3TS2A

Mouse lin28a in complex with let-7g microrna pre-element
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
135
structure length
135
Chain Sequence
b'QLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSINHMVASCPLKAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein lin-28 homolog A
publication title Molecular Basis for Interaction of let-7 MicroRNAs with Lin28.
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein/rna
total genus 27
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00098 zf-CCHC Zinc knuckle
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3ts2A01
4.10.60.10 Few Secondary Structures Irregular HIV-1 Nucleocapsid Protein Zinc finger, CCHC-type 3ts2A02
2PQAA 1KL9A 4YCWA 2ZM6L 1N34L 1JT8A 1WWGA 3I7FA 1PH7A 2ZTEA 2D0OA 5IYCG 1G6PA 1OXUA 3F8TA 3RLNA 3U50C 2VQEQ 4GOPC 1U6PA 1JE5A 3GTKH 1NY4A 4A3KG 2R7ZH 3HOYH 2JJQA 4DUZQ 1NMGA 1HNZQ 3G4SA 2UUCQ 2QGQA 3M4QA 2VQEL 4LUOA 2CWPA 4DK6C 2IX1A 3JAMc 1GD7A 4J15A 1SLJA 4OO1G 2NVYH 1HNZL 3GD7A 1HH2P 4QL5A 4UPAA 2UUCL 1A6BB 5FLMH 3NELA 5C3EG 3GTLH 3CCJA 1XPRA 1W2BA 2F3IA 4P74A 4GNXC 2E2IH 2JA5G 3I4NH 1SFOH 3BJUA 1WWDA 2EQSA 1K8GA 1WOCA 1E22A 2YTXA 3BZCA 3G71A 2PI2A 3W1BA 4GN3B 1CKNA 1HR0L 5IWAL 4HIDA 3S17H 2GVAA 4GOPA 1IL2A 4ALPA 4L5QA 4A76A 4BBRH 1VQ9A 4NPSA 2JA8H 3NENA 5ELNA 1L0WA 2Q2TA 3HOZG 2HIVA 4OONA 1NE3A 1CSPA 4PMWA 5JJLA 4A3IH 1TXYA 1YHQA 1IBMQ 3I4NG 1XPOA 1U0LA 3DM3A 3GTOH 2KENA 4JI4Q 4IPDA 4Y7NH 5JEAJ 1C9OA 3CW2C 5AJ3Q 5BR8L 4DV4Q 1S72A 4LF5Q 3PCOB 2BH2A 4GKKQ 4IOCA 3AEVA 1K0RA 3STBC 5IYDG 1IBML 4KLKA 1FJGQ 3S2DH 3S14H 1QUQA 4P71A 4GNXA 2EC7A 1BVSA 2I5HA 2JA8G 3ULLA 3GTJH 1S40A 1PA6A 4LF5L 1K3RA 3J81c 3NEMA 3LGJA 3HOVH 4GKKL 1G291 1I5FA 1XNQQ 3KYHC 4QQBX 3CCQA 2JA7H 4AYBG 4LF4Q 2D62A 4JBJA 4GLXA 3AQQA 1YHAA 3ZJYC 1Q86C 3PO3H 1K83H 4PZ8A 1MKHA 1NBWA 2E2JH 5C4XH 4A3LH 1SRUA 4OXPA 4DR6L 3DLLA 1Z47A 2BA1A 3M3YH 4BBSH 4YWLA 2N3SA 1VQDA 2NZHA 4DK3C 1Q81C 1VQMA 1A62A 4APVA 3F1ZA 1VQ8A 4LF9Q 3H0GH 4K0KQ 1M1KC 2QEXA 3S15H 5IP7G 2GN5A 3CC2A 4TQUS 5HY6A 4LFAQ 3UDXA 1AAFA 2UU9L 1HJPA 4LF9L 5C0XJ 3SGIA 4K0KL 3M9BA 1YHBA 4B3RQ 1D7QA 4QJFA 4C3JH 4LUZA 4KHPQ 1KRSA 2A19A 4JOIC 1VQJA 1KAWA 4B3RL 1WYDA 4YY3L 1EUJA 1VQ6A 4DR7Q 4LF8L 3CPWA 3CCUA 3G48A 2NVQH 1KD1C 2Q2HA 1VQHA 2CQFA 5GAGC 1T9HA 3E0EA 3K80C 4DR7L 2KHJA 1X3GA 4A93H 2IHXA 3ER0A 2Z6KA 4OWXB 1L1OC 1OTCA 2UUBL 1K8AC 1XTDA 4DR1Q 2B63H 2HHHQ 3PF4A 4YWMA 1PH3A 2YV5A 2UUAQ 3A0JA 4BA2I 4IFDG 2QA4A 3M85A 4R4OA 5GROA 2E2HH 4DR1L 1VQNA 3CF5A 1R9TH 2HHHL 1OXVA 3ICEA 4GKJQ 2HIXA 3RZDH 2JA6H 2V1CC 3EIVA 4JOIA 1KRTA 2UUAL 1I6HH 3RN2A 2YYZA 1IBKL 5JJIA 3JC66 3AFPA 3T1HQ 4L5RC 2I5LX 3B6YA 1I94L 3KLWA 5IP9G 5IYBG 1Q8KA 2B63G 3BU2A 5M3FH 4GKJL 1FL0A 1VS0A 2LXKA 4QGUA 5IYCH 3S2HH 3T1HL 1RL2A 1UEBA 4YCUA 1TWHH 1I3QH 2KBNA 3BZKA 4DV0Q 3A74A 3TREA 3PIPA 1L1OA 2JK8A 3S1MH 1KQSA 4LW1A 4DV3Q 2VUMG 2H5XA 1NTGA 2PMZE 2JEBI 4DV0L 1F6UA 3J81j 4WJ4A 4JI8L 1N32L 5M3FG 3CXCA 1KHIA 2IX0A 3PGZA 4DR5L 2WB1G 4DV3L 3OYYA 4WJ3M 3K0XA 3T1YQ 1EQQA 1VQPA 4JI5Q 2K5HA 3HKZE 4NB3A 5C3EH 4P73A 2UXBQ 4O2DA 1TWGH 2PQAB 2OCEA 4UY8C 2FXQA 3MEFA 2MFIA 4LNQA 3S16H 2JA5H 3CCEA 5M5XH 1Y1WG 4JI5L 2ZJQA 1PFSA 2UXBL 3UDFA 4A4IA 1AH9A 4IPGA 2R7FA 1OXSC 1AE2A 4DUZL 4KHZA 1P16A 5IE8A 1VQ7A 1XJVA 1HZAA 1VQAA 2NN6I 4DKAC 1PVOA 1Q3ZA 4OX9Q 3J80i 5C44G 3HOXG 1IXRA 1Y1VG 4R4IA 2K5NA 4QIWE 3RZOH 3HOZH 1EIYB 2VNUD 1BKBA 1PH9A 4X66Q 1N9WA 1PH2A 4B3MQ 4OX9L 3CC7A 2ASBA 2NVXH 1GM5A 4QY7A 4HIKA 1CSQA 1X3EA 2WFWA 1PV4A 1KC8C 4X66L 4AIMA 2IHEA 4LWCA 1KIXA 1JJ2A 5IYDH 2OQKA 2RHSB 4A3MG 4B3ML 1AE3A 4P72A 4DV1Q 4PG3A 3CP0A 4A3JH 1PH6A 4X64Q 3KF6A 1CKNB 4DV7Q 4MZ9A 3KFUA 4GOPB 1VQKA 1YVCA 2PNHA 3E9IA 3HOUH 3L0OA 3CMEA 4DV1L 4DR3Q 1P8LA 2UXCQ 3U58A 2BH8A 3CCSA 4X64L 5M5YH 4RMFA 4YCVA 3S24A 2JQOA 4DV7L 3KF6B 2VZAA 3RNUA 1CUKA 1K73C 4DR3L 1V9PA 2UXCL 4JI4L 4IJLA 5AJ3L 4DV4L 2R93H 2WAQE 5C0XI 4A3JG 1MFSA 2M3ZA 3PV0A 5IP7H 1FJGL 3HOWH 1WJJA 2B29A 1WCMH 4DV5Q 1XMQQ 1LM0A 1QUQB 2RF4A 3TRZA 4IPCA 4GNXB 2ZJRA 4JCVE 1N36Q 1ASYA 1JJGA 1WWEA 5C4JH 2KHIA 1XNQL 3NBHB 4LF7Q 1C7YA 2MO1A 4LF4L 1XMQL 2ATWA 3CCVA 4DV2Q 3GTMH 1LUZA 4JI1Q 4B3TQ 2IT1A 1SN8A 2Y0SE 2R93G 2MO0A 2GVBA 3KF8B 3TS0A 2F4VQ 3TS2A 4HJ8A 4LF7L 4HJ9A 3HOWG 4DV2L 3RR5A 4B3TL 1WCMG 1YJNA 1K9MC 2B3GA 5GAHC 2L15A 2MNAA 4LFBQ 1HZBA 4A3CG 3CCLA 4R1JA 1IYJB 4JI0Q 2KCTA 2N78A 3D31A 3ERSX 4HIMA 4LFAL 1YITA 1VQOA 1SROA 3GTPH 5GAEC 3A5UA 2NZOA 4JBKA 1CKOA 4LFBL 3M7NA 4A3EG 5M3MG 3L7ZC 1UE1A 2KCMA 4KHPL 1VQBA 4O0AA 5GQOA 3GDEA 4P75A 2CCZA 3A5ZB 3KOJA 1PH4A 1J5EQ 4DPGA 1UWVA 5LMNW 4A3DG 1IBLQ 1YBYA 4JC0A 4A3FG 4X62Q 3I4OA 4IOAA 4X65Q 5IP9H 5IYBH 4DR2Q 2EIFA 2D0PA 1J5EL 4FDBA 4POFA 4C3IH 2K75A 2A8VA 1IBLL 4B3SQ 3E9HA 4X62L 1WFQA 4GN5A 1EYGA 4DR2L 2VY3A 1WI5A 1HNXQ 1VQ5A 4EX5A 2EXDA 2JA9A 3K7UC 4ME3A 3RLFA 1V43A 3K7AH 4BA1I 3PSIA 3GTGH 1VQGA 2VUMH 4B3SL 4JI6Q 1A0IA 4OWWB 3JAMi 1JB7A 1M90C 1U5KA 4BY7H 2IHFA 2EXFA 1Q3YA 2CQOA 2Q2UA 3VDYA 4NXNQ 5JJKA 1YI2A 1E3PA 3PO2G 4L5SA 3FKIG 1MIUA 2AMCB 2K14A 3FHWA 3PUVA 3F2BA 5LMNQ 4BXXG 5FJ8G 2NVTH 1H95A 1A63A 4JI3Q 1W3SA 1UE7A 1YIJA 4NXNL 1BBUA 4MTNA 3H3VI 1Y1WH 1I50H 4GN4B 3OTOQ 5LMNL 2L4LA 5LMUQ 2Y0SG 4BY7G 4JI3L 1L1OB 4X6AH 4A75A 3RN5A 3OTOL 4NXMQ 5C44H 1VQFA 3HOXH 1QVCA 1Y1VH 2ZJPA 4BY1H 2C35B 1O7IA 1OXTA 1C0AA 3I55A 1LYLA 1DGSA 4JBWA 4IO9A 4H02A 3T1YL 3CCMA 1X55A 4NXML 4IFDJ 2ID0A 2AWOA 2LXJA 1B7YB 3GO5A 4LF6Q 2JZWA 4A3GH 3UDGA 1PH8A 4A3BH 1X6OA 4JI7Q 3GTQH 4L5TA 4HJAA 1VQIA 3PUXA 4A3MH 3AFQA 4IPHA 1Y14B 4AYBE 3J81i 5DLQE 3KDFA 2VW9A 1HR0W 4LF6L 1VQLA 3M4OH 4JI7L 2NN6G 4BY1G 4HJ5A 2K50A 2PI2E 3K8AA 1Q7YC 3IRBA 3G6EA 1Q12A 1YJWA 2R92H 2WP8J 4GLVB 1A1TA 1IZ6A 5JEAG 3CQZH 3J7ZC 2OTJA 3KDFB 1YJ9A 3I4MH 4A3GG 1ESKA 4AH6A 4A3BG 2CWAA 3W5OA 4C3HH 1GO3E 2CFMA 2K5VA 5ELOA 3ULPA 1J6QA 4OO1I 3J7A5 3I2ZA 4HJ7A 1X9NA 2YSAA 3CCRA 1X3FA 1YEZA 2R92G 1NMFA 2YU9H 3U4ZA 2N8NA 3EN2A 1MJCA 1WWFA 1A8VA 1HR0Q 5IWAQ 1FGUA 3I4MG 3HOYG 2R7ZG 4LFCQ 1SE8A 3RLOA 2MQHA 2Q2IA 1PH1A 3M4PA 4R4TA 1Q1BA 2UXDQ 2VS1A 2AKWB 3OW2A 2IY5B 4AQYQ 4LFCL 5EAYA 5FLXc 1E1TA 4MNOA 3PUYA 1QVFA 4Y52H 1BBWA 5C0XG 5FLMG 2UXDL 1VQEA 1Z9FA 1JJCB 4JG2A 3KJOA 4A3CH 5BR8Q 4AQYL 3S1RH 3FP9A 2A1AA 2LI8A 2XTIA 3TEHB 1RIPA 3HKZG 1N8RC 4DV5L 1EFWA 4JV5Q 1Q82C 2OQ0A 3CPFA 4A3EH 4DV6Q 1N36L 5M3MH 1Q1EA 1PH5A 1TWCH 2CKZB 1GKHA 1XNRQ 2RHQB 2XGTA 4KI0A 4JV5L 2LSSA 4BBRG 3KJPA 4PZ7A 4R4CA 1X54A 4JI1L 3TQYA 4DV6L 2OWOA 3PUZA 3MXNB 1XNRL 2F4VL 5IT9c 3HKSA 3J80c 4A3IG 4A3FH 1SMXA 4DR6Q 2HQLA 3CD6A 4A3DH 3HFZB 3D0FA 5E7NA 4HIOA 4UP9A 1HZCA 1OXXK 1FVIA 1UE6A 4XIGS 4YWKA 1SR3A 1XPUA 2Z0SA 2I0QA 4JI0L 2E8GA 2E5LQ 1E24A 2ZTCA 1EWIA 1Q46A 4XTCS 1EIFA 1EOVA 2Z6KC 2UU9Q 1VCIA 2K52A 2RCNA 4GLAC 3HOUG 2YTYA 4POGA 4RG1A 3HOVG 2WB1E 1MJEA 1TWAH 1L2FA 2E5LL 3AYHB 4DNIA 1CKMA 2JA7G 1N33Q 3PO3G 4YY3Q 1E7ZA 4JI2Q 4DAYB 4LF8Q 3W1GA 1ASZA 1E1OA 5C4XG 2ZTDA 4PZ6A 5M5WH 3PIOA 3PO2H 1EQRA 5GADC 4A3LG 4BBSG 3STBD 3WWVA 3NYBB 4X65L 4JBMA 2R7DA 3FKIH 4DAMA 1N33L 1QZGA 2OTLA 1TWFH 4GS3A 4JI2L 3S1QH 5FJ8H 4BXXH 3H0GG 3PUWA 1NJIC 2ES2A 5J3BA 4TVAB 1LTLA 1QZHA 5IY0A 3CMAA 1HNXL 1D8LA 1YNXA 3F2DA 2UUBQ 3H3VH 4DR4Q 2R6GA 3U4VA 2WAQG 4IJHA 5HGQA 3ULJA 2AWNA 4JI6L 3F2CA 1HNWQ 1YZ6A 2VL6A 4DR4L 3UE0A 3CC4A 4IFDI 1BJ6A 4C2MH 2JE6I 3Q8DA 1IBKQ 4OWTB 3PF5A 1HNWL 4UP8A 2AHOB 1QVGA 4YHHQ 1I94Q 1V1QA 1B70B 1PHJA 2ALYB 1X65A 4A93G 1HZ9A 4DUYQ 2DUDA 1S3OA 3H15A 5K36G 1KXLA 1PYBA 4YHHL 2YTVA 1GVPA 4UP7A 5LMUL 3CAMA 2K4KA 2DGYA 2I5MX 3UE1A 4DUYL 1G51A 3K81C 2VQFQ 5H1SE 3L2PA 1VQ4A 2HT1A 2JEAI 1XMOQ 2N49A 1JMCA 4JYAQ 3EBEA 4EQ5A 1B8AA 3I56A 2BA0A 1UE5A 3S1NH 1PYSB 4JI8Q 1N34Q 2ZM6Q 4LUVA 1X56A 3UDIA 4R4QA 2VQFL 4A3KH 1VQCA 4DR5Q 2JA6G 1N32Q 1XMOL 2F52A 4JYAL
chains in the Genus database with same CATH superfamily
1SYFA 2FFKB 1EY8A 1JT8A 1WWGA 1E2VA 3I7FA 1IYUA 1G6PA 2VQEQ 4GOPC 3GTKH 4L63B 5EKLA 2UUCQ 2YU9B 4LUOA 1EY6A 4FNFA 1I6VC 3NSWA 3JAMc 3MFYA 5I2YA 4J15A 5JOBA 5J22A 3HKZB 4UPAA 5C0XH 1I4RA 1HRJA 4UDUC 4M1UB 3X3NA 2E2IH 1SFOH 3Q6SA 4Q5VA 1DXMA 1WWDA 5DM73 2PI2A 1CKNA 1HR0L 5DM63 3LNNA 2K6AA 3S17H 2GVAA 4GOPA 4BBRH 4DNTB 1VQ9A 2RSNA 3WOEA 4XQJA 1WTHA 2LFNA 4IUNA 1D5XC 4HAEA 5JJLA 3IFTA 1X3PA 4QUFA 1IBMQ 1XPOA 3GTOH 4JI4Q 4Y7NH 5JEAJ 3H09A 2O4XA 5D3DA 5BR8L 3PCOB 1K3BC 1KTKA 4IOCA 4A3FB 5IYDG 2JA7B 3S14H 3HOUH 1S40A 4LF5L 1PA6A 1G291 1I5FA 1S5CD 3P7JA 5J39A 3CCQA 2D62A 1YHAA 1K83H 2FMCA 1MKHA 5EJWA 3ONAB 4BBSH 3M3YH 4YWLA 3SR1A 2NZHA 1VQDA 1F77A 3H0GH 4C1NK 4CKEA 2XSCA 5G3LF 5IT9L 5HGTA 1QCBD 3UDXA 3KBGA 2EYJA 4O42A 1F9QA 1D7QA 3BG3A 1GUOA 4YIJA 3MC0B 5BN3A 4NW2A 4B3RL 1VQ6A 1GUGA 3CCUA 2F0SA 3G48A 2NVQH 1VQHA 5A2QL 2JSOA 1SNPA 3E0EA 1KDBA 3O13A 3NPPA 4DR7L 2B8GA 2CH4A 2KHJA 2F0DA 3HG9A 3K5MA 4A93H 2Z6KA 1L1OC 2IL8A 2E2HB 1B9NA 5LL6S 2OT2A 4NP5A 4DR1Q 4YWMA 1B1ZA 1PH3A 3A0JA 3K5NA 4BA2I 4C56C 4B9XA 1OXVA 2CW0C 1VF7A 2HIXA 2SEBD 4F87A 2JA6H 1KRTA 2UUAL 3Q0AA 1IBKL 2K05A 3T1HQ 4L5RC 3KLWA 5IYBG 3DMUA 1FL0A 3H91A 5DEHA 2LXKA 3TP7A 1SMYC 1RL2A 1TWHH 1YNNC 3SK8A 1DD2A 3PIPA 1L1OA 1LACA 3S1MH 1KQSA 3OWEB 1I4PA 2H5XA 1X3QA 3D8GA 4DV0L 2QILA 3GTKB 1RDPD 4WJ3M 5CMDA 4JI5Q 4NB3A 5C3EH 1BQQT 1U4RA 1EEID 1BUVT 2FXQA 3L3OC 2MFIA 3Q23A 4LNQA 2JA5H 3CCEA 5M5XH 1Y1WG 1JORA 1JOQA 1PMRA 1B3QA 3NBIA 1C8CA 2R7FA 3NK9A 1AE2A 4UHVA 1SFOB 4DA2A 3R2IA 4FF3A 5KYIA 2NN6I 3J80i 3I4LA 3HOXG 3U9SA 2VNUD 4QIWE 2B8FA 1XTCD 3I91A 2KCCA 3PMFA 1D1KA 4BBRB 1CHPD 3OHXC 4QY7A 1X3EA 3FDTA 3GTOB 1H9MA 2RHSB 3I8ZA 1TIID 4Y7NB 4PG3A 3CP0A 1PH6A 