M3M H;  3CAM A;  2NN6 I;  1HJP A;  2D0P A;  2I0Q A;  4B3T Q;  1S3O A;  4X64 Q;  3A74 A;  3EBE A;  3I56 A;  2MO1 A;  3J80 i;  4AH6 A;  2KCT A;  1QVF A;  1YVC A;  1WWG A;  5IYC G;  4LUV A;  4POF A;  1QUQ B;  4BY1 H;  2NVY H;  3CW2 C;  4X65 L;  2RF4 A;  3I4N G;  3CP0 A;  1B70 B;  1W3S A;  1X3G A;  4A3C H;  3M4Q A;  3HOX G;  5LMU L;  1J5E Q;  1I94 L;  3GTQ H;  3G48 A;  3GTJ H;  1V43 A;  4HJ5 A;  3I4M H;  2N78 A;  1S72 A;  4QY7 A;  1Q1E A;  1MJC A;  1VQI A;  2EXF A;  4OX9 L;  1I5F A;  4C3I H;  3H0G H;  4X6A H;  4L5T A;  4P72 A;  4YCW A;  1P8L A;  1VQF A;  4GLX A;  4GKJ L;  1N36 Q;  4DV0 Q;  1KQS A;  1VQ5 A;  2R92 G;  1YI2 A;  4R1J A;  1Q82 C;  4IFD I;  2OQK A;  4DR6 Q;  1HR0 L;  1FVI A;  1NMG A;  2BA1 A;  4DAY B;  2IHF A;  4C2M H;  5IP9 H;  1FJG Q;  2VUM G;  3A5Z B;  5BR8 Q;  2ZM6 Q;  1UWV A;  1PH8 A;  5M5W H;  2EC7 A;  1AAF A;  1P16 A;  1LM0 A;  3PV0 A;  4OO1 G;  4IPC A;  1EWI A;  3M4P A;  2UUC L;  3S2H H;  1SMX A;  2IX0 A;  1UE7 A;  5IYD G;  1KHI A;  2Q2I A;  4DK3 C;  1QZH A;  5GAD C;  4DV3 Q;  1NE3 A;  5GAH C;  2D62 A;  2JE6 I;  3J7A 5;  5FLX c;  4LF6 L;  2Q2T A;  3MXN B;  1HNW L;  1HZC A;  4L5S A;  4YHH L;  1YIT A;  1S40 A;  2IHX A;  4IJL A;  5C0X J;  4YY3 Q;  4EQ5 A;  4A3J H;  2YV5 A;  3HKS A;  3J7Z C;  5JJI A;  1YIJ A;  2MO0 A;  4DUZ Q;  4UY8 C;  1C0A A;  2LI8 A;  4JI3 Q;  2AHO B;  2K5N A;  2XTI A;  2WAQ E;  1WWD A;  1IBL Q;  4A3L G;  3NEN A;  4YWL A;  4LF4 Q;  2JA5 G;  2A8V A;  4JI1 L;  1RL2 A;  2ID0 A;  4A3M G;  2UXB L;  1X6O A;  1Z47 A;  3EIV A;  4EX5 A;  1SFO H;  4JI7 L;  5C44 H;  2YYZ A;  4LUZ A;  4X66 L;  2UUA Q;  2AKW B;  2E5L Q;  1PYS B;  2H5X A;  4O2D A;  4X62 Q;  3Q8D A;  2K52 A;  1YNX A;  3K81 C;  4PZ6 A;  3AFQ A;  1MFS A;  2IHE A;  2IY5 B;  3CCV A;  3M9B A;  4JI0 Q;  4GNX C;  4A3B G;  4A3D H;  4B3M L;  1YZ6 A;  1LYL A;  4XTC S;  2CQF A;  4LF9 L;  1AE3 A;  2HIV A;  2F4V L;  3GTP H;  4B3S Q;  1TWC H;  1HNX L;  4Y7N H;  2VQE Q;  4DR1 Q;  4Y52 H;  5K36 G;  1PYB A;  2JA6 H;  4GNX A;  4GKK L;  4NXN Q;  3BZK A;  3HKZ E;  4DPG A;  3JC6 6;  2ASB A;  5IWA Q;  1QVG A;  1OTC A;  1U6P A;  3NYB B;  4LFA L;  2I5M X;  2N49 A;  2JQO A;  2B63 H;  2OTJ A;  5J3B A;  2EXD A;  4HID A;  4GN5 A;  4JI4 L;  4BA1 I;  4LF5 L;  2LXJ A;  3CCJ A;  4NXM Q;  1UE6 A;  1VQD A;  3G6E A;  1J6Q A;  3PO3 G;  3PIO A;  4DR5 L;  3KOJ A;  1HZA A;  4PG3 A;  1PH1 A;  1WCM H;  3HOV H;  3AFP A;  4DR2 Q;  2E2I H;  1OXT A;  2JA8 H;  1LTL A;  3J81 j;  1XNQ Q;  4JBM A;  2JJQ A;  1TXY A;  2GVB