2Z6BA 4X64Q 4KN7C 5CGKA 3KFUA 4X3KA 2PNHA 3TP5A 1SBBB 3D4RA 4BWGB 3VYSA 4KD4A 4C3HG 2ZXOA 5IGBA 3RNUA 4DR3L 1K83B 4JI4L 2K1BA 4IJLA 2WKCA 2WAQE 5C0XI 1Y8OB 5C4JB 1MFSA 4BBSB 1CT1D 5FKAC 3M3YB 2VB2X 1F2ZA 4XYQA 4HMIA 1EYCA 1HHVA 1QUQB 2RF4A 3TRZA 1F2YA 1JJGA 3DXJC 2KHIA 1BBXC 1C7YA 2MO1A 2MO0A 3TS0A 2F4VQ 4HJ8A 4HJ9A 1F9RA 2EJGC 5GAHC 3BVZA 1ET9A 4XT1B 1GXDC 4R1JA 2NVQB 3ERSX 2N78A 4X3UA 1IL8A 3A5UA 2TMPA 5KNCA 3QWNA 4A93B 4RFBA 4LFBL 3NXWA 1M8AA 4XXEA 1J5EQ 3T13A 1W6JA 3OIQA 1HFNA 4A3DG 1S5BD 4EQOA 2E2DC 1QWYA 5LHY1 5IP9H 3TZDA 2B2UC 3DM1A 5IIFA 2JA6B 2KHSA 2K75A 3E9HA 4QF4A 4X62L 1WFQA 4GN5A 2EXDA 3K7UC 4ME3A 1VQGA 2VUMH 1Z7TA 1M90C 1TWHB 2EYMA 1LTRD 4IUPA 1Y1WB 2F3VA 1EYAA 4NXNQ 1YI2A 3PO2G 1DONA 1XXGA 1SYEA 1MIUA 2AMCB 2K14A 4QB4A 2PW5A 4MTNA 2B2UA 4OELB 1ONLA 1EZ8A 3IFDA 1V8QA 1BNZA 2Y0SG 1E2WA 4PV1C 1B4OA 3HZXA 1BCPD 1VQFA 2ZJPA 3W3AA 1LYLA 3AU7A 1X55A 2AWOA 3GO5A 4LF6Q 1ILPA 1BR9A 3UDGA 4A3BH 3C1FA 1X6OA 4JI7Q 3AB9A 4HJAA 4WORA 1TS2A 4IPHA 1Y14B 5TSSA 3LWUA 5DLQE 3KDFA 4AYBE 5DAUA 4HJ5A 2Z8LA 4FP5D 3IRBA 4GLVB 2OTJA 3CQZH 3J7ZC 2CHBD 1L0YB 3KDFB 2PPBC 1YJ9A 3I4MH 4FYDA 4A3BG 5EBCA 5ELOA 2KVMA 1J6QA 1C4QA 1EU4A 2PO4A 3I70A 3R93A 1X3FA 1Y69U 2JP1A 1YEZA 1BO0A 3QB3A 4X3TA 1PDQA 4DXGA 3I4MG 1FGUA 2R7ZG 4LFCQ 2KOLA 1ESFA 2K28A 4OGQC 2IY5B 1ICWA 4Y52H 5C5MA 1BBWA 4QUCA 5FLMG 1NNXA 3HRZC 1Z9FA 4JG2A 4TSSA 4AQYL 2I07B 2NWGA 3JAME 1PTOD 3TEHB 4K14A 1EFWA 2GA4B 2FHTA 3CPFA 5M3MH 4A3DB 1GKHA 5JVH3 1CK1A 2XGTA 4JV5L 2LSSA 1PRTF 2K33A 2OWOA 1ZYRD 3PUZA 3TN2A 1EY9A 2F4VL 5IT9c 3HKSA 4A3IG 1HZCA 1FVIA 2Z4HA 2EOTA 1SYCA 2E8GA 4H13C 2PZWA 4OIJA 2K52A 3D4DA 3A8KE 4DAYA 5M5WB 1TWAH 1LT3D 2E5LL 3PO2B 4DNIA 4DK1A 1DM0B 4ME5A 3PO3G 1BDOA 4YY3Q 1E7ZA 1GUNA 4DAYB 4LF8Q 2VUMB 2EE1A 3PIOA 3WWVA 1N33L 1BCPC 2C9OA 4BXXH 1KNAA 1NJIC 2P5ZX 1QZHA 1CFMA 3CMAA 3H3VH 4DR4Q 4QMGA 2R6GA 3C46A 4QCLA 3ULJA 3HGBA 5IGDA 4KKUA 3CC4A 4IFDI 1GUSA 4WFN3 1B53A 3Q8DA 3I90A 2PYKA 1CM9A 1B70B 2BOSA 1X65A 4ILWA 3Q24A 4DUYQ 2A68D 3H15A 1Y8NB 5KNDA 1KXLA 3QJYA 2YTVA 1GVPA 1STAA 3CAMA 3NE5B 2K4KA 2Z9HA 4A3BB 4DAPA 1FNVA 1Q3LA 1ILQA 4OL7A 1LTID 2PZUA 3I56A 2ICEC 3KBXA 1HFGA 1N32Q 3UDIA 1XMOL 1MGSA 2F52A 4JYAL 2M00A 4J6HA 4KK7A 1EIHA 3CQZB 4IZ8A 1KL9A 5I6YA 1BOSA 5EBDA 3I4MB 4E6IA 3J7YW 2R7ZB 2E74C 1JC7A 2MHVA 1IW7D 1OXUA 1EZ6A 1XYIA 3HOYH 2JJQA 1SE2A 4DUZQ 1PTOC 5IOCA 3EJIA 2DY7A 4DK6C 4DNRB 2X69A 1SLJA 4OO1G 1RODA 1FGBD 1SNCA 3GD7A 2ENBA 5ELEA 5FOBB 5IGEA 3TDQA 4KMUC 1ZYRC 3GTLH 4KN4C 3CCJA 3NTHA 2F3IA 2PZTA 1GUWA 2Q8RE 4X3SA 1K8GA 1WOCA 3R2TA 3G71A 3W1BA 4G7HC 4GN3B 1O7LA 4HIDA 1SYDA 1QG7A 3BVMA 4A3IB 1D2BA 1IL2A 4ALPA 3BDLA 2PCFB 2XN9C 5M3MB 1NE3A 1G8ZD 1G2TA 1TS5A 1TQOA 1WD1A 4ZRZA 1YHQA 3DM3A 4DFAA 2WV6D 5AJ3Q 4LF5Q 2BH2A 4KLKA 1AW7A 3PO3B 3RMHA 2EC7A 1BVSA 4G7OC 3PQIA 4F8MA 4XQNA 4GKKL 4KHVA 3LGJA 4CJ1B 1XNQQ 2JA7H 4LF4Q 3ZJYC 4EQPA 4U673 3KF8A 1TWAB 4A3LH 4OXPA 4G4KA 3DLLA 2N3SA 4DK3C 1JWMD 1HA5A 3J81L 2E75C 5IP7G 1I4XA 4LF9L 5C0XJ 4B3RQ 2A68C 4IUUA 4QJFA 4LUZA 4KHPQ 1KRSA 4JOIC 1M4VA 5KYLA 1KAWA 2KCNA 4MN3A 4PMBA 1CQVA 5CBEE 1EUJA 4YY3L 4DR7Q 4LF8L 2H4OA 2CQFA 1KD1C 1SE4A 5GAGC 4RWSC 1XX8A 2QKIC 3K80C 3ER0A 1BF4A 4OWXB 5E3FA 1K8AC 1XTDA 1STYA 1S5FD 2UUAQ 1ENAA 5GROA 2E2HH 1VQNA 3CF5A 1R9TH 3QR8A 2HHHL 2RDGA 3ICEA 5FO8B 4KJNA 3RZDH 2V1CC 3EIVA 4FO2A 4JOIA 2K03A 5T1GA 1I6HH 1I3QB 3B6YA 3ITPA 2RDFA 3SDZA 4C3IG 4QGUA 2B2VC 1UEBA 2KBNA 4DV0Q 3A74A 2F0NA 1SNMA 2O5JC 2AUKA 2F0MA 4HEDA 4V0BA 2K5WA 3P75A 2NZ1D 3OW7A 1KDAA 1VF5C 2F1MA 4IUTA 3PIO3 1EFID 4WJ4A 1N32L 2D9UA 3PGZA 3HOYB 2WB1G 2J4XA 4CJ2C 3ND8A 3T1YQ 1VQPA 5FO7B 2CQAA 3HKZE 4WRDA 2OCEA 2CW0D 1LO5D 4UY8C 2RDHA 3UI2A 2ZJQA 1SAPA 1PFSA 3MVVA 3UDFA 3GTLB 1FD7D 1V1OA 4IPGA 3EROA 3IAYA 4DUZL 1LTGD 1P16A 2J0TD 5IE8A 2PW7A 1HZAA 1SMYD 1Q3ZA 1QNUA 4CBVA 1YNND 1Y1VG 1EIYB 3A54A 2EYLA 2L1BA 4CHTB 4OX9L 4KKTA 4L6TB 1GM5A 5EKKA 5FO9B 3OMCA 4RH6A 4X66L 2NBFA 5IYDH 2KEEA 4IUVA 4B3ML 4J1MA 3WDNA 4P72A 2HD3A 5M5YB 2F0KA 1CKNB 1STGA 4NDXA 3T56B 4DU9A 2EYFA 3QIAA 3SK4A 1O80A 4GOPB 1MI2A 3CMEA 2JYOA 1P8LA 2OEOA 4DR3Q 3U58A 3CCSA 4YCVA 4CKCA 2F0FA 4DV7L 3VYUA 2VZAA 4HMJA 1CUKA 5D14A 2UXCL 1RD9D 3W2DA 5AJ3L 3PV0A 1AEXA 2G9HD 1RJTA 1WCMH 4IPCA 2MPMA 5CV9A 4JCVE 1ASYA 4FF2A 5C4JH 1XNQL 4LF4L 3CCVA 1LUZA 3MXNA 3CKIB 1SDFA 2C5CA 2F0HA 2L9HA 1LV9A 1WCMG 1K9MC 1MHWC 4LFBQ 4A3CG 1KDCA 1IYJB 2KCTA 3V2TA 3D31A 3GTPH 5GAEC 2NZOA 4HCSA 3M7NA 1TS4A 4A3EG 5JAVA 1KNEA 1RTOA 4H7BA 1F9SA 4J8QA 4KHPL 3N52A 5GQOA 1CZGA 4P75A 3CHBD 5C6AA 5KGUA 4C3IB 1PXUA 1UUPA 3NWSA 2XWJB 4X62Q 5IYBH 1E2ZA 1R9TB 1T5EA 2F0WA 3RZDB 1I6HB 4POFA 4ABNA 1HCZA 4ZKCB 2IPKD 2A8VA 3N6RA 3VA7A 1RTNA 2N88A 3X3MA 1FNWA 5EPKA 1EYGA 1WI5A 3FMCA 3RLFA 3K7AH 2WB1B 3GTGH 4KJOA 1MD2D 3M4YA 2Q8TA 4JVZA 5DNFA 4RGMA 4ZKBB 4MIUA 3DWAA 1SNDA 2Q2UA 3VDYA 1H9RA 2XRQD 3FKIG 2HCIA 1H95A 4ZUIA 3E3XA 5KRUA 1Y1WH 1GHKA 3SVMA 5LMNL 3J7AF 1Y1VB 5I4DA 5LMUQ 2L4LA 1O7ZA 2E76C 4JI3L 1L1OB 1CHQD 1A3VA 1MBYA 4RAUC 1ET6A 2WACA 4JW0A 3VR6A 3HOXH 1QVCA 4BY1H 4R8NA 1O7IA 2QCPX 4BS9A 3T1YL 3E6ZX 4XYOA 5JEAH 3CCMA 4NXML 4IFDJ 2MJ8A 1S4ZA 1B7YB 3KUPA 2JZWA 2QDLA 1PH8A 1EY5A 4DXFA 1EQTA 1JICA 4L5TA 4DN4M 3J81i 5CC4A 1VQLA 3M4OH 1AN8A 3A7AB 4BY1G 1Q12A 2WP8J 1IZ6A 5JEAG 4HTHA 4AH6A 2DJFC 3TP8A 4C3HH 2QW7A 1B50A 3J7A5 1X9NA 3CCRA 1Z6HA 2A6HD 5F2DA 4RGTA 3RLOA 4LAAA 1WCMB 2Q2IA 4LJZC 1G6ZA 2B39A 1Q1BA 4R4TA 2SNSA 2AKWB 1YNJC 4AQYQ 2XIWA 5EAYA 4MNOA 5LL6X 5FLXc 1QVFA 4A3EB 2KUMA 3MXGA 5D65A 4JV5Q 2EPBA 4K8IA 3P20A 2EZVA 1Q1EA 2CKZB 4JPBW 2RHQB 4HR7B 2X6GA 2DNEA 3GTPB 1K0SA 1X54A 2L11A 1XNRL 1SXTA 3J80c 1MSHA 4A3DH 3D0FA 1SE3A 4NKLA 4XIGS 3MHBA 1SR3A 4B9WA 2Z0SA 2O2LD 2E5LQ 1NR4A 2UU9Q 1PRTC 4HSPA 2YTYA 1HXYD 4RG1A 4POGA 3HOVG 1L2FA 3FKIB 4IALA 4KTAA 1N33Q 3K7AB 2LMCB 1EU3A 2G5DA 5CV4A 2D5DA 3GTGB 3SHLA 5C4XG 5M5WH 3PO2H 1EQRA 1HA6A 3STBD 4UAIA 1QB5D 2R7DA 3TZUA 4DAMA 2XVSA 2OTLA 1VMCA 2F0VA 4MTKA 2A73B 5IY0A 1YNXA 1U4LA 3U4VA 4C2MB 4C3JG 2PQEA 2VL6A 3UE0A 1BJ6A 4LMQD 1ENCA 3VR5A 1HNWL 4OWTB 2AHOB 2OXPA 1I94Q 3HOXB 2J7ZA 1JOKA 1PHJA 4M8AA 4BY1B 1E0BA 2AQ3B 1AFPA 5LMUL 2I5MX 3L2PA 2HT1A 3QOLA 1XMOQ 4JYAQ 2A6HC 3SXHA 1LLRD 2BA0A 3M4OB 1ZEQX 4EQNA 1X56A 1PVOA 4A3KH 3K0YA 4K8JA 3HEJA 5KEEA 1UNSA 1U9RA 2PQAA 5JVG3 2ZM6L 1A2TA 1ENFA 3OOCA 1PFMA 4Q0FA 2AQ2B 2D0OA 4C3HB 5IYCG 3F8TA 3GQBA 3RLNA 3U50C 1JE5A 1NY4A 2F3WA 4A3KG 2R7ZH 1NMGA 3G4SA 1EYDA 2QGQA 2BE5D 2CWPA 1GD7A 2NVYH 3PIP3 1HNZL 1HH2P 3C1EA 4QL5A 1I4GA 5FLMH 3BS1A 1XPRA 1W2BA 4P74A 4GNXC 1DOMA 1TS3A 1LT5D 2EQSA 3JAML 2YTXA 2CVRA 4A76A 1HTLD 4NPSA 2JA8H 3NENA 1QJOA 5ELNA 5IODA 2Q2TA 3KLSX 3HOZG 5I9PA 4OONA 5D3IB 4A3IH 1TXYA 1U0LA 2F0QA 3HOVB 1C9OA 1EWHA 2VB3X 4GKKQ 2RSOA 3AEVA 3STBC 2VXWA 2PNRC 4GNXA 2I5HA 2JA8G 3CRLC 1PTOH 3BYTB 3NBHA 1STHA 3J7AV 4JBJA 4CDDC 3AQQA 4GLXA 3PO3H 2EYOA 1NBWA 1SRUA 2BA1A 1PFNA 1R4QB 3KLRA 1A62A 4LF9Q 3F1ZA 2TSSA 4K6LA 5KNBA 4OIKA 4C3JB 5CV8A 2QEXA 4TQUS 2NTSA 2UU9L 1HJPA 2EVBA 3SGIA 4K0KL 1PZID 1YHBA 3NUCA 4F7XA 1STNA 3GP7A 4R9WA 3BZDB 2A19A 1K8MA 2QDBA 2Y0SB 1U4PA 1RKNA 2H1EA 3CPWA 3EVQA 3A8JE 3V96A 2HDLA 4I7AA 1LABA 2IHXA 2F0LA 1OTCA 3U9OA 2HHHQ 3PF4A 2YV5A 2V4DA 1TY0A 2QA4A 4C1NI 2XWBB 5CORA 2LS01 1ICFB 5JJIA 3JC66 1I94L 2BE5C 4U68A 3NHHA 1WD0A 4GKJL 3BU2A 5M3FH 4A3KB 1HUMA 1O7YA 5G3LD 1BCPB 1NCVA 3S2HH 1I3QH 3BZKA 2M9VA 3TREA 3DWPA 5CYUA 2L0CA 4LW1A 2RQXA 2JEBI 1SJED 1F6UA 2DN8A 4L8JA 3J81j 1SEBD 5M3FG 2IX0A 3S16B 4DV3L 4P2CB 4OO1H 3KK7A 1WTQA 3K0XA 1EQQA 3BDCA 1EWCA 4O2DA 1CTMA 5ELDA 1GHJA 3C2PA 1QOHA 3MEFA 2NVYB 2UXBL 4OEMB 4A4IA 2NB0A 3HOZB 1ZXTA 3VR4A 1OXSC 1PZJD 2HQEA 4KHZA 1VQ7A 1DOLA 1F9PA 4OX9Q 5C44G 1IXRA 1BKBA 4X66Q 5K5PA 4B3MQ 2JA8B 2NVXH 4HIKA 3K59A 1CSQA 1TR5A 2WFWA 2IWHA 1PV4A 1KC8C 4AIMA 1KIXA 4LWCA 2OQKA 4A3MG 3CU7A 3OWFA 4DV7Q 4MZ9A 4CGYB 1YVCA 3E9IA 4DV1L 2O5IC 2UXCQ 1EY4A 2BH8A 3SK6A 3QO2A 1PTOB 5M5YH 3T51B 3S24A 2JQOA 4RGNA 1D1IA 1I4QA 1A2UA 2QEJC 1WVLA 2R93H 5IP7H 1HUNA 3SE0A 4DK0A 1WJJA 4DV5Q 4CDCC 3MZ5A 1HPCA 1N36Q 4RKBA 1UAPA 2ZXPA 3ZYYX 2ATWA 1XMQL 3IL8A 1K8OA 2IT1A 4FXKC 1SN8A 3R8BA 2R93G 3KF8B 4LF7L 1STBA 2F0JA 4K2LA 4DV2L 1NAPA 4B3TL 2F0IA 2B3GA 1HZBA 1Q90A 4PQXA 2Q8IB 1YITA 1VQOA 1CKOA 3E0JA 3R3OA 2F0EA 5FLXE 3TBIB 3BVGA 2I46A 3FPUB 2EJMA 4O0AA 4ZAIA 1BCPF 2CCZA 1EL0A 1RHPA 2K5DA 4I7ZC 1PH4A 1TVXA 3BYYB 1UWVA 5LMNW 4JC0A 4A3FG 4IOAA 4CDEC 1LT6D 3K5OA 1JCKB 3GV6A 4C3IH 1IBLL 4DR2L 1HNXQ 4EX5A 5M3FB 3I73A 3J80E 1EEFD 2SDFA 3PSIA 3VA5A 1A15A 4B3SL 4JI6Q 4OWWB 3S2HB 3JAMi 1T5XD 2EXFA 1I50B 5CR3A 4L5SA 3PUVA 3FHWA 5LMNQ 1SYGA 5FJ8G 2NVTH 4JI3Q 1W3SA 1UE7A 4IN3A 3H3VI 5C3XA 1GJXA 1G91A 5C44B 1SSOA 3VYTA 1PZKD 3MFGA 2NUCA 1TY2A 3RN5A 2A74C 3OTOL 4NXMQ 1EY7A 1Y1VH 3EFXD 2NN6H 1K28A 4IQZA 1OXTA 3I55A 1QNKA 2FJ2A 4A3MB 1DGSA 1LTSD 4H02A 2LXJA 4A3GH 2B2VA 3G6JB 4KV6A 3T4AC 3GTQH 1KABA 1PTOF 2A69D 5ELBA 2DJGC 1VQIA 3PUXA 3AFQA 2NVXB 2NN6G 2PI2E 1Q7YC 1DYQA 1MSGA 3G6EA 1AZPA 4HCEA 1ML0D 5ISRA 3MWYW 4A3GG 1ESKA 1B9MA 2CFMA 1AZQA 2FMMA 4OO1I 1B3AA 5ELCA 4N9TA 4HSVA 5NUCA 2EY5A 1BXTA 3U4ZA 2N8NA 2AUJD 5HURA 2R93B 1PFBA 1MJCA 2BDNA 2Z1CA 2ZXRA 5IWAQ 1SE8A 3FEWX 1PH1A 3M4PA 4G57A 2VS1A 2F0TA 3OW2A 3DUZA 5JJZA 5COYA 3PUYA 1ESRA 5C0XG 3NQTA 1QE6A 2UXDL 1KAAA 1VQEA 2WKDA 4RCOA 4A3CH 1HQMC 1STEA 4K5XA 3S1RH 2A1AA 3TMEA 3RUZA 1JWUD 2XTIA 2HUGA 4DV5L 2OQ0A 4A3EH 5C4HA 1WTRA 4H0LC 1N36L 1PH5A 1TWCH 3K5LA 1XNRQ 1II3A 1O78A 4BBRG 5CV5A 3KJPA 4PZ7A 4R4CA 4DV6L 4K5VA 3MXNB 4PNYA 4DR6Q 2HQLA 3CD6A 3HFZB 5E7NA 3M7GA 4UP9A 1OXXK 1VDZA 1UE6A 4YWKA 5C3WA 1XPUA 1NR2A 4RA8A 2I0QA 1YNJD 1H9JA 1E24A 1EWIA 1Q46A 4XTCS 1EIFA 2Z6KC 2RCNA 3HOUG 1TT2A 2WB1E 1MJEA 2F0PA 1WTOA 1J8IA 2L4NA 3S1QB 4I65A 1PLFA 3K6OA 3W1GA 4ZK9B 1ASZA 1E1OA 3H6MA 2G9DA 4FF1A 4BBSG 4JBMA 3FKIH 1TWFH 4GS3A 4JI2L 5IT9E 3H0GG 2X6LA 2ES2A 4TVAB 1HNXL 1D8LA 3V05A 3F2DA 2UUBQ 1UEAB 4DF7A 5I2XA 2NVTB 2WAQG 4IJHA 5HGQA 5IGCA 2AWNA 2A69C 4JI6L 3F2CA 4ZCKA 3NQIA 1HNWQ 1PRTD 1SJHD 5A2QE 4C2MH 2JE6I 1V1QA 2ALYB 4A93G 2KA7A 5I6WA 2DUDA 1S3OA 4YHHL 4UP7A 4A3GB 4LK1C 3S9WA 2DGYA 1G51A 3K81C 3GTQB 1VQ4A 1B8AA 3S1NH 4ULLA 4JI8Q 2ZM6Q 1D5ZC 2JA6G 1HTPA 3FPPA 2VQFL 1VQCA 4H44C 4PMCA 5J1ZA 4DR5Q 4XT3B 2F03A 1HQRD 1LT4D 4YCWA 1N34L 3HS0C 1D5MC 1JQYD 2BCOA 1PH7A 2ZTEA 4ID6A 5E4XA 1SNQA 1U6PA 3KLSA 1I4HA 1HNZQ 4XDXA 3M4QA 4HN7A 2VQEL 2IX1A 2R61A 3MA2B 2E2IB 2UUCL 1A6BB 3NELA 5C3EG 1RCVD 3S17B 2D2CC 5I9OA 5IGFA 2JA5G 4KD3A 3AMUA 3I4NH 3BJUA 3LWEA 5L37A 1E22A 3BZCA 4KY7A 5IWAL 3S1RB 1Q8IA 1WTVA 4L5QA 1DOKA 4QIWB 1L0WA 1KLGD 2HIVA 5JPMC 1TWCB 1CSPA 4PMWA 3S14B 1NSNS 3I4NG 3H94A 2KENA 3HOUB 4IPDA 3CW2C 4DV4Q 1S72A 4ZQ3A 1JR0D 1K0RA 2F0UA 1IBML 1FJGQ 3S2DH 1QUQA 4P71A 3G7LA 2EDGA 3ULLA 5CV7A 3GTJH 3HOVH 1K3RA 3J81c 3NEMA 4TRDA 3D6WA 3LX0A 3KYHC 3A7LA 4QQBX 1KLUD 3VYRA 4AYBG 4RHRA 3H0GB 1Q86C 4PZ8A 2E2JH 4MHEA 5C4XH 4DR6L 1Z47A 4G7ZC 1EY0A 3D3RA 4B08A 4KY5A 1Q81C 1VQMA 2R3ZA 4APVA 2WAQB 1VQ8A 4K0KQ 5FK9C 2WIIB 1M1KC 3S15H 3CC2A 2GN5A 5HY6A 4LFAQ 1AAFA 1TWFB 3M9BA 1CA5A 4Z9CB 1V1PA 4C3JH 1CZWA 3I3CA 3MXUA 1VQJA 1WYDA 5E1FA 3K58A 3RD4A 2AQ1B 1CA6A 4IFDH 2Q2HA 1V1PB 1RF2D 1NUCA 1T9HA 2F4IA 3IKJA 2BDOA 2MP1A 1X3GA 4CJ0B 4EVOA 5EQ0A 3NTKA 2ICIA 4ODGA 2UUBL 2B63H 3MXPA 5CV6A 5EPJA 4IFDG 1PRTB 3M85A 4R4OA 4DR1L 1F2MA 4GKJQ 3RN2A 2YYZA 3AFPA 1PYWD 3S1NB 2I5LX 5IP9G 1Q8KA 3K57A 2B63G 3S1MB 3EA6A 3DWQA 1VS0A 3CRKC 2RKSA 2QF7A 5IYCH 3T1HL 4YCUA 4OHJA 2JK8A 1WTWA 3NTIA 4DV3Q 2VUMG 2PMZE 1NTGA 1IYVA 5C3EB 3MTSA 4KKSA 3GV3A 2EJFC 4JI8L 3CXCA 1KHIA 5AFWA 4DR5L 2JA5B 5M5XB 3OYYA 2K5HA 2UXBQ 4P73A 1A3TA 1TWGH 2PQAB 2PMZB 3S16H 2EY2A 4JI5L 1WTPA 1AH9A 3A55A 3MEHA 3I4NB 1XJVA 3QOJA 1VQAA 4DKAC 2A5HA 2JN4A 4R4IA 2L12A 3RZOH 2K5NA 3HOZH 1PH9A 3T53B 3DEPA 3OSOA 1N9WA 1PH2A 2ASBA 3CC7A 4TKOB 1R4PB 2XRSD 1W6KA 5A35A 1JJ2A 2IHEA 1JE4A 4FF4A 4AYBB 1QILA 1AE3A 2XNAC 4DV1Q 4RHSA 4A3JH 2WINB 1C48A 3KF6A 3A56A 5IGGA 3S2DB 1GOZA 1IKLA 1VQKA 3NP8A 3L0OA 2Z4IA 3F2UA 4ZYSA 3GTJB 4FVMA 2SNMA 2RBMA 4X64L 4RMFA 2RA4A 2KEDA 3KF6B 1K73C 1S5ED 1V9PA 3FVQA 4DAVA 2K5QA 4DV4L 2E2JB 5JPNC 4A3JG 5C4XB 2M3ZA 5ELFA 1J9OA 1FJGL 3HOWH 1TKWB 2B29A 2IX3A 1XMQQ 1LM0A 1WWEA 4GNXB 2ZJRA 3S15B 2B2TC 3NBHB 4LF7Q 4DV2Q 3GTMH 4B3TQ 4JI1Q 2L5TA 5C4ZA 1L0XB 2Y0SE 1DCZA 5BN4A 2GVBA 3TS2A 4XQQA 2L55A 4S3SA 3HOWG 3RR5A 1YJNA 2MGSA 4CKBA 2L15A 2MNAA 3CCLA 3OMGA 4JI0Q 4HIMA 2B2WC 2K01A 4LFAL 1SROA 4JBKA 2NTTA 5EGTA 5E4WC 4ZLTF 5M3MG 3L7ZC 1UE1A 2KCMA 1G2SA 1VQBA 1EIGA 3GDEA 2HCCA 2B63B 1LTAD 3A5ZB 3KOJA 2B2TA 4ZUJA 2ZT9C 2EY1A 4DPGA 4JK1C 2EYHA 2KQ3A 1YBYA 1IBLQ 3I4OA 2SOBA 4X65Q 2OF1A 4DR2Q 2EIFA 3A8IE 2D0PA 5BN5A 2DNCA 2A6ED 4KY6A 4FDBA 1J5EL 2NYZD 4B3SQ 1DZ1A 2VY3A 1VQ5A 2JA9A 3HP3A 1V43A 4BA1I 2B2WA 1A0IA 3DEOA 1JB7A 4EGVA 3TSSA 1U5KA 4R8IA 4BY7H 2IHFA 1Q3YA 1XWEA 2CQOA 4K6DA 5JJKA 5CBAE 1E3PA 4RCNA 3F2BA 4BXXG 1A3UA 1A63A 1YIJA 4NXNL 1BBUA 1I50H 2B2YC 4GN4B 2M2LA 3OTOQ 1TWGB 2FINB 4BY7G 3NWTA 1SYBA 5C5LA 4X6AH 4A75A 1A6XA 3SEBA 3P1HA 1H9KA 5C44H 3SK5A 2C35B 2EY6A 1C0AA 4K5WA 2F0GA 4CDFC 4IO9A 4JBWA 1IHZA 1U4MA 2ID0A 4N9PA 3Q22A 3RZOB 5M9OA 3OIPA 2KECA 2LY7A 2KJXA 4A3MH 2VW9A 1HR0W 4IUQA 4LF6L 3D4WA 3T16A 2K32A 2B2YA 4JI7L 3D6CA 3MAQA 3ERQA 4NMZA 2K50A 3K8AA 1YJWA 2R92H 1A1TA 4A3JB 2IW3A 4V190 2CWAA 3W5OA 1GO3E 2K5VA 3ULPA 1H9SA 2N55A 4N8FA 1CQFA 2LKVA 3I2ZA 4HJ7A 2YSAA 3ND9A 4DGZA 2CH4W 2K04A 1JB3A 2R92G 1NMFA 2YU9H 1JWSD 1H9SB 2EXZA 1B2TA 3EN2A 1VMPA 1WWFA 1A8VA 1HR0Q 3HOYG 4FXGC 4IURA 3HOWB 2MQHA 2UXDQ 1AP0A 4LFCL 1E1TA 2RVLA 4F88A 3GTMB 4K2KA 3E5SA 1Y8PB 1JJCB 3KJOA 5BR8Q 4FXDA 3FP9A 2HDMA 2LI8A 3L9AX 1EOTA 1RIPA 3HKZG 1N8RC 1EQVA 2A6EC 3VR2A 1JOOA 3BDOA 3EQLC 4DV6Q 1Q82C 3H3VC 2IJ0A 5FLXL 4KI0A 2F0OA 4JI1L 3TQYA 4RKLA 4A3FH 1SMXA 3I72A 4HIOA 1ZKOA 1X32A 1OO9B 4JI0L 2ZTCA 3DHQA 3VR3A 1EOVA 1VCIA 4GLAC 3URYA 1FNUA 3J80L 3AYHB 1CKMA 2JA7G 4JI2Q 1FYCA 2K7VA 2ZTDA 4PZ6A 4A3LG 3QG1A 5GADC 3NYBB 1IKMA 4X65L 3J81E 3S1QH 3OPOA 1QZGA 4RGOS 4BY7B 2JXMB 1LTBD 5FJ8H 3PUWA 1GUTA 5T1IA 3C3LA 5J3BA 1LTLA 3WOFA 2DY8A 1WTXA 4O1NA 3FRPB 5K36H 1B44D 1CI3M 1YZ6A 4DR4L 2EYPA 1IW7C 5EPLA 1IBKQ 3PF5A 1SNOA 4UP8A 1QVGA 4YHHQ 1D6EC 1LTTD 1HZ9A 5K36G 1F2LA 1PYBA 3TP6A 1DJRD 2MUYA 1S5DD 4DUYL 3UE1A 2VQFQ 5H1SE 2JEAI 5KIXA 2N49A 1JMCA 5EKIA 3EBEA 4EQ5A 1UE5A 2RCFA 4N8X1 1PYSB 1N34Q 4LUVA 4R4QA 4GZYC 1TU2B 4WJWA 2R92B 1FR3A
chains in the Genus database with same CATH topology
2PQAA 1KL9A 4YCWA 2ZM6L 1N34L 1JT8A 1WWGA 3I7FA 1PH7A 2ZTEA 2D0OA 5IYCG 1G6PA 1OXUA 3F8TA 3RLNA 3U50C 2VQEQ 4GOPC 1U6PA 1JE5A 3GTKH 1NY4A 4A3KG 2R7ZH 3HOYH 2JJQA 4DUZQ 1NMGA 1HNZQ 3G4SA 2UUCQ 2QGQA 3M4QA 2VQEL 4LUOA 2CWPA 4DK6C 2IX1A 3JAMc 1GD7A 4J15A 1SLJA 4OO1G 2NVYH 1HNZL 3GD7A 1HH2P 4QL5A 4UPAA 2UUCL 1A6BB 5FLMH 3NELA 5C3EG 3GTLH 3CCJA 1XPRA 1W2BA 2F3IA 4P74A 4GNXC 2E2IH 2JA5G 3I4NH 1SFOH 3BJUA 1WWDA 2EQSA 1K8GA 1WOCA 1E22A 2YTXA 3BZCA 3G71A 2PI2A 3W1BA 4GN3B 1CKNA 1HR0L 5IWAL 4HIDA 3S17H 2GVAA 4GOPA 1IL2A 4ALPA 4L5QA 4A76A 4BBRH 1VQ9A 4NPSA 2JA8H 3NENA 5ELNA 1L0WA 2Q2TA 3HOZG 2HIVA 4OONA 1NE3A 1CSPA 4PMWA 5JJLA 4A3IH 1TXYA 1YHQA 1IBMQ 3I4NG 1XPOA 1U0LA 3DM3A 3GTOH 2KENA 4JI4Q 4IPDA 4Y7NH 5JEAJ 1C9OA 3CW2C 5AJ3Q 5BR8L 4DV4Q 1S72A 4LF5Q 3PCOB 2BH2A 4GKKQ 4IOCA 3AEVA 1K0RA 3STBC 5IYDG 1IBML 4KLKA 1FJGQ 3S2DH 3S14H 1QUQA 4P71A 4GNXA 2EC7A 1BVSA 2I5HA 2JA8G 3ULLA 3GTJH 1S40A 1PA6A 4LF5L 1K3RA 3J81c 3NEMA 3LGJA 3HOVH 4GKKL 1G291 1I5FA 1XNQQ 3KYHC 4QQBX 3CCQA 2JA7H 4AYBG 4LF4Q 2D62A 4JBJA 4GLXA 3AQQA 1YHAA 3ZJYC 1Q86C 3PO3H 1K83H 4PZ8A 1MKHA 1NBWA 2E2JH 5C4XH 4A3LH 1SRUA 4OXPA 4DR6L 3DLLA 1Z47A 2BA1A 3M3YH 4BBSH 4YWLA 2N3SA 1VQDA 2NZHA 4DK3C 1Q81C 1VQMA 1A62A 4APVA 3F1ZA 1VQ8A 4LF9Q 3H0GH 4K0KQ 1M1KC 2QEXA 3S15H 5IP7G 2GN5A 3CC2A 4TQUS 5HY6A 4LFAQ 3UDXA 1AAFA 2UU9L 1HJPA 4LF9L 5C0XJ 3SGIA 4K0KL 3M9BA 1YHBA 4B3RQ 1D7QA 4QJFA 4C3JH 4LUZA 4KHPQ 1KRSA 2A19A 4JOIC 1VQJA 1KAWA 4B3RL 1WYDA 4YY3L 1EUJA 1VQ6A 4DR7Q 4LF8L 3CPWA 3CCUA 3G48A 2NVQH 1KD1C 2Q2HA 1VQHA 2CQFA 5GAGC 1T9HA 3E0EA 3K80C 4DR7L 2KHJA 1X3GA 4A93H 2IHXA 3ER0A 2Z6KA 4OWXB 1L1OC 1OTCA 2UUBL 1K8AC 1XTDA 4DR1Q 2B63H 2HHHQ 3PF4A 4YWMA 1PH3A 2YV5A 2UUAQ 3A0JA 4BA2I 4IFDG 2QA4A 3M85A 4R4OA 5GROA 2E2HH 4DR1L 1VQNA 3CF5A 1R9TH 2HHHL 1OXVA 3ICEA 4GKJQ 2HIXA 3RZDH 2JA6H 2V1CC 3EIVA 4JOIA 1KRTA 2UUAL 1I6HH 3RN2A 2YYZA 1IBKL 5JJIA 3JC66 3AFPA 3T1HQ 4L5RC 2I5LX 3B6YA 1I94L 3KLWA 5IP9G 5IYBG 1Q8KA 2B63G 3BU2A 5M3FH 4GKJL 1FL0A 1VS0A 2LXKA 4QGUA 5IYCH 3S2HH 3T1HL 1RL2A 1UEBA 4YCUA 1TWHH 1I3QH 2KBNA 3BZKA 4DV0Q 3A74A 3TREA 3PIPA 1L1OA 2JK8A 3S1MH 1KQSA 4LW1A 4DV3Q 2VUMG 2H5XA 1NTGA 2PMZE 2JEBI 4DV0L 1F6UA 3J81j 4WJ4A 4JI8L 1N32L 5M3FG 3CXCA 1KHIA 2IX0A 3PGZA 4DR5L 2WB1G 4DV3L 3OYYA 4WJ3M 3K0XA 3T1YQ 1EQQA 1VQPA 4JI5Q 2K5HA 3HKZE 4NB3A 5C3EH 4P73A 2UXBQ 4O2DA 1TWGH 2PQAB 2OCEA 4UY8C 2FXQA 3MEFA 2MFIA 4LNQA 3S16H 2JA5H 3CCEA 5M5XH 1Y1WG 4JI5L 2ZJQA 1PFSA 2UXBL 3UDFA 4A4IA 1AH9A 4IPGA 2R7FA 1OXSC 1AE2A 4DUZL 4KHZA 1P16A 5IE8A 1VQ7A 1XJVA 1HZAA 1VQAA 2NN6I 4DKAC 1PVOA 1Q3ZA 4OX9Q 3J80i 5C44G 3HOXG 1IXRA 1Y1VG 4R4IA 2K5NA 4QIWE 3RZOH 3HOZH 1EIYB 2VNUD 1BKBA 1PH9A 4X66Q 1N9WA 1PH2A 4B3MQ 4OX9L 3CC7A 2ASBA 2NVXH 1GM5A 4QY7A 4HIKA 1CSQA 1X3EA 2WFWA 1PV4A 1KC8C 4X66L 4AIMA 2IHEA 4LWCA 1KIXA 1JJ2A 5IYDH 2OQKA 2RHSB 4A3MG 4B3ML 1AE3A 4P72A 4DV1Q 4PG3A 3CP0A 4A3JH 1PH6A 4X64Q 3KF6A 1CKNB 4DV7Q 4MZ9A 3KFUA 4GOPB 1VQKA 1YVCA 2PNHA 3E9IA 3HOUH 3L0OA 3CMEA 4DV1L 4DR3Q 1P8LA 2UXCQ 3U58A 2BH8A 3CCSA 4X64L 5M5YH 4RMFA 4YCVA 3S24A 2JQOA 4DV7L 3KF6B 2VZAA 3RNUA 1CUKA 1K73C 4DR3L 1V9PA 2UXCL 4JI4L 4IJLA 5AJ3L 4DV4L 2R93H 2WAQE 5C0XI 4A3JG 1MFSA 2M3ZA 3PV0A 5IP7H 1FJGL 3HOWH 1WJJA 2B29A 1WCMH 4DV5Q 1XMQQ 1LM0A 1QUQB 2RF4A 3TRZA 4IPCA 4GNXB 2ZJRA 4JCVE 1N36Q 1ASYA 1JJGA 1WWEA 5C4JH 2KHIA 1XNQL 3NBHB 4LF7Q 1C7YA 2MO1A 4LF4L 1XMQL 2ATWA 3CCVA 4DV2Q 3GTMH 1LUZA 4JI1Q 4B3TQ 2IT1A 1SN8A 2Y0SE 2R93G 2MO0A 2GVBA 3KF8B 3TS0A 2F4VQ 3TS2A 4HJ8A 4LF7L 4HJ9A 3HOWG 4DV2L 3RR5A 4B3TL 1WCMG 1YJNA 1K9MC 2B3GA 5GAHC 2L15A 2MNAA 4LFBQ 1HZBA 4A3CG 3CCLA 4R1JA 1IYJB 4JI0Q 2KCTA 2N78A 3D31A 3ERSX 4HIMA 4LFAL 1YITA 1VQOA 1SROA 3GTPH 5GAEC 3A5UA 2NZOA 4JBKA 1CKOA 4LFBL 3M7NA 4A3EG 5M3MG 3L7ZC 1UE1A 2KCMA 4KHPL 1VQBA 4O0AA 5GQOA 3GDEA 4P75A 2CCZA 3A5ZB 3KOJA 1PH4A 1J5EQ 4DPGA 1UWVA 5LMNW 4A3DG 1IBLQ 1YBYA 4JC0A 4A3FG 4X62Q 3I4OA 4IOAA 4X65Q 5IP9H 5IYBH 4DR2Q 2EIFA 2D0PA 1J5EL 4FDBA 4POFA 4C3IH 2K75A 2A8VA 1IBLL 4B3SQ 3E9HA 4X62L 1WFQA 4GN5A 1EYGA 4DR2L 2VY3A 1WI5A 1HNXQ 1VQ5A 4EX5A 2EXDA 2JA9A 3K7UC 4ME3A 3RLFA 1V43A 3K7AH 4BA1I 3PSIA 3GTGH 1VQGA 2VUMH 4B3SL 4JI6Q 1A0IA 4OWWB 3JAMi 1JB7A 1M90C 1U5KA 4BY7H 2IHFA 2EXFA 1Q3YA 2CQOA 2Q2UA 3VDYA 4NXNQ 5JJKA 1YI2A 1E3PA 3PO2G 4L5SA 3FKIG 1MIUA 2AMCB 2K14A 3FHWA 3PUVA 3F2BA 5LMNQ 4BXXG 5FJ8G 2NVTH 1H95A 1A63A 4JI3Q 1W3SA 1UE7A 1YIJA 4NXNL 1BBUA 4MTNA 3H3VI 1Y1WH 1I50H 4GN4B 3OTOQ 5LMNL 2L4LA 5LMUQ 2Y0SG 4BY7G 4JI3L 1L1OB 4X6AH 4A75A 3RN5A 3OTOL 4NXMQ 5C44H 1VQFA 3HOXH 1QVCA 1Y1VH 2ZJPA 4BY1H 2C35B 1O7IA 1OXTA 1C0AA 3I55A 1LYLA 1DGSA 4JBWA 4IO9A 4H02A 3T1YL 3CCMA 1X55A 4NXML 4IFDJ 2ID0A 2AWOA 