A;  4BY7 H;  2DUD A;  1XMO L;  5JJL A;  2R7Z H;  3H3V H;  1X54 A;  1VQK A;  2C35 B;  3MEF A;  2MNA A;  3CC7 A;  4BBS G;  1SRO A;  1A1T A;  1T9H A;  1YBY A;  3CC2 A;  4JBW A;  1EIF A;  4JI5 L;  2IX1 A;  1N33 L;  3PF4 A;  4JV5 L;  5GAE C;  5C3E H;  5JEA G;  4FDB A;  5IY0 A;  3F2B A;  1GD7 A;  1WYD A;  4X64 L;  3L0O A;  3HOZ H;  1XNR L;  2RCN A;  5C0X I;  3RR5 A;  1U5K A;  1VQ8 A;  3S24 A;  5JJK A;  3UDG A;  3S1N H;  3S2D H;  4P75 A;  2Y0S E;  4DV7 Q;  4DR3 Q;  2B29 A;  3CD6 A;  1WWE A;  3FKI H;  1IBK L;  1X56 A;  4IPD A;  1Y1W G;  1EFW A;  3PUV A;  1A62 A;  4A3G G;  3UE1 A;  5IP7 G;  2LSS A;  1OXS C;  1VQM A;  1Z9F A;  2PI2 E;  1NMF A;  3HFZ B;  1J5E L;  4LFB L;  1JJG A;  5FJ8 G;  4DUY Q;  4TQU S;  1K8A C;  2Z0S A;  4JI8 L;  1QUQ A;  3K7U C;  1IXR A;  1VQG A;  2GVA A;  3BU2 A;  2ZJQ A;  4DR7 Q;  5IYC H;  2EQS A;  1KL9 A;  4HJ8 A;  3CCM A;  2VS1 A;  4PZ7 A;  4HIK A;  1Y1V H;  1MKH A;  2UXD L;  3H3V I;  1PA6 A;  4R4I A;  4BBR H;  4QL5 A;  4C3H H;  1L2F A;  4KI0 A;  4POG A;  5FLM H;  2ZJR A;  3JAM i;  1Q86 C;  2OTL A;  4DR6 L;  4B3R L;  1GO3 E;  3CMA A;  1YJW A;  4J15 A;  2KHI A;  4LFC Q;  4OWW B;  3GD7 A;  1N8R C;  1FJG L;  3IRB A;  4O0A A;  1VQ7 A;  3F2C A;  2HHH L;  1E1T A;  4K0K L;  1YHA A;  1YJ9 A;  4KHP L;  4GOP B;  3PGZ A;  2R92 H;  4DV1 Q;  1L1O C;  2AWN A;  4IFD G;  1K8G A;  3CCQ A;  4LW1 A;  3GTG H;  4DV4 L;  3F8T A;  4AQY L;  1RIP A;  1HNZ Q;  1VQC A;  5M5X H;  3CCL A;  2OWO A;  2VUM H;  1XMQ Q;  1PH9 A;  1VQB A;  1F6U A;  1UE1 A;  5AJ3 L;  1NBW A;  4A3I G;  5LMN Q;  4ME3 A;  3UDF A;  3CME A;  3F2D A;  1L1O A;  2VL6 A;  4GN3 B;  1PFS A;  4DV2 Q;  4BXX G;  4APV A;  4A3E H;  5IYD H;  2WB1 G;  4A3F G;  4BY1 G;  4JI3 L;  3CCR A;  4LF7 L;  3HOY G;  3S1Q H;  1TWG H;  1EUJ A;  1VQ9 A;  1WI5 A;  1A63 A;  1G6P A;  2ATW A;  4A3C G;  4PZ8 A;  1Y14 B;  3NEM A;  1FGU A;  5C4X H;  3I4M G;  1L1O B;  2VZA A;  3ULP A;  2E2J H;  3J80 c;  3CPF A;  5M3F G;  2UUA L;  2IT1 A;  2JEB I;  3KJO A;  2VQF L;  4IOA A;  3S16 H;  3M4O H;  1MIU A;  1B7Y B;  1UEB A;  1X55 A;  4JI2 L;  1NJI C;  5ELO A;  3RLF A;  5ELN A;  1N32 Q;  1I50 H;  4GLV B;  5LMU Q;  1I94 Q;  1HZB A;  1SE8 A;  2WFW A;  3K0X A;  4DR4 L;  2KEN A;  1IZ6 A;  4OON A;  1VQN A;  2JK8 A;  4DAM A;  3ICE A;  5LMN W;  4OXP A;  1KC8 C;  3RNU A;  1JMC A;  5IP9 G;  2D0O A;  2L15 A;  4B3S L;  4OX9 Q;  3PO2 G;  2NVQ H;  4AIM A;  4JYA L;  1X3F A;  3NBH B;  1Q12 A;  4LF8 L;  2EIF A;  2UUB Q;  3HOW H;  4AYB E;  2N8N A;  4OO1 