2LXJA 1B7YB 3GO5A 4LF6Q 2JZWA 4A3GH 3UDGA 1PH8A 4A3BH 1X6OA 4JI7Q 3GTQH 4L5TA 4HJAA 1VQIA 3PUXA 4A3MH 3AFQA 4IPHA 1Y14B 4AYBE 3J81i 5DLQE 3KDFA 2VW9A 1HR0W 4LF6L 1VQLA 3M4OH 4JI7L 2NN6G 4BY1G 4HJ5A 2K50A 2PI2E 3K8AA 1Q7YC 3IRBA 3G6EA 1Q12A 1YJWA 2R92H 2WP8J 4GLVB 1A1TA 1IZ6A 5JEAG 3CQZH 3J7ZC 2OTJA 3KDFB 1YJ9A 3I4MH 4A3GG 1ESKA 4AH6A 4A3BG 2CWAA 3W5OA 4C3HH 1GO3E 2CFMA 2K5VA 5ELOA 3ULPA 1J6QA 4OO1I 3J7A5 3I2ZA 4HJ7A 1X9NA 2YSAA 3CCRA 1X3FA 1YEZA 2R92G 1NMFA 2YU9H 3U4ZA 2N8NA 3EN2A 1MJCA 1WWFA 1A8VA 1HR0Q 5IWAQ 1FGUA 3I4MG 3HOYG 2R7ZG 4LFCQ 1SE8A 3RLOA 2MQHA 2Q2IA 1PH1A 3M4PA 4R4TA 1Q1BA 2UXDQ 2VS1A 2AKWB 3OW2A 2IY5B 4AQYQ 4LFCL 5EAYA 5FLXc 1E1TA 4MNOA 3PUYA 1QVFA 4Y52H 1BBWA 5C0XG 5FLMG 2UXDL 1VQEA 1Z9FA 1JJCB 4JG2A 3KJOA 4A3CH 5BR8Q 4AQYL 3S1RH 3FP9A 2A1AA 2LI8A 2XTIA 3TEHB 1RIPA 3HKZG 1N8RC 4DV5L 1EFWA 4JV5Q 1Q82C 2OQ0A 3CPFA 4A3EH 4DV6Q 1N36L 5M3MH 1Q1EA 1PH5A 1TWCH 2CKZB 1GKHA 1XNRQ 2RHQB 2XGTA 4KI0A 4JV5L 2LSSA 4BBRG 3KJPA 4PZ7A 4R4CA 1X54A 4JI1L 3TQYA 4DV6L 2OWOA 3PUZA 3MXNB 1XNRL 2F4VL 5IT9c 3HKSA 3J80c 4A3IG 4A3FH 1SMXA 4DR6Q 2HQLA 3CD6A 4A3DH 3HFZB 3D0FA 5E7NA 4HIOA 4UP9A 1HZCA 1OXXK 1FVIA 1UE6A 4XIGS 4YWKA 1SR3A 1XPUA 2Z0SA 2I0QA 4JI0L 2E8GA 2E5LQ 1E24A 2ZTCA 1EWIA 1Q46A 4XTCS 1EIFA 1EOVA 2Z6KC 2UU9Q 1VCIA 2K52A 2RCNA 4GLAC 3HOUG 2YTYA 4POGA 4RG1A 3HOVG 2WB1E 1MJEA 1TWAH 1L2FA 2E5LL 3AYHB 4DNIA 1CKMA 2JA7G 1N33Q 3PO3G 4YY3Q 1E7ZA 4JI2Q 4DAYB 4LF8Q 3W1GA 1ASZA 1E1OA 5C4XG 2ZTDA 4PZ6A 5M5WH 3PIOA 3PO2H 1EQRA 5GADC 4A3LG 4BBSG 3STBD 3WWVA 3NYBB 4X65L 4JBMA 2R7DA 3FKIH 4DAMA 1N33L 1QZGA 2OTLA 1TWFH 4GS3A 4JI2L 3S1QH 5FJ8H 4BXXH 3H0GG 3PUWA 1NJIC 2ES2A 5J3BA 4TVAB 1LTLA 1QZHA 5IY0A 3CMAA 1HNXL 1D8LA 1YNXA 3F2DA 2UUBQ 3H3VH 4DR4Q 2R6GA 3U4VA 2WAQG 4IJHA 5HGQA 3ULJA 2AWNA 4JI6L 3F2CA 1HNWQ 1YZ6A 2VL6A 4DR4L 3UE0A 3CC4A 4IFDI 1BJ6A 4C2MH 2JE6I 3Q8DA 1IBKQ 4OWTB 3PF5A 1HNWL 4UP8A 2AHOB 1QVGA 4YHHQ 1I94Q 1V1QA 1B70B 1PHJA 2ALYB 1X65A 4A93G 1HZ9A 4DUYQ 2DUDA 1S3OA 3H15A 5K36G 1KXLA 1PYBA 4YHHL 2YTVA 1GVPA 4UP7A 5LMUL 3CAMA 2K4KA 2DGYA 2I5MX 3UE1A 4DUYL 1G51A 3K81C 2VQFQ 5H1SE 3L2PA 1VQ4A 2HT1A 2JEAI 1XMOQ 2N49A 1JMCA 4JYAQ 3EBEA 4EQ5A 1B8AA 3I56A 2BA0A 1UE5A 3S1NH 1PYSB 4JI8Q 1N34Q 2ZM6Q 4LUVA 1X56A 3UDIA 4R4QA 2VQFL 4A3KH 1VQCA 4DR5Q 2JA6G 1N32Q 1XMOL 2F52A 4JYAL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQA A;  1KL9 A;  4YCW A;  2ZM6 L;  1N34 L;  1JT8 A;  1WWG A;  3I7F A;  1PH7 A;  2ZTE A;  2D0O A;  5IYC G;  1G6P A;  1OXU A;  3F8T A;  3RLN A;  3U50 C;  2VQE Q;  4GOP C;  1U6P A;  1JE5 A;  3GTK H;  1NY4 A;  4A3K G;  2R7Z H;  3HOY H;  2JJQ A;  4DUZ Q;  1NMG A;  1HNZ Q;  3G4S A;  2UUC Q;  2QGQ A;  3M4Q A;  2VQE L;  4LUO A;  2CWP A;  4DK6 C;  2IX1 A;  3JAM c;  1GD7 A;  4J15 A;  1SLJ A;  4OO1 G;  2NVY H;  1HNZ L;  3GD7 A;  1HH2 P;  4QL5 A;  4UPA A;  2UUC L;  1A6B B;  5FLM H;  3NEL A;  5C3E G;  3GTL H;  3CCJ A;  1XPR A;  1W2B A;  2F3I A;  4P74 A;  4GNX C;  2E2I H;  2JA5 G;  3I4N H;  1SFO H;  3BJU A;  1WWD A;  2EQS A;  1K8G A;  1WOC A;  1E22 A;  2YTX A;  3BZC A;  3G71 A;  2PI2 A;  3W1B A;  4GN3 B;  1CKN A;  1HR0 L;  5IWA L;  4HID A;  3S17 H;  2GVA A;  4GOP A;  1IL2 A;  4ALP A;  4L5Q A;  4A76 A;  4BBR H;  1VQ9 A;  4NPS A;  2JA8 H;  3NEN A;  5ELN A;  1L0W A;  2Q2T A;  3HOZ G;  2HIV A;  4OON A;  1NE3 A;  1CSP A;  4PMW A;  5JJL A;  4A3I H;  1TXY A;  1YHQ A;  1IBM Q;  3I4N G;  1XPO A;  1U0L A;  3DM3 A;  3GTO H;  2KEN A;  4JI4 Q;  4IPD A;  4Y7N H;  5JEA J;  1C9O A;  3CW2 C;  5AJ3 Q;  5BR8 L;  4DV4 Q;  1S72 A;  4LF5 Q;  3PCO B;  2BH2 A;  4GKK Q;  4IOC A;  3AEV A;  1K0R A;  3STB C;  5IYD G;  1IBM L;  4KLK A;  1FJG Q;  3S2D H;  3S14 H;  1QUQ A;  4P71 A;  4GNX A;  2EC7 A;  1BVS A;  2I5H A;  2JA8 G;  3ULL A;  3GTJ H;  1S40 A;  1PA6 A;  4LF5 L;  1K3R A;  3J81 c;  3NEM A;  3LGJ A;  3HOV H;  4GKK L;  1G29 1;  1I5F A;  1XNQ Q;  3KYH C;  4QQB X;  3CCQ A;  2JA7 H;  4AYB G;  4LF4 Q;  2D62 A;  4JBJ A;  4GLX A;  3AQQ A;  1YHA A;  3ZJY C;  1Q86 C;  3PO3 H;  1K83 H;  4PZ8 A;  1MKH A;  1NBW A;  2E2J H;  5C4X H;  4A3L H;  1SRU A;  4OXP A;  4DR6 L;  3DLL A;  1Z47 A;  2BA1 A;  3M3Y H;  4BBS H;  4YWL A;  2N3S A;  1VQD A;  2NZH A;  4DK3 C;  1Q81 C;  1VQM A;  1A62 A;  4APV A;  3F1Z A;  1VQ8 A;  4LF9 Q;  3H0G H;  4K0K Q;  1M1K C;  2QEX A;  3S15 H;  5IP7 G;  2GN5 A;  3CC2 A;  4TQU S;  5HY6 A;  4LFA Q;  3UDX A;  1AAF A;  2UU9 L;  1HJP A;  4LF9 L;  5C0X J;  3SGI A;  4K0K L;  3M9B A;  1YHB A;  4B3R Q;  1D7Q A;  4QJF A;  4C3J H;  4LUZ A;  4KHP Q;  1KRS A;  2A19 A;  4JOI C;  1VQJ A;  1KAW A;  4B3R L;  1WYD A;  4YY3 L;  1EUJ A;  1VQ6 A;  4DR7 Q;  4LF8 L;  3CPW A;  3CCU A;  3G48 A;  2NVQ H;  1KD1 C;  2Q2H A;  1VQH A;  2CQF A;  5GAG C;  1T9H A;  3E0E A;  3K80 C;  4DR7 L;  2KHJ A;  1X3G A;  4A93 H;  2IHX A;  3ER0 A;  2Z6K A;  4OWX B;  1L1O C;  1OTC A;  2UUB L;  1K8A C;  1XTD A;  4DR1 Q;  2B63 H;  2HHH Q;  3PF4 A;  4YWM A;  1PH3 A;  2YV5 A;  2UUA Q;  3A0J A;  4BA2 I;  4IFD G;  2QA4 A;  3M85 A;  4R4O A;  5GRO A;  2E2H H;  4DR1 L;  1VQN A;  3CF5 A;  1R9T H;  2HHH L;  1OXV A;  3ICE A;  4GKJ Q;  2HIX A;  3RZD H;  2JA6 H;  2V1C C;  3EIV A;  4JOI A;  1KRT A;  2UUA L;  1I6H H;  3RN2 A;  2YYZ A;  1IBK L;  5JJI A;  3JC6 6;  3AFP A;  3T1H Q;  4L5R C;  2I5L X;  3B6Y A;  1I94 L;  3KLW A;  5IP9 G;  5IYB G;  1Q8K A;  2B63 G;  3BU2 A;  5M3F H;  4GKJ L;  1FL0 A;  1VS0 A;  2LXK A;  4QGU A;  5IYC H;  3S2H H;  3T1H L;  1RL2 A;  1UEB A;  4YCU A;  1TWH H;  1I3Q H;  2KBN A;  3BZK A;  4DV0 Q;  3A74 A;  3TRE A;  3PIP A;  1L1O A;  2JK8 A;  3S1M H;  1KQS A;  4LW1 A;  4DV3 Q;  2VUM G;  2H5X A;  1NTG A;  2PMZ E;  2JEB I;  4DV0 L;  1F6U A;  3J81 j;  4WJ4 A;  4JI8 L;  1N32 L;  5M3F G;  3CXC A;  1KHI A;  2IX0 A;  3PGZ A;  4DR5 L;  2WB1 G;  4DV3 L;  3OYY A;  4WJ3 M;  3K0X A;  3T1Y Q;  1EQQ A;  1VQP A;  4JI5 Q;  2K5H A;  3HKZ E;  4NB3 A;  5C3E H;  4P73 A;  2UXB Q;  4O2D A;  1TWG H;  2PQA B;  2OCE A;  4UY8 C;  2FXQ A;  3MEF A;  2MFI A;  4LNQ A;  3S16 H;  2JA5 H;  3CCE A;  5M5X H;  1Y1W G;  4JI5 L;  2ZJQ A;  1PFS A;  2UXB L;  3UDF A;  4A4I A;  1AH9 A;  4IPG A;  2R7F A;  1OXS C;  1AE2 A;  4DUZ L;  4KHZ A;  1P16 A;  5IE8 A;  1VQ7 A;  1XJV A;  1HZA A;  1VQA A;  2NN6 I;  4DKA C;  1PVO A;  1Q3Z A;  4OX9 Q;  3J80 i;  5C44 G;  3HOX G;  1IXR A;  1Y1V G;  4R4I A;  2K5N A;  4QIW E;  3RZO H;  3HOZ H;  1EIY B;  2VNU D;  1BKB A;  1PH9 A;  4X66 Q;  1N9W A;  1PH2 A;  4B3M Q;  4OX9 L;  3CC7 A;  2ASB A;  2NVX H;  1GM5 A;  4QY7 A;  4HIK A;  1CSQ A;  1X3E A;  2WFW A;  1PV4 A;  1KC8 C;  4X66 L;  4AIM A;  2IHE A;  4LWC A;  1KIX A;  1JJ2 A;  5IYD H;  2OQK A;  2RHS B;  4A3M G;  4B3M L;  1AE3 A;  4P72 A;  4DV1 Q;  4PG3 A;  3CP0 A;  4A3J H;  1PH6 A;  4X64 Q;  3KF6 A;  1CKN B;  4DV7 Q;  4MZ9 A;  3KFU A;  4GOP B;  1VQK A;  1YVC A;  2PNH A;  3E9I A;  3HOU H;  3L0O A;  3CME A;  4DV1 L;  4DR3 Q;  1P8L A;  2UXC Q;  3U58 A;  2BH8 A;  3CCS A;  4X64 L;  5M5Y H;  4RMF A;  4YCV A;  3S24 A;  2JQO A;  4DV7 L;  3KF6 B;  2VZA A;  3RNU A;  1CUK A;  1K73 C;  4DR3 L;  1V9P A;  2UXC L;  4JI4 L;  4IJL A;  5AJ3 L;  4DV4 L;  2R93 H;  2WAQ E;  5C0X I;  4A3J G;  1MFS A;  2M3Z A;  3PV0 A;  5IP7 H;  1FJG L;  3HOW H;  1WJJ A;  2B29 A;  1WCM H;  4DV5 Q;  1XMQ Q;  1LM0 A;  1QUQ B;  2RF4 A;  3TRZ A;  4IPC A;  4GNX B;  2ZJR A;  4JCV E;  1N36 Q;  1ASY A;  1JJG A;  1WWE A;  5C4J H;  2KHI A;  1XNQ L;  3NBH B;  4LF7 Q;  1C7Y A;  2MO1 A;  4LF4 L;  1XMQ L;  2ATW A;  3CCV A;  4DV2 Q;  3GTM H;  1LUZ A;  4JI1 Q;  4B3T Q;  2IT1 A;  1SN8 A;  2Y0S E;  2R93 G;  2MO0 A;  2GVB A;  3KF8 B;  3TS0 A;  2F4V Q;  3TS2 A;  4HJ8 A;  4LF7 L;  4HJ9 A;  3HOW G;  4DV2 L;  3RR5 A;  4B3T L;  1WCM G;  1YJN A;  1K9M C;  2B3G A;  5GAH C;  2L15 A;  2MNA A;  4LFB Q;  1HZB A;  4A3C G;  3CCL A;  4R1J A;  1IYJ B;  4JI0 Q;  2KCT A;  2N78 A;  3D31 A;  3ERS X;  4HIM A;  4LFA L;  1YIT A;  1VQO A;  1SRO A;  3GTP H;  5GAE C;  3A5U A;  2NZO A;  4JBK A;  1CKO A;  4LFB L;  3M7N A;  4A3E G;  5M3M G;  3L7Z C;  1UE1 A;  2KCM A;  4KHP L;  1VQB A;  4O0A A;  5GQO A;  3GDE A;  4P75 A;  2CCZ A;  3A5Z B;  3KOJ A;  1PH4 A;  1J5E Q;  4DPG A;  1UWV A;  5LMN W;  4A3D G;  1IBL Q;  1YBY A;  4JC0 A;  4A3F G;  4X62 Q;  3I4O A;  4IOA A;  4X65 Q;  5IP9 H;  5IYB H;  4DR2 Q;  2EIF A;  2D0P A;  1J5E L;  4FDB A;  4POF A;  4C3I H;  2K75 A;  2A8V A;  1IBL L;  4B3S Q;  3E9H A;  4X62 L;  1WFQ A;  4GN5 A;  1EYG A;  4DR2 L;  2VY3 A;  1WI5 A;  1HNX Q;  1VQ5 A;  4EX5 A;  2EXD A;  2JA9 A;  3K7U C;  4ME3 A;  3RLF A;  1V43 A;  3K7A H;  4BA1 I;  3PSI A;  3GTG H;  1VQG A;  2VUM H;  4B3S L;  4JI6 Q;  1A0I A;  4OWW B;  3JAM i;  1JB7 A;  1M90 C;  1U5K A;  4BY7 H;  2IHF A;  2EXF A;  1Q3Y A;  2CQO A;  2Q2U A;  3VDY A;  4NXN Q;  5JJK A;  1YI2 A;  1E3P A;  3PO2 G;  4L5S A;  3FKI G;  1MIU A;  2AMC B;  2K14 A;  3FHW A;  3PUV A;  3F2B A;  5LMN Q;  4BXX G;  5FJ8 G;  2NVT H;  1H95 A;  1A63 A;  4JI3 Q;  1W3S A;  1UE7 A;  1YIJ A;  4NXN L;  1BBU A;  4MTN A;  3H3V I;  1Y1W H;  1I50 H;  4GN4 B;  3OTO Q;  5LMN L;  2L4L A;  5LMU Q;  2Y0S G;  4BY7 G;  4JI3 L;  1L1O B;  4X6A H;  4A75 A;  3RN5 A;  3OTO L;  4NXM Q;  5C44 H;  1VQF A;  3HOX H;  1QVC A;  1Y1V H;  2ZJP A;  4BY1 H;  2C35 B;  1O7I A;  1OXT A;  1C0A A;  3I55 A;  1LYL A;  1DGS A;  4JBW A;  4IO9 A;  4H02 A;  3T1Y L;  3CCM A;  1X55 A;  4NXM L;  4IFD J;  2ID0 A;  2AWO A;  2LXJ A;  1B7Y B;  3GO5 A;  4LF6 Q;  2JZW A;  4A3G H;  3UDG A;  1PH8 A;  4A3B H;  1X6O A;  4JI7 Q;  3GTQ H;  4L5T A;  4HJA A;  1VQI A;  3PUX A;  4A3M H;  3AFQ A;  4IPH A;  1Y14 B;  4AYB E;  3J81 i;  5DLQ E;  3KDF A;  2VW9 A;  1HR0 W;  4LF6 L;  1VQL A;  3M4O H;  4JI7 L;  2NN6 G;  4BY1 G;  4HJ5 A;  2K50 A;  2PI2 E;  3K8A A;  1Q7Y C;  3IRB A;  3G6E A;  1Q12 A;  1YJW A;  2R92 H;  2WP8 J;  4GLV B;  1A1T A;  1IZ6 A;  5JEA G;  3CQZ H;  3J7Z C;  2OTJ A;  3KDF B;  1YJ9 A;  3I4M H;  4A3G G;  1ESK A;  4AH6 A;  4A3B G;  2CWA A;  3W5O A;  4C3H H;  1GO3 E;  2CFM A;  2K5V A;  5ELO A;  3ULP A;  1J6Q A;  4OO1 I;  3J7A 5;  3I2Z A;  4HJ7 A;  1X9N A;  2YSA A;  3CCR A;  1X3F A;  1YEZ A;  2R92 G;  1NMF A;  2YU9 H;  3U4Z A;  2N8N A;  3EN2 A;  1MJC A;  1WWF A;  1A8V A;  1HR0 Q;  5IWA Q;  1FGU A;  3I4M G;  3HOY G;  2R7Z G;  4LFC Q;  1SE8 A;  3RLO A;  2MQH A;  2Q2I A;  1PH1 A;  3M4P A;  4R4T A;  1Q1B A;  2UXD Q;  2VS1 A;  2AKW B;  3OW2 A;  2IY5 B;  4AQY Q;  4LFC L;  5EAY A;  5FLX c;  1E1T A;  4MNO A;  3PUY A;  1QVF A;  4Y52 H;  1BBW A;  5C0X G;  5FLM G;  2UXD L;  1VQE A;  1Z9F A;  1JJC B;  4JG2 A;  3KJO A;  4A3C H;  5BR8 Q;  4AQY L;  3S1R H;  3FP9 A;  2A1A A;  2LI8 A;  2XTI A;  3TEH B;  1RIP A;  3HKZ G;  1N8R C;  4DV5 L;  1EFW A;  4JV5 Q;  1Q82 C;  2OQ0 A;  3CPF A;  4A3E H;  4DV6 Q;  1N36 L;  5M3M H;  1Q1E A;  1PH5 A;  1TWC H;  2CKZ B;  1GKH A;  1XNR Q;  2RHQ B;  2XGT A;  4KI0 A;  4JV5 L;  2LSS A;  4BBR G;  3KJP A;  4PZ7 A;  4R4C A;  1X54 A;  4JI1 L;  3TQY A;  4DV6 L;  2OWO A;  3PUZ A;  3MXN B;  1XNR L;  2F4V L;  5IT9 c;  3HKS A;  3J80 c;  4A3I G;  4A3F H;  1SMX A;  4DR6 Q;  2HQL A;  3CD6 A;  4A3D H;  3HFZ B;  3D0F A;  5E7N A;  4HIO A;  4UP9 A;  1HZC A;  1OXX K;  1FVI A;  1UE6 A;  4XIG S;  4YWK A;  1SR3 A;  1XPU A;  2Z0S A;  2I0Q A;  4JI0 L;  2E8G A;  2E5L Q;  1E24 A;  2ZTC A;  1EWI A;  1Q46 A;  4XTC S;  1EIF A;  1EOV A;  2Z6K C;  2UU9 Q;  1VCI A;  2K52 A;  2RCN A;  4GLA C;  3HOU G;  2YTY A;  4POG A;  4RG1 A;  3HOV G;  2WB1 E;  1MJE A;  1TWA H;  1L2F A;  2E5L L;  3AYH B;  4DNI A;  1CKM A;  2JA7 G;  1N33 Q;  3PO3 G;  4YY3 Q;  1E7Z A;  4JI2 Q;  4DAY B;  4LF8 Q;  3W1G A;  1ASZ A;  1E1O A;  5C4X G;  2ZTD A;  4PZ6 A;  5M5W H;  3PIO A;  3PO2 H;  1EQR A;  5GAD C;  4A3L G;  4BBS G;  3STB D;  3WWV A;  3NYB B;  4X65 L;  4JBM A;  2R7D A;  3FKI H;  4DAM A;  1N33 L;  1QZG A;  2OTL A;  1TWF H;  4GS3 A;  4JI2 L;  3S1Q H;  5FJ8 H;  4BXX H;  3H0G G;  3PUW A;  1NJI C;  2ES2 A;  5J3B A;  4TVA B;  1LTL A;  1QZH A;  5IY0 A;  3CMA A;  1HNX L;  1D8L A;  1YNX A;  3F2D A;  2UUB Q;  3H3V H;  4DR4 Q;  2R6G A;  3U4V A;  2WAQ G;  4IJH A;  5HGQ A;  3ULJ A;  2AWN A;  4JI6 L;  3F2C A;  1HNW Q;  1YZ6 A;  2VL6 A;  4DR4 L;  3UE0 A;  3CC4 A;  4IFD I;  1BJ6 A;  4C2M H;  2JE6 I;  3Q8D A;  1IBK Q;  4OWT B;  3PF5 A;  1HNW L;  4UP8 A;  2AHO B;  1QVG A;  4YHH Q;  1I94 Q;  1V1Q A;  1B70 B;  1PHJ A;  2ALY B;  1X65 A;  4A93 G;  1HZ9 A;  4DUY Q;  2DUD A;  1S3O A;  3H15 A;  5K36 G;  1KXL A;  1PYB A;  4YHH L;  2YTV A;  1GVP A;  4UP7 A;  5LMU L;  3CAM A;  2K4K A;  2DGY A;  2I5M X;  3UE1 A;  4DUY L;  1G51 A;  3K81 C;  2VQF Q;  5H1S E;  3L2P A;  1VQ4 A;  2HT1 A;  2JEA I;  1XMO Q;  2N49 A;  1JMC A;  4JYA Q;  3EBE A;  4EQ5 A;  1B8A A;  3I56 A;  2BA0 A;  1UE5 A;  3S1N H;  1PYS B;  4JI8 Q;  1N34 Q;  2ZM6 Q;  4LUV A;  1X56 A;  3UDI A;  4R4Q A;  2VQF L;  4A3K H;  1VQC A;  4DR5 Q;  2JA6 G;  1N32 Q;  1XMO L;  2F52 A;  4JYA L; 
#chains in the Genus database with same CATH topology
 1SYF A;  2FFK B;  1EY8 A;  1JT8 A;  1WWG A;  1E2V A;  3I7F A;  1IYU A;  1G6P A;  2VQE Q;  4GOP C;  3GTK H;  4L63 B;  5EKL A;  2UUC Q;  2YU9 B;  4LUO A;  1EY6 A;  4FNF A;  1I6V C;  3NSW A;  3JAM c;  3MFY A;  5I2Y A;  4J15 A;  5JOB A;  5J22 A;  3HKZ B;  4UPA A;  5C0X H;  1I4R A;  1HRJ A;  4UDU C;  4M1U B;  3X3N A;  2E2I H;  1SFO H;  3Q6S A;  4Q5V A;  1DXM A;  1WWD A;  5DM7 3;  2PI2 A;  1CKN A;  1HR0 L;  5DM6 3;  3LNN A;  2K6A A;  3S17 H;  2GVA A;  4GOP A;  4BBR H;  4DNT B;  1VQ9 A;  2RSN A;  3WOE A;  4XQJ A;  1WTH A;  2LFN A;  4IUN A;  1D5X C;  4HAE A;  5JJL A;  3IFT A;  1X3P A;  4QUF A;  1IBM Q;  1XPO A;  3GTO H;  4JI4 Q;  4Y7N H;  5JEA J;  3H09 A;  2O4X A;  5D3D A;  5BR8 L;  3PCO B;  1K3B C;  1KTK A;  4IOC A;  4A3F B;  5IYD G;  2JA7 B;  3S14 H;  3HOU H;  1S40 A;  4LF5 L;  1PA6 A;  1G29 1;  1I5F A;  1S5C D;  3P7J A;  5J39 A;  3CCQ A;  2D62 A;  1YHA A;  1K83 H;  2FMC A;  1MKH A;  5EJW A;  3ONA B;  4BBS H;  3M3Y H;  4YWL A;  3SR1 A;  2NZH A;  1VQD A;  1F77 A;  3H0G H;  4C1N K;  4CKE A;  2XSC A;  5G3L F;  5IT9 L;  5HGT A;  1QCB D;  3UDX A;  3KBG A;  2EYJ A;  4O42 A;  1F9Q A;  1D7Q A;  3BG3 A;  1GUO A;  4YIJ A;  3MC0 B;  5BN3 A;  4NW2 A;  4B3R L;  1VQ6 A;  1GUG A;  3CCU A;  2F0S A;  3G48 A;  2NVQ H;  1VQH A;  5A2Q L;  2JSO A;  1SNP A;  3E0E A;  1KDB A;  3O13 A;  3NPP A;  4DR7 L;  2B8G A;  2CH4 A;  2KHJ A;  2F0D A;  3HG9 A;  3K5M A;  4A93 H;  2Z6K A;  1L1O C;  2IL8 A;  2E2H B;  1B9N A;  5LL6 S;  2OT2 A;  4NP5 A;  4DR1 Q;  4YWM A;  1B1Z A;  1PH3 A;  3A0J A;  3K5N A;  4BA2 I;  4C56 C;  4B9X A;  1OXV A;  2CW0 C;  1VF7 A;  2HIX A;  2SEB D;  4F87 A;  2JA6 H;  1KRT A;  2UUA L;  3Q0A A;  1IBK L;  2K05 A;  3T1H Q;  4L5R C;  3KLW A;  5IYB G;  3DMU A;  1FL0 A;  3H91 A;  5DEH A;  2LXK A;  3TP7 A;  1SMY C;  1RL2 A;  1TWH H;  1YNN C;  3SK8 A;  1DD2 A;  3PIP A;  1L1O A;  1LAC A;  3S1M H;  1KQS A;  3OWE B;  1I4P A;  2H5X A;  1X3Q A;  3D8G A;  4DV0 L;  2QIL A;  3GTK B;  1RDP D;  4WJ3 M;  5CMD A;  4JI5 Q;  4NB3 A;  5C3E H;  1BQQ T;  1U4R A;  1EEI D;  1BUV T;  2FXQ A;  3L3O C;  2MFI A;  3Q23 A;  4LNQ A;  2JA5 H;  3CCE A;  5M5X H;  1Y1W G;  1JOR A;  1JOQ A;  1PMR A;  1B3Q A;  3NBI A;  1C8C A;  2R7F A;  3NK9 A;  1AE2 A;  4UHV A;  1SFO B;  4DA2 A;  3R2I A;  4FF3 A;  5KYI A;  2NN6 I;  3J80 i;  3I4L A;  3HOX G;  3U9S A;  2VNU D;  4QIW E;  2B8F A;  1XTC D;  3I91 A;  2KCC A;  3PMF A;  1D1K A;  4BBR B;  1CHP D;  3OHX C;  4QY7 A;  1X3E A;  3FDT A;  3GTO B;  1H9M A;  2RHS B;  3I8Z A;  1TII D;  4Y7N B;  4PG3 A;  3CP0 A;  1PH6 A;  2Z6B A;  4X64 Q;  4KN7 C;  5CGK A;  3KFU A;  4X3K A;  2PNH A;  3TP5 A;  1SBB B;  3D4R A;  4BWG B;  3VYS A;  4KD4 A;  4C3H G;  2ZXO A;  5IGB A;  3RNU A;  4DR3 L;  1K83 B;  4JI4 L;  2K1B A;  4IJL A;  2WKC A;  2WAQ E;  5C0X I;  1Y8O B;  5C4J B;  1MFS A;  4BBS B;  1CT1 D;  5FKA C;  3M3Y B;  2VB2 X;  1F2Z A;  4XYQ A;  4HMI A;  1EYC A;  1HHV A;  1QUQ B;  2RF4 A;  3TRZ A;  1F2Y A;  1JJG A;  3DXJ C;  2KHI A;  1BBX C;  1C7Y A;  2MO1 A;  2MO0 A;  3TS0 A;  2F4V Q;  4HJ8 A;  4HJ9 A;  1F9R A;  2EJG C;  5GAH C;  3BVZ A;  1ET9 A;  4XT1 B;  1GXD C;  4R1J A;  2NVQ B;  3ERS X;  2N78 A;  4X3U A;  1IL8 A;  3A5U A;  2TMP A;  5KNC A;  3QWN A;  4A93 B;  4RFB A;  4LFB L;  3NXW A;  1M8A A;  4XXE A;  1J5E Q;  3T13 A;  1W6J A;  3OIQ A;  1HFN A;  4A3D G;  1S5B D;  4EQO A;  2E2D C;  1QWY A;  5LHY 1;  5IP9 H;  3TZD A;  2B2U C;  3DM1 A;  5IIF A;  2JA6 B;  2KHS A;  2K75 A;  3E9H A;  4QF4 A;  4X62 L;  1WFQ A;  4GN5 A;  2EXD A;  3K7U C;  4ME3 A;  1VQG A;  2VUM H;  1Z7T A;  1M90 C;  1TWH B;  2EYM A;  1LTR D;  4IUP A;  1Y1W B;  2F3V A;  1EYA A;  4NXN Q;  1YI2 A;  3PO2 G;  1DON A;  1XXG A;  1SYE A;  1MIU A;  2AMC B;  2K14 A;  4QB4 A;  2PW5 A;  4MTN A;  2B2U A;  4OEL B;  1ONL A;  1EZ8 A;  3IFD A;  1V8Q A;  1BNZ A;  2Y0S G;  1E2W A;  4PV1 C;  1B4O A;  3HZX A;  1BCP D;  1VQF A;  2ZJP A;  3W3A A;  1LYL A;  3AU7 A;  1X55 A;  2AWO A;  3GO5 A;  4LF6 Q;  1ILP A;  1BR9 A;  3UDG A;  4A3B H;  3C1F A;  1X6O A;  4JI7 Q;  3AB9 A;  4HJA A;  4WOR A;  1TS2 A;  4IPH A;  1Y14 B;  5TSS A;  3LWU A;  5DLQ E;  3KDF A;  4AYB E;  5DAU A;  4HJ5 A;  2Z8L A;  4FP5 D;  3IRB A;  4GLV B;  2OTJ A;  3CQZ H;  3J7Z C;  2CHB D;  1L0Y B;  3KDF B;  2PPB C;  1YJ9 A;  3I4M H;  4FYD A;  4A3B G;  5EBC A;  5ELO A;  2KVM A;  1J6Q A;  1C4Q A;  1EU4 A;  2PO4 A;  3I70 A;  3R93 A;  1X3F A;  1Y69 U;  2JP1 A;  1YEZ A;  1BO0 A;  3QB3 A;  4X3T A;  1PDQ A;  4DXG A;  3I4M G;  1FGU A;  2R7Z G;  4LFC Q;  2KOL A;  1ESF A;  2K28 A;  4OGQ C;  2IY5 B;  1ICW A;  4Y52 H;  5C5M A;  1BBW A;  4QUC A;  5FLM G;  1NNX A;  3HRZ C;  1Z9F A;  4JG2 A;  4TSS A;  4AQY L;  2I07 B;  2NWG A;  3JAM E;  1PTO D;  3TEH B;  4K14 A;  1EFW A;  2GA4 B;  2FHT A;  3CPF A;  5M3M H;  4A3D B;  1GKH A;  5JVH 3;  1CK1 A;  2XGT A;  4JV5 L;  2LSS A;  1PRT F;  2K33 A;  2OWO A;  1ZYR D;  3PUZ A;  3TN2 A;  1EY9 A;  2F4V L;  5IT9 c;  3HKS A;  4A3I G;  1HZC A;  1FVI A;  2Z4H A;  2EOT A;  1SYC A;  2E8G A;  4H13 C;  2PZW A;  4OIJ A;  2K52 A;  3D4D A;  3A8K E;  4DAY A;  5M5W B;  1TWA H;  1LT3 D;  2E5L L;  3PO2 B;  4DNI A;  4DK1 A;  1DM0 B;  4ME5 A;  3PO3 G;  1BDO A;  4YY3 Q;  1E7Z A;  1GUN A;  4DAY B;  4LF8 Q;  2VUM B;  2EE1 A;  3PIO A;  3WWV A;  1N33 L;  1BCP C;  2C9O A;  4BXX H;  1KNA A;  1NJI C;  2P5Z X;  1QZH A;  1CFM A;  3CMA A;  3H3V H;  4DR4 Q;  4QMG A;  2R6G A;  3C46 A;  4QCL A;  3ULJ A;  3HGB A;  5IGD A;  4KKU A;  3CC4 A;  4IFD I;  1GUS A;  4WFN 3;  1B53 A;  3Q8D A;  3I90 A;  2PYK A;  1CM9 A;  1B70 B;  2BOS A;  1X65 A;  4ILW A;  3Q24 A;  4DUY Q;  2A68 D;  3H15 A;  1Y8N B;  5KND A;  1KXL A;  3QJY A;  2YTV A;  1GVP A;  1STA A;  3CAM A;  3NE5 B;  2K4K A;  2Z9H A;  4A3B B;  4DAP A;  1FNV A;  1Q3L A;  1ILQ A;  4OL7 A;  1LTI D;  2PZU A;  3I56 A;  2ICE C;  3KBX A;  1HFG A;  1N32 Q;  3UDI A;  1XMO L;  1MGS A;  2F52 A;  4JYA L;  2M00 A;  4J6H A;  4KK7 A;  1EIH A;  3CQZ B;  4IZ8 A;  1KL9 A;  5I6Y A;  1BOS A;  5EBD A;  3I4M B;  4E6I A;  3J7Y W;  2R7Z B;  2E74 C;  1JC7 A;  2MHV A;  1IW7 D;  1OXU A;  1EZ6 