I;  3KF6 A;  4NXN L;  1IYJ B;  3SGI A;  2ZTC A;  5GAG C;  4A3K H;  4QGU A;  2R93 H;  1I3Q H;  1ASZ A;  4GKJ Q;  3T1H L;  2RHS B;  2BA0 A;  2K5H A;  3VDY A;  5JEA J;  3STB C;  2PQA B;  1HR0 Q;  2E2H H;  3TS0 A;  3KF8 B;  3KLW A;  2K14 A;  2DGY A;  5C4J H;  1KXL A;  1C9O A;  3KF6 B;  3J81 i;  2UU9 L;  1BKB A;  2K75 A;  2UUC Q;  4A3J G;  3A0J A;  4QIW E;  1N34 L;  3PUZ A;  4DV6 L;  2I5H A;  3G71 A;  2MFI A;  1C7Y A;  4LF6 Q;  4A76 A;  3BZC A;  2K4K A;  4UP9 A;  1HNW Q;  1XTD A;  3I2Z A;  1TWH H;  1BBU A;  3DM3 A;  1VQJ A;  4YHH Q;  3T1Y Q;  4A93 G;  2K5V A;  4DNI A;  4DV5 Q;  5C44 G;  4GS3 A;  3OTO L;  4MTN A;  2QEX A;  1JT8 A;  1A8V A;  4IJH A;  4MZ9 A;  2Q2U A;  3PO3 H;  2YTX A;  4JBJ A;  2YTV A;  3RZD H;  2AWO A;  1GM5 A;  1HR0 W;  4P71 A;  4IOC A;  1VQH A;  5IYB H;  2QA4 A;  1HZ9 A;  2A1A A;  1TWF H;  4JI7 Q;  1CKN B;  4LNQ A;  3UE0 A;  1K9M C;  2UXC L;  4DR3 L;  4X66 Q;  4R4Q A;  2ES2 A;  3G4S A;  4ALP A;  3S17 H;  2HQL A;  2JA6 G;  3U4Z A;  1NTG A;  4JI6 L;  3S15 H;  4OWX B;  1E3P A;  1EQQ A;  2ZTD A;  1TWA H;  1Q46 A;  1V1Q A;  1KD1 C;  1HH2 P;  1OXV A;  1E22 A;  3RN2 A;  4B3T L;  4LF9 Q;  2F4V Q;  4C3J H;  1A0I A;  1Q8K A;  1WFQ A;  1BJ6 A;  3KDF B;  1HNX Q;  2KBN A;  1VCI A;  2R6G A;  1K73 C;  1AH9 A;  2HIX A;  3F1Z A;  1G51 A;  3TQY A;  3W1G A;  1EIY B;  3RLO A;  2NVX H;  2PI2 A;  2CKZ B;  4P73 A;  5FJ8 H;  4UP8 A;  4HIO A;  1PH5 A;  3S14 H;  2Z6K C;  2NN6 G;  3U58 A;  1W2B A;  4DKA C;  3HOV G;  3CQZ H;  4LFC L;  4RG1 A;  1YJN A;  2JA7 G;  2JA8 G;  2KCM A;  2NVT H;  3ULJ A;  1LUZ A;  4BY7 G;  2VY3 A;  2ZTE A;  3E9I A;  4MNO A;  4HJA A;  2R7Z G;  4LF5 Q;  1M1K C;  4GOP C;  4RMF A;  2JA9 A;  2Z6K A;  1VQL A;  2YU9 H;  4JI4 Q;  1H95 A;  1E24 A;  1PHJ A;  1OXU A;  1E7Z A;  4DR5 Q;  1XPR A;  1X3E A;  5C3E G;  3I4N H;  3KFU A;  1IBM Q;  3HOX H;  1KIX A;  1VQP A;  4DV0 L;  1N36 L;  3D31 A;  4R4T A;  2KHJ A;  3E9H A;  3PUW A;  4GOP A;  5H1S E;  2R7F A;  4H02 A;  3STB D;  2V1C C;  3GTK H;  3HOZ G;  3A5U A;  1KRT A;  1XMO Q;  2ZM6 L;  5BR8 L;  4YCV A;  3W5O A;  2ZJP A;  2QGQ A;  3FKI G;  1N9W A;  2BH2 A;  4JV5 Q;  1PV4 A;  4OWT B;  4JI5 Q;  4L5R C;  1N33 Q;  2CQO A;  2OCE A;  5IT9 c;  3D0F A;  3BJU A;  3HOU G;  4R4O A;  1WJJ A;  2MQH A;  4DV3 L;  2OQ0 A;  5M3M G;  1V9P A;  4KLK A;  2LXK A;  2E8G A;  3UDX A;  3CF5 A;  3OW2 A;  4A3I H;  1VS0 A;  1VQO A;  1PH7 A;  2PMZ E;  1XNR Q;  1PVO A;  2CFM A;  4BXX H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...