A;  1XYI A;  3HOY H;  2JJQ A;  1SE2 A;  4DUZ Q;  1PTO C;  5IOC A;  3EJI A;  2DY7 A;  4DK6 C;  4DNR B;  2X69 A;  1SLJ A;  4OO1 G;  1ROD A;  1FGB D;  1SNC A;  3GD7 A;  2ENB A;  5ELE A;  5FOB B;  5IGE A;  3TDQ A;  4KMU C;  1ZYR C;  3GTL H;  4KN4 C;  3CCJ A;  3NTH A;  2F3I A;  2PZT A;  1GUW A;  2Q8R E;  4X3S A;  1K8G A;  1WOC A;  3R2T A;  3G71 A;  3W1B A;  4G7H C;  4GN3 B;  1O7L A;  4HID A;  1SYD A;  1QG7 A;  3BVM A;  4A3I B;  1D2B A;  1IL2 A;  4ALP A;  3BDL A;  2PCF B;  2XN9 C;  5M3M B;  1NE3 A;  1G8Z D;  1G2T A;  1TS5 A;  1TQO A;  1WD1 A;  4ZRZ A;  1YHQ A;  3DM3 A;  4DFA A;  2WV6 D;  5AJ3 Q;  4LF5 Q;  2BH2 A;  4KLK A;  1AW7 A;  3PO3 B;  3RMH A;  2EC7 A;  1BVS A;  4G7O C;  3PQI A;  4F8M A;  4XQN A;  4GKK L;  4KHV A;  3LGJ A;  4CJ1 B;  1XNQ Q;  2JA7 H;  4LF4 Q;  3ZJY C;  4EQP A;  4U67 3;  3KF8 A;  1TWA B;  4A3L H;  4OXP A;  4G4K A;  3DLL A;  2N3S A;  4DK3 C;  1JWM D;  1HA5 A;  3J81 L;  2E75 C;  5IP7 G;  1I4X A;  4LF9 L;  5C0X J;  4B3R Q;  2A68 C;  4IUU A;  4QJF A;  4LUZ A;  4KHP Q;  1KRS A;  4JOI C;  1M4V A;  5KYL A;  1KAW A;  2KCN A;  4MN3 A;  4PMB A;  1CQV A;  5CBE E;  1EUJ A;  4YY3 L;  4DR7 Q;  4LF8 L;  2H4O A;  2CQF A;  1KD1 C;  1SE4 A;  5GAG C;  4RWS C;  1XX8 A;  2QKI C;  3K80 C;  3ER0 A;  1BF4 A;  4OWX B;  5E3F A;  1K8A C;  1XTD A;  1STY A;  1S5F D;  2UUA Q;  1ENA A;  5GRO A;  2E2H H;  1VQN A;  3CF5 A;  1R9T H;  3QR8 A;  2HHH L;  2RDG A;  3ICE A;  5FO8 B;  4KJN A;  3RZD H;  2V1C C;  3EIV A;  4FO2 A;  4JOI A;  2K03 A;  5T1G A;  1I6H H;  1I3Q B;  3B6Y A;  3ITP A;  2RDF A;  3SDZ A;  4C3I G;  4QGU A;  2B2V C;  1UEB A;  2KBN A;  4DV0 Q;  3A74 A;  2F0N A;  1SNM A;  2O5J C;  2AUK A;  2F0M A;  4HED A;  4V0B A;  2K5W A;  3P75 A;  2NZ1 D;  3OW7 A;  1KDA A;  1VF5 C;  2F1M A;  4IUT A;  3PIO 3;  1EFI D;  4WJ4 A;  1N32 L;  2D9U A;  3PGZ A;  3HOY B;  2WB1 G;  2J4X A;  4CJ2 C;  3ND8 A;  3T1Y Q;  1VQP A;  5FO7 B;  2CQA A;  3HKZ E;  4WRD A;  2OCE A;  2CW0 D;  1LO5 D;  4UY8 C;  2RDH A;  3UI2 A;  2ZJQ A;  1SAP A;  1PFS A;  3MVV A;  3UDF A;  3GTL B;  1FD7 D;  1V1O A;  4IPG A;  3ERO A;  3IAY A;  4DUZ L;  1LTG D;  1P16 A;  2J0T D;  5IE8 A;  2PW7 A;  1HZA A;  1SMY D;  1Q3Z A;  1QNU A;  4CBV A;  1YNN D;  1Y1V G;  1EIY B;  3A54 A;  2EYL A;  2L1B A;  4CHT B;  4OX9 L;  4KKT A;  4L6T B;  1GM5 A;  5EKK A;  5FO9 B;  3OMC A;  4RH6 A;  4X66 L;  2NBF A;  5IYD H;  2KEE A;  4IUV A;  4B3M L;  4J1M A;  3WDN A;  4P72 A;  2HD3 A;  5M5Y B;  2F0K A;  1CKN B;  1STG A;  4NDX A;  3T56 B;  4DU9 A;  2EYF A;  3QIA A;  3SK4 A;  1O80 A;  4GOP B;  1MI2 A;  3CME A;  2JYO A;  1P8L A;  2OEO A;  4DR3 Q;  3U58 A;  3CCS A;  4YCV A;  4CKC A;  2F0F A;  4DV7 L;  3VYU A;  2VZA A;  4HMJ A;  1CUK A;  5D14 A;  2UXC L;  1RD9 D;  3W2D A;  5AJ3 L;  3PV0 A;  1AEX A;  2G9H D;  1RJT A;  1WCM H;  4IPC A;  2MPM A;  5CV9 A;  4JCV E;  1ASY A;  4FF2 A;  5C4J H;  1XNQ L;  4LF4 L;  3CCV A;  1LUZ A;  3MXN A;  3CKI B;  1SDF A;  2C5C A;  2F0H A;  2L9H A;  1LV9 A;  1WCM G;  1K9M C;  1MHW C;  4LFB Q;  4A3C G;  1KDC A;  1IYJ B;  2KCT A;  3V2T A;  3D31 A;  3GTP H;  5GAE C;  2NZO A;  4HCS A;  3M7N A;  1TS4 A;  4A3E G;  5JAV A;  1KNE A;  1RTO A;  4H7B A;  1F9S A;  4J8Q A;  4KHP L;  3N52 A;  5GQO A;  1CZG A;  4P75 A;  3CHB D;  5C6A A;  5KGU A;  4C3I B;  1PXU A;  1UUP A;  3NWS A;  2XWJ B;  4X62 Q;  5IYB H;  1E2Z A;  1R9T B;  1T5E A;  2F0W A;  3RZD B;  1I6H B;  4POF A;  4ABN A;  1HCZ A;  4ZKC B;  2IPK D;  2A8V A;  3N6R A;  3VA7 A;  1RTN A;  2N88 A;  3X3M A;  1FNW A;  5EPK A;  1EYG A;  1WI5 A;  3FMC A;  3RLF A;  3K7A H;  2WB1 B;  3GTG H;  4KJO A;  1MD2 D;  3M4Y A;  2Q8T A;  4JVZ A;  5DNF A;  4RGM A;  4ZKB B;  4MIU A;  3DWA A;  1SND A;  2Q2U A;  3VDY A;  1H9R A;  2XRQ D;  3FKI G;  2HCI A;  1H95 A;  4ZUI A;  3E3X A;  5KRU A;  1Y1W H;  1GHK A;  3SVM A;  5LMN L;  3J7A F;  1Y1V B;  5I4D A;  5LMU Q;  2L4L A;  1O7Z A;  2E76 C;  4JI3 L;  1L1O B;  1CHQ D;  1A3V A;  1MBY A;  4RAU C;  1ET6 A;  2WAC A;  4JW0 A;  3VR6 A;  3HOX H;  1QVC A;  4BY1 H;  4R8N A;  1O7I A;  2QCP X;  4BS9 A;  3T1Y L;  3E6Z X;  4XYO A;  5JEA H;  3CCM A;  4NXM L;  4IFD J;  2MJ8 A;  1S4Z A;  1B7Y B;  3KUP A;  2JZW A;  2QDL A;  1PH8 A;  1EY5 A;  4DXF A;  1EQT A;  1JIC A;  4L5T A;  4DN4 M;  3J81 i;  5CC4 A;  1VQL A;  3M4O H;  1AN8 A;  3A7A B;  4BY1 G;  1Q12 A;  2WP8 J;  1IZ6 A;  5JEA G;  4HTH A;  4AH6 A;  2DJF C;  3TP8 A;  4C3H H;  2QW7 A;  1B50 A;  3J7A 5;  1X9N A;  3CCR A;  1Z6H A;  2A6H D;  5F2D A;  4RGT A;  3RLO A;  4LAA A;  1WCM B;  2Q2I A;  4LJZ C;  1G6Z A;  2B39 A;  1Q1B A;  4R4T A;  2SNS A;  2AKW B;  1YNJ C;  4AQY Q;  2XIW A;  5EAY A;  4MNO A;  5LL6 X;  5FLX c;  1QVF A;  4A3E B;  2KUM A;  3MXG A;  5D65 A;  4JV5 Q;  2EPB A;  4K8I A;  3P20 A;  2EZV A;  1Q1E A;  2CKZ B;  4JPB W;  2RHQ B;  4HR7 B;  2X6G A;  2DNE A;  3GTP B;  1K0S A;  1X54 A;  2L11 A;  1XNR L;  1SXT A;  3J80 c;  1MSH A;  4A3D H;  3D0F A;  1SE3 A;  4NKL A;  4XIG S;  3MHB A;  1SR3 A;  4B9W A;  2Z0S A;  2O2L D;  2E5L Q;  1NR4 A;  2UU9 Q;  1PRT C;  4HSP A;  2YTY A;  1HXY D;  4RG1 A;  4POG A;  3HOV G;  1L2F A;  3FKI B;  4IAL A;  4KTA A;  1N33 Q;  3K7A B;  2LMC B;  1EU3 A;  2G5D A;  5CV4 A;  2D5D A;  3GTG B;  3SHL A;  5C4X G;  5M5W H;  3PO2 H;  1EQR A;  1HA6 A;  3STB D;  4UAI A;  1QB5 D;  2R7D A;  3TZU A;  4DAM A;  2XVS A;  2OTL A;  1VMC A;  2F0V A;  4MTK A;  2A73 B;  5IY0 A;  1YNX A;  1U4L A;  3U4V A;  4C2M B;  4C3J G;  2PQE A;  2VL6 A;  3UE0 A;  1BJ6 A;  4LMQ D;  1ENC A;  3VR5 A;  1HNW L;  4OWT B;  2AHO B;  2OXP A;  1I94 Q;  3HOX B;  2J7Z A;  1JOK A;  1PHJ A;  4M8A A;  4BY1 B;  1E0B A;  2AQ3 B;  1AFP A;  5LMU L;  2I5M X;  3L2P A;  2HT1 A;  3QOL A;  1XMO Q;  4JYA Q;  2A6H C;  3SXH A;  1LLR D;  2BA0 A;  3M4O B;  1ZEQ X;  4EQN A;  1X56 A;  1PVO A;  4A3K H;  3K0Y A;  4K8J A;  3HEJ A;  5KEE A;  1UNS A;  1U9R A;  2PQA A;  5JVG 3;  2ZM6 L;  1A2T A;  1ENF A;  3OOC A;  1PFM A;  4Q0F A;  2AQ2 B;  2D0O A;  4C3H B;  5IYC G;  3F8T A;  3GQB A;  3RLN A;  3U50 C;  1JE5 A;  1NY4 A;  2F3W A;  4A3K G;  2R7Z H;  1NMG A;  3G4S A;  1EYD A;  2QGQ A;  2BE5 D;  2CWP A;  1GD7 A;  2NVY H;  3PIP 3;  1HNZ L;  1HH2 P;  3C1E A;  4QL5 A;  1I4G A;  5FLM H;  3BS1 A;  1XPR A;  1W2B A;  4P74 A;  4GNX C;  1DOM A;  1TS3 A;  1LT5 D;  2EQS A;  3JAM L;  2YTX A;  2CVR A;  4A76 A;  1HTL D;  4NPS A;  2JA8 H;  3NEN A;  1QJO A;  5ELN A;  5IOD A;  2Q2T A;  3KLS X;  3HOZ G;  5I9P A;  4OON A;  5D3I B;  4A3I H;  1TXY A;  1U0L A;  2F0Q A;  3HOV B;  1C9O A;  1EWH A;  2VB3 X;  4GKK Q;  2RSO A;  3AEV A;  3STB C;  2VXW A;  2PNR C;  4GNX A;  2I5H A;  2JA8 G;  3CRL C;  1PTO H;  3BYT B;  3NBH A;  1STH A;  3J7A V;  4JBJ A;  4CDD C;  3AQQ A;  4GLX A;  3PO3 H;  2EYO A;  1NBW A;  1SRU A;  2BA1 A;  1PFN A;  1R4Q B;  3KLR A;  1A62 A;  4LF9 Q;  3F1Z A;  2TSS A;  4K6L A;  5KNB A;  4OIK A;  4C3J B;  5CV8 A;  2QEX A;  4TQU S;  2NTS A;  2UU9 L;  1HJP A;  2EVB A;  3SGI A;  4K0K L;  1PZI D;  1YHB A;  3NUC A;  4F7X A;  1STN A;  3GP7 A;  4R9W A;  3BZD B;  2A19 A;  1K8M A;  2QDB A;  2Y0S B;  1U4P A;  1RKN A;  2H1E A;  3CPW A;  3EVQ A;  3A8J E;  3V96 A;  2HDL A;  4I7A A;  1LAB A;  2IHX A;  2F0L A;  1OTC A;  3U9O A;  2HHH Q;  3PF4 A;  2YV5 A;  2V4D A;  1TY0 A;  2QA4 A;  4C1N I;  2XWB B;  5COR A;  2LS0 1;  1ICF B;  5JJI A;  3JC6 6;  1I94 L;  2BE5 C;  4U68 A;  3NHH A;  1WD0 A;  4GKJ L;  3BU2 A;  5M3F H;  4A3K B;  1HUM A;  1O7Y A;  5G3L D;  1BCP B;  1NCV A;  3S2H H;  1I3Q H;  3BZK A;  2M9V A;  3TRE A;  3DWP A;  5CYU A;  2L0C A;  4LW1 A;  2RQX A;  2JEB I;  1SJE D;  1F6U A;  2DN8 A;  4L8J A;  3J81 j;  1SEB D;  5M3F G;  2IX0 A;  3S16 B;  4DV3 L;  4P2C B;  4OO1 H;  3KK7 A;  1WTQ A;  3K0X A;  1EQQ A;  3BDC A;  1EWC A;  4O2D A;  1CTM A;  5ELD A;  1GHJ A;  3C2P A;  1QOH A;  3MEF A;  2NVY B;  2UXB L;  4OEM B;  4A4I A;  2NB0 A;  3HOZ B;  1ZXT A;  3VR4 A;  1OXS C;  1PZJ D;  2HQE A;  4KHZ A;  1VQ7 A;  1DOL A;  1F9P A;  4OX9 Q;  5C44 G;  1IXR A;  1BKB A;  4X66 Q;  5K5P A;  4B3M Q;  2JA8 B;  2NVX H;  4HIK A;  3K59 A;  1CSQ A;  1TR5 A;  2WFW A;  2IWH A;  1PV4 A;  1KC8 C;  4AIM A;  1KIX A;  4LWC A;  2OQK A;  4A3M G;  3CU7 A;  3OWF A;  4DV7 Q;  4MZ9 A;  4CGY B;  1YVC A;  3E9I A;  4DV1 L;  2O5I C;  2UXC Q;  1EY4 A;  2BH8 A;  3SK6 A;  3QO2 A;  1PTO B;  5M5Y H;  3T51 B;  3S24 A;  2JQO A;  4RGN A;  1D1I A;  1I4Q A;  1A2U A;  2QEJ C;  1WVL A;  2R93 H;  5IP7 H;  1HUN A;  3SE0 A;  4DK0 A;  1WJJ A;  4DV5 Q;  4CDC C;  3MZ5 A;  1HPC A;  1N36 Q;  4RKB A;  1UAP A;  2ZXP A;  3ZYY X;  2ATW A;  1XMQ L;  3IL8 A;  1K8O A;  2IT1 A;  4FXK C;  1SN8 A;  3R8B A;  2R93 G;  3KF8 B;  4LF7 L;  1STB A;  2F0J A;  4K2L A;  4DV2 L;  1NAP A;  4B3T L;  2F0I A;  2B3G A;  1HZB A;  1Q90 A;  4PQX A;  2Q8I B;  1YIT A;  1VQO A;  1CKO A;  3E0J A;  3R3O A;  2F0E A;  5FLX E;  3TBI B;  3BVG A;  2I46 A;  3FPU B;  2EJM A;  4O0A A;  4ZAI A;  1BCP F;  2CCZ A;  1EL0 A;  1RHP A;  2K5D A;  4I7Z C;  1PH4 A;  1TVX A;  3BYY B;  1UWV A;  5LMN W;  4JC0 A;  4A3F G;  4IOA A;  4CDE C;  1LT6 D;  3K5O A;  1JCK B;  3GV6 A;  4C3I H;  1IBL L;  4DR2 L;  1HNX Q;  4EX5 A;  5M3F B;  3I73 A;  3J80 E;  1EEF D;  2SDF A;  3PSI A;  3VA5 A;  1A15 A;  4B3S L;  4JI6 Q;  4OWW B;  3S2H B;  3JAM i;  1T5X D;  2EXF A;  1I50 B;  5CR3 A;  4L5S A;  3PUV A;  3FHW A;  5LMN Q;  1SYG A;  5FJ8 G;  2NVT H;  4JI3 Q;  1W3S A;  1UE7 A;  4IN3 A;  3H3V I;  5C3X A;  1GJX A;  1G91 A;  5C44 B;  1SSO A;  3VYT A;  1PZK D;  3MFG A;  2NUC A;  1TY2 A;  3RN5 A;  2A74 C;  3OTO L;  4NXM Q;  1EY7 A;  1Y1V H;  3EFX D;  2NN6 H;  1K28 A;  4IQZ A;  1OXT A;  3I55 A;  1QNK A;  2FJ2 A;  4A3M B;  1DGS A;  1LTS D;  4H02 A;  2LXJ A;  4A3G H;  2B2V A;  3G6J B;  4KV6 A;  3T4A C;  3GTQ H;  1KAB A;  1PTO F;  2A69 D;  5ELB A;  2DJG C;  1VQI A;  3PUX A;  3AFQ A;  2NVX B;  2NN6 G;  2PI2 E;  1Q7Y C;  1DYQ A;  1MSG A;  3G6E A;  1AZP A;  4HCE A;  1ML0 D;  5ISR A;  3MWY W;  4A3G G;  1ESK A;  1B9M A;  2CFM A;  1AZQ A;  2FMM A;  4OO1 I;  1B3A A;  5ELC A;  4N9T A;  4HSV A;  5NUC A;  2EY5 A;  1BXT A;  3U4Z A;  2N8N A;  2AUJ D;  5HUR A;  2R93 B;  1PFB A;  1MJC A;  2BDN A;  2Z1C A;  2ZXR A;  5IWA Q;  1SE8 A;  3FEW X;  1PH1 A;  3M4P A;  4G57 A;  2VS1 A;  2F0T A;  3OW2 A;  3DUZ A;  5JJZ A;  5COY A;  3PUY A;  1ESR A;  5C0X G;  3NQT A;  1QE6 A;  2UXD L;  1KAA A;  1VQE A;  2WKD A;  4RCO A;  4A3C H;  1HQM C;  1STE A;  4K5X A;  3S1R H;  2A1A A;  3TME A;  3RUZ A;  1JWU D;  2XTI A;  2HUG A;  4DV5 L;  2OQ0 A;  4A3E H;  5C4H A;  1WTR A;  4H0L C;  1N36 L;  1PH5 A;  1TWC H;  3K5L A;  1XNR Q;  1II3 A;  1O78 A;  4BBR G;  5CV5 A;  3KJP A;  4PZ7 A;  4R4C A;  4DV6 L;  4K5V A;  3MXN B;  4PNY A;  4DR6 Q;  2HQL A;  3CD6 A;  3HFZ B;  5E7N A;  3M7G A;  4UP9 A;  1OXX K;  1VDZ A;  1UE6 A;  4YWK A;  5C3W A;  1XPU A;  1NR2 A;  4RA8 A;  2I0Q A;  1YNJ D;  1H9J A;  1E24 A;  1EWI A;  1Q46 A;  4XTC S;  1EIF A;  2Z6K C;  2RCN A;  3HOU G;  1TT2 A;  2WB1 E;  1MJE A;  2F0P A;  1WTO A;  1J8I A;  2L4N A;  3S1Q B;  4I65 A;  1PLF A;  3K6O A;  3W1G A;  4ZK9 B;  1ASZ A;  1E1O A;  3H6M A;  2G9D A;  4FF1 A;  4BBS G;  4JBM A;  3FKI H;  1TWF H;  4GS3 A;  4JI2 L;  5IT9 E;  3H0G G;  2X6L A;  2ES2 A;  4TVA B;  1HNX L;  1D8L A;  3V05 A;  3F2D A;  2UUB Q;  1UEA B;  4DF7 A;  5I2X A;  2NVT B;  2WAQ G;  4IJH A;  5HGQ A;  5IGC A;  2AWN A;  2A69 C;  4JI6 L;  3F2C A;  4ZCK A;  3NQI A;  1HNW Q;  1PRT D;  1SJH D;  5A2Q E;  4C2M H;  2JE6 I;  1V1Q A;  2ALY B;  4A93 G;  2KA7 A;  5I6W A;  2DUD A;  1S3O A;  4YHH L;  4UP7 A;  4A3G B;  4LK1 C;  3S9W A;  2DGY A;  1G51 A;  3K81 C;  3GTQ B;  1VQ4 A;  1B8A A;  3S1N H;  4ULL A;  4JI8 Q;  2ZM6 Q;  1D5Z C;  2JA6 G;  1HTP A;  3FPP A;  2VQF L;  1VQC A;  4H44 C;  4PMC A;  5J1Z A;  4DR5 Q;  4XT3 B;  2F03 A;  1HQR D;  1LT4 D;  4YCW A;  1N34 L;  3HS0 C;  1D5M C;  1JQY D;  2BCO A;  1PH7 A;  2ZTE A;  4ID6 A;  5E4X A;  1SNQ A;  1U6P A;  3KLS A;  1I4H A;  1HNZ Q;  4XDX A;  3M4Q A;  4HN7 A;  2VQE L;  2IX1 A;  2R61 A;  3MA2 B;  2E2I B;  2UUC L;  1A6B B;  3NEL A;  5C3E G;  1RCV D;  3S17 B;  2D2C C;  5I9O A;  5IGF A;  2JA5 G;  4KD3 A;  3AMU A;  3I4N H;  3BJU A;  3LWE A;  5L37 A;  1E22 A;  3BZC A;  4KY7 A;  5IWA L;  3S1R B;  1Q8I A;  1WTV A;  4L5Q A;  1DOK A;  4QIW B;  1L0W A;  1KLG D;  2HIV A;  5JPM C;  1TWC B;  1CSP A;  4PMW A;  3S14 B;  1NSN S;  3I4N G;  3H94 A;  2KEN A;  3HOU B;  4IPD A;  3CW2 C;  4DV4 Q;  1S72 A;  4ZQ3 A;  1JR0 D;  1K0R A;  2F0U A;  1IBM L;  1FJG Q;  3S2D H;  1QUQ A;  4P71 A;  3G7L A;  2EDG A;  3ULL A;  5CV7 A;  3GTJ H;  3HOV H;  1K3R A;  3J81 c;  3NEM A;  4TRD A;  3D6W A;  3LX0 A;  3KYH C;  3A7L A;  4QQB X;  1KLU D;  3VYR A;  4AYB G;  4RHR A;  3H0G B;  1Q86 C;  4PZ8 A;  2E2J H;  4MHE A;  5C4X H;  4DR6 L;  1Z47 A;  4G7Z C;  1EY0 A;  3D3R A;  4B08 A;  4KY5 A;  1Q81 C;  1VQM A;  2R3Z A;  4APV A;  2WAQ B;  1VQ8 A;  4K0K Q;  5FK9 C;  2WII B;  1M1K C;  3S15 H;  3CC2 A;  2GN5 A;  5HY6 A;  4LFA Q;  1AAF A;  1TWF B;  3M9B A;  1CA5 A;  4Z9C B;  1V1P A;  4C3J H;  1CZW A;  3I3C A;  3MXU A;  1VQJ A;  1WYD A;  5E1F A;  3K58 A;  3RD4 A;  2AQ1 B;  1CA6 A;  4IFD H;  2Q2H A;  1V1P B;  1RF2 D;  1NUC A;  1T9H A;  2F4I A;  3IKJ A;  2BDO A;  2MP1 A;  1X3G A;  4CJ0 B;  4EVO A;  5EQ0 A;  3NTK A;  2ICI A;  4ODG A;  2UUB L;  2B63 H;  3MXP A;  5CV6 A;  5EPJ A;  4IFD G;  1PRT B;  3M85 A;  4R4O A;  4DR1 L;  1F2M A;  4GKJ Q;  3RN2 A;  2YYZ A;  3AFP A;  1PYW D;  3S1N B;  2I5L X;  5IP9 G;  1Q8K A;  3K57 A;  2B63 G;  3S1M B;  3EA6 A;  3DWQ A;  1VS0 A;  3CRK C;  2RKS A;  2QF7 A;  5IYC H;  3T1H L;  4YCU A;  4OHJ A;  2JK8 A;  1WTW A;  3NTI A;  4DV3 Q;  2VUM G;  2PMZ E;  1NTG A;  1IYV A;  5C3E B;  3MTS A;  4KKS A;  3GV3 A;  2EJF C;  4JI8 L;  3CXC A;  1KHI A;  5AFW A;  4DR5 L;  2JA5 B;  5M5X B;  3OYY A;  2K5H A;  2UXB Q;  4P73 A;  1A3T A;  1TWG H;  2PQA B;  2PMZ B;  3S16 H;  2EY2 A;  4JI5 L;  1WTP A;  1AH9 A;  3A55 A;  3MEH A;  3I4N B;  1XJV A;  3QOJ A;  1VQA A;  4DKA C;  2A5H A;  2JN4 A;  4R4I A;  2L12 A;  3RZO H;  2K5N A;  3HOZ H;  1PH9 A;  3T53 B;  3DEP A;  3OSO A;  1N9W A;  1PH2 A;  2ASB A;  3CC7 A;  4TKO B;  1R4P B;  2XRS D;  1W6K A;  5A35 A;  1JJ2 A;  2IHE A;  1JE4 A;  4FF4 A;  4AYB B;  1QIL A;  1AE3 A;  2XNA C;  4DV1 Q;  4RHS A;  4A3J H;  2WIN B;  1C48 A;  3KF6 A;  3A56 A;  5IGG A;  3S2D B;  1GOZ A;  1IKL A;  1VQK A;  3NP8 A;  3L0O A;  2Z4I A;  3F2U A;  4ZYS A;  3GTJ B;  4FVM A;  2SNM A;  2RBM A;  4X64 L;  4RMF A;  2RA4 A;  2KED A;  3KF6 B;  1K73 C;  1S5E D;  1V9P A;  3FVQ A;  4DAV A;  2K5Q A;  4DV4 L;  2E2J B;  5JPN C;  4A3J G;  5C4X B;  2M3Z A;  5ELF A;  1J9O A;  1FJG L;  3HOW H;  1TKW B;  2B29 A;  2IX3 A;  1XMQ Q;  1LM0 A;  1WWE A;  4GNX B;  2ZJR A;  3S15 B;  2B2T C;  3NBH B;  4LF7 Q;  4DV2 Q;  3GTM H;  4B3T Q;  4JI1 Q;  2L5T A;  5C4Z A;  1L0X B;  2Y0S E;  1DCZ A;  5BN4 A;  2GVB A;  3TS2 A;  4XQQ A;  2L55 A;  4S3S A;  3HOW G;  3RR5 A;  1YJN A;  2MGS A;  4CKB A;  2L15 A;  2MNA A;  3CCL A;  3OMG A;  4JI0 Q;  4HIM A;  2B2W C;  2K01 A;  4LFA L;  1SRO A;  4JBK A;  2NTT A;  5EGT A;  5E4W C;  4ZLT F;  5M3M G;  3L7Z C;  1UE1 A;  2KCM A;  1G2S A;  1VQB A;  1EIG A;  3GDE A;  2HCC A;  2B63 B;  1LTA D;  3A5Z B;  3KOJ A;  2B2T A;  4ZUJ A;  2ZT9 C;  2EY1 A;  4DPG A;  4JK1 C;  2EYH A;  2KQ3 A;  1YBY A;  1IBL Q;  3I4O A;  2SOB A;  4X65 Q;  2OF1 A;  4DR2 Q;  2EIF A;  3A8I E;  2D0P A;  5BN5 A;  2DNC A;  2A6E D;  4KY6 A;  4FDB A;  1J5E L;  2NYZ D;  4B3S Q;  1DZ1 A;  2VY3 A;  1VQ5 A;  2JA9 A;  3HP3 A;  1V43 A;  4BA1 I;  2B2W A;  1A0I A;  3DEO A;  1JB7 A;  4EGV A;  3TSS A;  1U5K A;  4R8I A;  4BY7 H;  2IHF A;  1Q3Y A;  1XWE A;  2CQO A;  4K6D A;  5JJK A;  5CBA E;  1E3P A;  4RCN A;  3F2B A;  4BXX G;  1A3U A;  1A63 A;  1YIJ A;  4NXN L;  1BBU A;  1I50 H;  2B2Y C;  4GN4 B;  2M2L A;  3OTO Q;  1TWG B;  2FIN B;  4BY7 G;  3NWT A;  1SYB A;  5C5L A;  4X6A H;  4A75 A;  1A6X A;  3SEB A;  3P1H A;  1H9K A;  5C44 H;  3SK5 A;  2C35 B;  2EY6 A;  1C0A A;  4K5W A;  2F0G A;  4CDF C;  4IO9 A;  4JBW A;  1IHZ A;  1U4M A;  2ID0 A;  4N9P A;  3Q22 A;  3RZO B;  5M9O A;  3OIP A;  2KEC A;  2LY7 A;  2KJX A;  4A3M H;  2VW9 A;  1HR0 W;  4IUQ A;  4LF6 L;  3D4W A;  3T16 A;  2K32 A;  2B2Y A;  4JI7 L;  3D6C A;  3MAQ A;  3ERQ A;  4NMZ A;  2K50 A;  3K8A A;  1YJW A;  2R92 H;  1A1T A;  4A3J B;  2IW3 A;  4V19 0;  2CWA A;  3W5O A;  1GO3 E;  2K5V A;  3ULP A;  1H9S A;  2N55 A;  4N8F A;  1CQF A;  2LKV A;  3I2Z A;  4HJ7 A;  2YSA A;  3ND9 A;  4DGZ A;  2CH4 W;  2K04 A;  1JB3 A;  2R92 G;  1NMF A;  2YU9 H;  1JWS D;  1H9S B;  2EXZ A;  1B2T A;  3EN2 A;  1VMP A;  1WWF A;  1A8V A;  1HR0 Q;  3HOY G;  4FXG C;  4IUR A;  3HOW B;  2MQH A;  2UXD Q;  1AP0 A;  4LFC L;  1E1T A;  2RVL A;  4F88 A;  3GTM B;  4K2K A;  3E5S A;  1Y8P B;  1JJC B;  3KJO A;  5BR8 Q;  4FXD A;  3FP9 A;  2HDM A;  2LI8 A;  3L9A X;  1EOT A;  1RIP A;  3HKZ G;  1N8R C;  1EQV A;  2A6E C;  3VR2 A;  1JOO A;  3BDO A;  3EQL C;  4DV6 Q;  1Q82 C;  3H3V C;  2IJ0 A;  5FLX L;  4KI0 A;  2F0O A;  4JI1 L;  3TQY A;  4RKL A;  4A3F H;  1SMX A;  3I72 A;  4HIO A;  1ZKO A;  1X32 A;  1OO9 B;  4JI0 L;  2ZTC A;  3DHQ A;  3VR3 A;  1EOV A;  1VCI A;  4GLA C;  3URY A;  1FNU A;  3J80 L;  3AYH B;  1CKM A;  2JA7 G;  4JI2 Q;  1FYC A;  2K7V A;  2ZTD A;  4PZ6 A;  4A3L G;  3QG1 A;  5GAD C;  3NYB B;  1IKM A;  4X65 L;  3J81 E;  3S1Q H;  3OPO A;  1QZG A;  4RGO S;  4BY7 B;  2JXM B;  1LTB D;  5FJ8 H;  3PUW A;  1GUT A;  5T1I A;  3C3L A;  5J3B A;  1LTL A;  3WOF A;  2DY8 A;  1WTX A;  4O1N A;  3FRP B;  5K36 H;  1B44 D;  1CI3 M;  1YZ6 A;  4DR4 L;  2EYP A;  1IW7 C;  5EPL A;  1IBK Q;  3PF5 A;  1SNO A;  4UP8 A;  1QVG A;  4YHH Q;  1D6E C;  1LTT D;  1HZ9 A;  5K36 G;  1F2L A;  1PYB A;  3TP6 A;  1DJR D;  2MUY A;  1S5D D;  4DUY L;  3UE1 A;  2VQF Q;  5H1S E;  2JEA I;  5KIX A;  2N49 A;  1JMC A;  5EKI A;  3EBE A;  4EQ5 A;  1UE5 A;  2RCF A;  4N8X 1;  1PYS B;  1N34 Q;  4LUV A;  4R4Q A;  4GZY C;  1TU2 B;  4WJW A;  2R92 B;  1FR3 A; 
#chains in the Genus database with same CATH homology
 2PQA A;  1KL9 A;  4YCW A;  2ZM6 L;  1N34 L;  1JT8 A;  1WWG A;  3I7F A;  1PH7 A;  2ZTE A;  2D0O A;  5IYC G;  1G6P A;  1OXU A;  3F8T A;  3RLN A;  3U50 C;  2VQE Q;  4GOP C;  1U6P A;  1JE5 A;  3GTK H;  1NY4 A;  4A3K G;  2R7Z H;  3HOY H;  2JJQ A;  4DUZ Q;  1NMG A;  1HNZ Q;  3G4S A;  2UUC Q;  2QGQ A;  3M4Q A;  2VQE L;  4LUO A;  2CWP A;  4DK6 C;  2IX1 A;  3JAM c;  1GD7 A;  4J15 A;  1SLJ A;  4OO1 G;  2NVY H;  1HNZ L;  3GD7 A;  1HH2 P;  4QL5 A;  4UPA A;  2UUC L;  1A6B B;  5FLM H;  3NEL A;  5C3E G;  3GTL H;  3CCJ A;  1XPR A;  1W2B A;  2F3I A;  4P74 A;  4GNX C;  2E2I H;  2JA5 G;  3I4N H;  1SFO H;  3BJU A;  1WWD A;  2EQS A;  1K8G A;  1WOC A;  1E22 A;  2YTX A;  3BZC A;  3G71 A;  2PI2 A;  3W1B A;  4GN3 B;  1CKN A;  1HR0 L;  5IWA L;  4HID A;  3S17 H;  2GVA A;  4GOP A;  1IL2 A;  4ALP A;  4L5Q A;  4A76 A;  4BBR H;  1VQ9 A;  4NPS A;  2JA8 H;  3NEN A;  5ELN A;  1L0W A;  2Q2T A;  3HOZ G;  2HIV A;  4OON A;  1NE3 A;  1CSP A;  4PMW A;  5JJL A;  4A3I H;  1TXY A;  1YHQ A;  1IBM Q;  3I4N G;  1XPO A;  1U0L A;  3DM3 A;  3GTO H;  2KEN A;  4JI4 Q;  4IPD A;  4Y7N H;  5JEA J;  1C9O A;  3CW2 C;  5AJ3 Q;  5BR8 L;  4DV4 Q;  1S72 A;  4LF5 Q;  3PCO B;  2BH2 A;  4GKK Q;  4IOC A;  3AEV A;  1K0R A;  3STB C;  5IYD G;  1IBM L;  4KLK A;  1FJG Q;  3S2D H;  3S14 H;  1QUQ A;  4P71 A;  4GNX A;  2EC7 A;  1BVS A;  2I5H A;  2JA8 G;  3ULL A;  3GTJ H;  1S40 A;  1PA6 A;  4LF5 L;  1K3R A;  3J81 c;  3NEM A;  3LGJ A;  3HOV H;  4GKK L;  1G29 1;  1I5F A;  1XNQ Q;  3KYH C;  4QQB X;  3CCQ A;  2JA7 H;  4AYB G;  4LF4 Q;  2D62 A;  4JBJ A;  4GLX A;  3AQQ A;  1YHA A;  3ZJY C;  1Q86 C;  3PO3 H;  1K83 H;  4PZ8 A;  1MKH A;  1NBW A;  2E2J H;  5C4X H;  4A3L H;  1SRU A;  4OXP A;  4DR6 L;  3DLL A;  1Z47 A;  2BA1 A;  3M3Y H;  4BBS H;  4YWL A;  2N3S A;  1VQD A;  2NZH A;  4DK3 C;  1Q81 C;  1VQM A;  1A62 A;  4APV A;  3F1Z A;  1VQ8 A;  4LF9 Q;  3H0G H;  4K0K Q;  1M1K C;  2QEX A;  3S15 H;  5IP7 G;  2GN5 A;  3CC2 A;  4TQU S;  5HY6 A;  4LFA Q;  3UDX A;  1AAF A;  2UU9 L;  1HJP A;  4LF9 L;  5C0X J;  3SGI A;  4K0K L;  3M9B A;  1YHB A;  4B3R Q;  1D7Q A;  4QJF A;  4C3J H;  4LUZ A;  4KHP Q;  1KRS A;  2A19 A;  4JOI C;  1VQJ A;  1KAW A;  4B3R L;  1WYD A;  4YY3 L;  1EUJ A;  1VQ6 A;  4DR7 Q;  4LF8 L;  3CPW A;  3CCU A;  3G48 A;  2NVQ H;  1KD1 C;  2Q2H A;  1VQH A;  2CQF A;  5GAG C;  1T9H A;  3E0E A;  3K80 C;  4DR7 L;  2KHJ A;  1X3G A;  4A93 H;  2IHX A;  3ER0 A;  2Z6K A;  4OWX B;  1L1O C;  1OTC A;  2UUB L;  1K8A C;  1XTD A;  4DR1 Q;  2B63 H;  2HHH Q;  3PF4 A;  4YWM A;  1PH3 A;  2YV5 A;  2UUA Q;  3A0J A;  4BA2 I;  4IFD G;  2QA4 A;  3M85 A;  4R4O A;  5GRO A;  2E2H H;  4DR1 L;  1VQN A;  3CF5 A;  1R9T H;  2HHH L;  1OXV A;  3ICE A;  4GKJ Q;  2HIX A;  3RZD H;  2JA6 H;  2V1C C;  3EIV A;  4JOI A;  1KRT A;  2UUA L;  1I6H H;  3RN2 A;  2YYZ A;  1IBK L;  5JJI A;  3JC6 6;  3AFP A;  3T1H Q;  4L5R C;  2I5L X;  3B6Y A;  1I94 L;  3KLW A;  5IP9 G;  5IYB G;  1Q8K A;  2B63 G;  3BU2 A;  5M3F H;  4GKJ L;  1FL0 A;  1VS0 A;  2LXK A;  4QGU A;  5IYC H;  3S2H H;  3T1H L;  1RL2 A;  1UEB A;  4YCU A;  1TWH H;  1I3Q H;  2KBN A;  3BZK A;  4DV0 Q;  3A74 A;  3TRE A;  3PIP A;  1L1O A;  2JK8 A;  3S1M H;  1KQS A;  4LW1 A;  4DV3 Q;  2VUM G;  2H5X A;  1NTG A;  2PMZ E;  2JEB I;  4DV0 L;  1F6U A;  3J81 j;  4WJ4 A;  4JI8 L;  1N32 L;  5M3F G;  3CXC A;  1KHI A;  2IX0 A;  3PGZ A;  4DR5 L;  2WB1 G;  4DV3 L;  3OYY A;  4WJ3 M;  3K0X A;  3T1Y Q;  1EQQ A;  1VQP A;  4JI5 Q;  2K5H A;  3HKZ E;  4NB3 A;  5C3E H;  4P73 A;  2UXB Q;  4O2D A;  1TWG H;  2PQA B;  2OCE A;  4UY8 C;  2FXQ A;  3MEF A;  2MFI A;  4LNQ A;  3S16 H;  2JA5 H;  3CCE A;  5M5X H;  1Y1W G;  4JI5 L;  2ZJQ A;  1PFS A;  2UXB L;  3UDF A;  4A4I A;  1AH9 A;  4IPG A;  2R7F A;  1OXS C;  1AE2 A;  4DUZ L;  4KHZ A;  1P16 A;  5IE8 A;  1VQ7 A;  1XJV A;  1HZA A;  1VQA A;  2NN6 I;  4DKA C;  1PVO A;  1Q3Z A;  4OX9 Q;  3J80 i;  5C44 G;  3HOX G;  1IXR A;  1Y1V G;  4R4I A;  2K5N A;  4QIW E;  3RZO H;  3HOZ H;  1EIY B;  2VNU D;  1BKB A;  1PH9 A;  4X66 Q;  1N9W A;  1PH2 A;  4B3M Q;  4OX9 L;  3CC7 A;  2ASB A;  2NVX H;  1GM5 A;  4QY7 A;  4HIK A;  1CSQ A;  1X3E A;  2WFW A;  1PV4 A;  1KC8 C;  4X66 L;  4AIM A;  2IHE A;  4LWC A;  1KIX A;  1JJ2 A;  5IYD H;  2OQK A;  2RHS B;  4A3M G;  4B3M L;  1AE3 A;  4P72 A;  4DV1 Q;  4PG3 A;  3CP0 A;  4A3J H;  1PH6 A;  4X64 Q;  3KF6 A;  1CKN B;  4DV7 Q;  4MZ9 A;  3KFU A;  4GOP B;  1VQK A;  1YVC A;  2PNH A;  3E9I A;  3HOU H;  3L0O A;  3CME A;  4DV1 L;  4DR3 Q;  1P8L A;  2UXC Q;  3U58 A;  2BH8 A;  3CCS A;  4X64 L;  5M5Y H;  4RMF A;  4YCV A;  3S24 A;  2JQO A;  4DV7 L;  3KF6 B;  2VZA A;  3RNU A;  1CUK A;  1K73 C;  4DR3 L;  1V9P A;  2UXC L;  4JI4 L;  4IJL A;  5AJ3 L;  4DV4 L;  2R93 H;  2WAQ E;  5C0X I;  4A3J G;  1MFS A;  2M3Z A;  3PV0 A;  5IP7 H;  1FJG L;  3HOW H;  1WJJ A;  2B29 A;  1WCM H;  4DV5 Q;  1XMQ Q;  1LM0 A;  1QUQ B;  2RF4 A;  3TRZ A;  4IPC A;  4GNX B;  2ZJR A;  4JCV E;  1N36 Q;  1ASY A;  1JJG A;  1WWE A;  5C4J H;  2KHI A;  1XNQ L;  3NBH B;  4LF7 Q;  1C7Y A;  2MO1 A;  4LF4 L;  1XMQ L;  2ATW A;  3CCV A;  4DV2 Q;  3GTM H;  1LUZ A;  4JI1 Q;  4B3T Q;  2IT1 A;  1SN8 A;  2Y0S E;  2R93 G;  2MO0 A;  2GVB A;  3KF8 B;  3TS0 A;  2F4V Q;  3TS2 A;  4HJ8 A;  4LF7 L;  4HJ9 A;  3HOW G;  4DV2 L;  3RR5 A;  4B3T L;  1WCM G;  1YJN A;  1K9M C;  2B3G A;  5GAH C;  2L15 A;  2MNA A;  4LFB Q;  1HZB A;  4A3C G;  3CCL A;  4R1J A;  1IYJ B;  4JI0 Q;  2KCT A;  2N78 A;  3D31 A;  3ERS X;  4HIM A;  4LFA L;  1YIT A;  1VQO A;  1SRO A;  3GTP H;  5GAE C;  3A5U A;  2NZO A;  4JBK A;  1CKO A;  4LFB L;  3M7N A;  4A3E G;  5M3M G;  3L7Z C;  1UE1 A;  2KCM A;  4KHP L;  1VQB A;  4O0A A;  5GQO A;  3GDE A;  4P75 A;  2CCZ A;  3A5Z B;  3KOJ A;  1PH4 A;  1J5E Q;  4DPG A;  1UWV A;  5LMN W;  4A3D G;  1IBL Q;  1YBY A;  4JC0 A;  4A3F G;  4X62 Q;  3I4O A;  4IOA A;  4X65 Q;  5IP9 H;  5IYB H;  4DR2 Q;  2EIF A;  2D0P A;  1J5E L;  4FDB A;  4POF A;  4C3I H;  2K75 A;  2A8V A;  1IBL L;  4B3S Q;  3E9H A;  4X62 L;  1WFQ A;  4GN5 A;  1EYG A;  4DR2 L;  2VY3 A;  1WI5 A;  1HNX Q;  1VQ5 A;  4EX5 A;  2EXD A;  2JA9 A;  3K7U C;  4ME3 A;  3RLF A;  1V43 A;  3K7A H;  4BA1 I;  3PSI A;  3GTG H;  1VQG A;  2VUM H;  4B3S L;  4JI6 Q;  1A0I A;  4OWW B;  3JAM i;  1JB7 A;  1M90 C;  1U5K A;  4BY7 H;  2IHF A;  2EXF A;  1Q3Y A;  2CQO A;  2Q2U A;  3VDY A;  4NXN Q;  5JJK A;  1YI2 A;  1E3P A;  3PO2 G;  4L5S A;  3FKI G;  1MIU A;  2AMC B;  2K14 A;  3FHW A;  3PUV A;  3F2B A;  5LMN Q;  4BXX G;  5FJ8 G;  2NVT H;  1H95 A;  1A63 A;  4JI3 Q;  1W3S A;  1UE7 A;  1YIJ A;  4NXN L;  1BBU A;  4MTN A;  3H3V I;  1Y1W H;  1I50 H;  4GN4 B;  3OTO Q;  5LMN L;  2L4L A;  5LMU Q;  2Y0S G;  4BY7 G;  4JI3 L;  1L1O B;  4X6A H;  4A75 A;  3RN5 A;  3OTO L;  4NXM Q;  5C44 H;  1VQF A;  3HOX H;  1QVC A;  1Y1V H;  2ZJP A;  4BY1 H;  2C35 B;  1O7I A;  1OXT A;  1C0A A;  3I55 A;  1LYL A;  1DGS A;  4JBW A;  4IO9 A;  4H02 A;  3T1Y L;  3CCM A;  1X55 A;  4NXM L;  4IFD J;  2ID0 A;  2AWO A;  2LXJ A;  1B7Y B;  3GO5 A;  4LF6 Q;  2JZW A;  4A3G H;  3UDG A;  1PH8 A;  4A3B H;  1X6O A;  4JI7 Q;  3GTQ H;  4L5T A;  4HJA A;  1VQI A;  3PUX A;  4A3M H;  3AFQ A;  4IPH A;  1Y14 B;  4AYB E;  3J81 i;  5DLQ E;  3KDF A;  2VW9 A;  1HR0 W;  4LF6 L;  1VQL A;  3M4O H;  4JI7 L;  2NN6 G;  4BY1 G;  4HJ5 A;  2K50 A;  2PI2 E;  3K8A A;  1Q7Y C;  3IRB A;  3G6E A;  1Q12 A;  1YJW A;  2R92 H;  2WP8 J;  4GLV B;  1A1T A;  1IZ6 A;  5JEA G;  3CQZ H;  3J7Z C;  2OTJ A;  3KDF B;  1YJ9 A;  3I4M H;  4A3G G;  1ESK A;  4AH6 A;  4A3B G;  2CWA A;  3W5O A;  4C3H H;  1GO3 E;  2CFM A;  2K5V A;  5ELO A;  3ULP A;  1J6Q A;  4OO1 I;  3J7A 5;  3I2Z A;  4HJ7 A;  1X9N A;  2YSA A;  3CCR A;  1X3F A;  1YEZ A;  2R92 G;  1NMF A;  2YU9 H;  3U4Z A;  2N8N A;  3EN2 A;  1MJC A;  1WWF A;  1A8V A;  1HR0 Q;  5IWA Q;  1FGU A;  3I4M G;  3HOY G;  2R7Z G;  4LFC Q;  1SE8 A;  3RLO A;  2MQH A;  2Q2I A;  1PH1 A;  3M4P A;  4R4T A;  1Q1B A;  2UXD Q;  2VS1 A;  2AKW B;  3OW2 A;  2IY5 B;  4AQY Q;  4LFC L;  5EAY A;  5FLX c;  1E1T A;  4MNO A;  3PUY A;  1QVF A;  4Y52 H;  1BBW A;  5C0X G;  5FLM G;  2UXD L;  1VQE A;  1Z9F A;  1JJC B;  4JG2 A;  3KJO A;  4A3C H;  5BR8 Q;  4AQY L;  3S1R H;  3FP9 A;  2A1A A;  2LI8 A;  2XTI A;  3TEH B;  1RIP A;  3HKZ G;  1N8R C;  4DV5 L;  1EFW A;  4JV5 Q;  1Q82 C;  2OQ0 A;  3CPF A;  4A3E H;  4DV6 Q;  1N36 L;  5M3M H;  1Q1E A;  1PH5 A;  1TWC H;  2CKZ B;  1GKH A;  1XNR Q;  2RHQ B;  2XGT A;  4KI0 A;  4JV5 L;  2LSS A;  4BBR G;  3KJP A;  4PZ7 A;  4R4C A;  1X54 A;  4JI1 L;  3TQY A;  4DV6 L;  2OWO A;  3PUZ A;  3MXN B;  1XNR L;  2F4V L;  5IT9 c;  3HKS A;  3J80 c;  4A3I G;  4A3F H;  1SMX A;  4DR6 Q;  2HQL A;  3CD6 A;  4A3D H;  3HFZ B;  3D0F A;  5E7N A;  4HIO A;  4UP9 A;  1HZC A;  1OXX K;  1FVI A;  1UE6 A;  4XIG S;  4YWK A;  1SR3 A;  1XPU A;  2Z0S A;  2I0Q A;  4JI0 L;  2E8G A;  2E5L Q;  1E24 A;  2ZTC A;  1EWI A;  1Q46 A;  4XTC S;  1EIF A;  1EOV A;  2Z6K C;  2UU9 Q;  1VCI A;  2K52 A;  2RCN A;  4GLA C;  3HOU G;  2YTY A;  4POG A;  4RG1 A;  3HOV G;  2WB1 E;  1MJE A;  1TWA H;  1L2F A;  2E5L L;  3AYH B;  4DNI A;  1CKM A;  2JA7 G;  1N33 Q;  3PO3 G;  4YY3 Q;  1E7Z A;  4JI2 Q;  4DAY B;  4LF8 Q;  3W1G A;  1ASZ A;  1E1O A;  5C4X G;  2ZTD A;  4PZ6 A;  5M5W H;  3PIO A;  3PO2 H;  1EQR A;  5GAD C;  4A3L G;  4BBS G;  3STB D;  3WWV A;  3NYB B;  4X65 L;  4JBM A;  2R7D A;  3FKI H;  4DAM A;  1N33 L;  1QZG A;  2OTL A;  1TWF H;  4GS3 A;  4JI2 L;  3S1Q H;  5FJ8 H;  4BXX H;  3H0G G;  3PUW A;  1NJI C;  2ES2 A;  5J3B A;  4TVA B;  1LTL A;  1QZH A;  5IY0 A;  3CMA A;  1HNX L;  1D8L A;  1YNX A;  3F2D A;  2UUB Q;  3H3V H;  4DR4 Q;  2R6G A;  3U4V A;  2WAQ G;  4IJH A;  5HGQ A;  3ULJ A;  2AWN A;  4JI6 L;  3F2C A;  1HNW Q;  1YZ6 A;  2VL6 A;  4DR4 L;  3UE0 A;  3CC4 A;  4IFD I;  1BJ6 A;  4C2M H;  2JE6 I;  3Q8D A;  1IBK Q;  4OWT B;  3PF5 A;  1HNW L;  4UP8 A;  2AHO B;  1QVG A;  4YHH Q;  1I94 Q;  1V1Q A;  1B70 B;  1PHJ A;  2ALY B;  1X65 A;  4A93 G;  1HZ9 A;  4DUY Q;  2DUD A;  1S3O A;  3H15 A;  5K36 G;  1KXL A;  1PYB A;  4YHH L;  2YTV A;  1GVP A;  4UP7 A;  5LMU L;  3CAM A;  2K4K A;  2DGY A;  2I5M X;  3UE1 A;  4DUY L;  1G51 A;  3K81 C;  2VQF Q;  5H1S E;  3L2P A;  1VQ4 A;  2HT1 A;  2JEA I;  1XMO Q;  2N49 A;  1JMC A;  4JYA Q;  3EBE A;  4EQ5 A;  1B8A A;  3I56 A;  2BA0 A;  1UE5 A;  3S1N H;  1PYS B;  4JI8 Q;  1N34 Q;  2ZM6 Q;  4LUV A;  1X56 A;  3UDI A;  4R4Q A;  2VQF L;  4A3K H;  1VQC A;  4DR5 Q;  2JA6 G;  1N32 Q;  1XMO L;  2F52 A;  4JYA L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...