3TS2A

Mouse lin28a in complex with let-7g microrna pre-element
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
135
structure length
135
Chain Sequence
QLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSINHMVASCPLKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords Protein lin-28 homolog A
publication title Molecular Basis for Interaction of let-7 MicroRNAs with Lin28.
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00098 zf-CCHC Zinc knuckle
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3ts2A01
4.10.60.10 Few Secondary Structures Irregular HIV-1 Nucleocapsid Protein Zinc finger, CCHC-type 3ts2A02
1VQ4A 4HJ5A 4LFBQ 4JOIA 1N36L 1D8LA 2PI2A 2WAQG 4JG2A 1N33L 1VQBA 2EC7A 5JJKA 1EWIA 3GTKH 3OTOQ 2YTYA 4QGUA 1K8AC 3T1HQ 4DR1L 1HR0L 2B63H 1PVOA 3H15A 3UE1A 4RG1A 3HKZG 1LUZA 3TS2A 2R6GA 4IFDG 5LMNQ 4BY7H 2JJQA 2GVBA 2JA5H 3DLLA 3HOWG 1OXUA 4DV3L 1VQJA 2LXJA 3OYYA 4DPGA 5C4XG 1UE1A 5M5XH 1NBWA 3HOYH 4A3KG 4NXML 3H3VI 1F6UA 2Y0SG 4P73A 2AMCB 1K9MC 4OWWB 2N78A 2CKZB 4DV1Q 4A3BG 3M7NA 1GKHA 1VCIA 1EUJA 1GVPA 1IBLL 5C0XG 2KCMA 3HFZB 2R7FA 4A3LH 2HIXA 4R1JA 3J81i 4DV7Q 2PQAB 1PV4A 3K81C 1H95A 4A3EG 4YWLA 3S24A 2F4VL 4AQYL 2PQAA 1UE7A 3GTJH 4DR5L 3TEHB 2VW9A 2FXQA 1B8AA 2C35B 1PH3A 4JI7Q 4A3IH 2UUCL 3UDFA 3HOZG 4IPHA 2JEBI 2UXCQ 2M3ZA 3I4NH 1TWCH 1O7IA 2LSSA 2ES2A 2OWOA 5LMNW 1BBUA 3CMEA 1CSQA 2IT1A 1ESKA 4YY3Q 4HIMA 4Y7NH 1CSPA 1QZHA 1NMGA 4APVA 2OQKA 1YZ6A 3A0JA 5E7NA 1WWDA 1HNXL 1HZCA 3J81j 4JI4L 1I5FA 3ICEA 2F4VQ 3E0EA 5M3FG 2Z0SA 1X6OA 2WFWA 2MO1A 4BY1G 4DR5Q 3M85A 4P75A 5LMUQ 4PZ6A 2QEXA 5IP9G 3HOVH 2ATWA 1SRUA 1BVSA 4AH6A 1HNWQ 5M5YH 3HKSA 3KLWA 1ASZA 3TRZA 2PNHA 1K83H 3F1ZA 4QL5A 1YJNA 1K0RA 2KENA 3CP0A 3UDXA 5GAEC 1TWGH 4X64L 3S1RH 1XNRQ 2NVQH 4JI8Q 5IYDH 3JAMi 2BA0A 3F8TA 1YITA 1I3QH 1QVFA 4GKJL 4YWMA 2E5LL 1EIFA 4A3JG 1J5EL 3CCRA 2WAQE 4OWXB 2JA7H 3S14H 1VQMA 4JI0L 1S3OA 3PO3H 2LI8A 4NB3A 1YHQA 3S16H 2VQFL 3CCUA 1A63A 1VQEA 2KHIA 1I94L 1KC8C 1OXVA 5FJ8H 4PZ8A 2E2JH 2RCNA 3HKZE 3ULJA 1YBYA 3H3VH 4WJ3M 2Z6KC 4DUZQ 3CPWA 1S72A 3PO2G 2HT1A 4GKKL 2Q2IA 4EX5A 1VQDA 1VQGA 4QY7A 3BZCA 2MFIA 4DV5Q 1YI2A 4KHPQ 2NVYH 2JE6I 4A3GG 5FLMG 4OX9Q 2Y0SE 1N32L 2K75A 5ELOA 1ASYA 2K5VA 3S1MH 3UDGA 1VQ9A 1PH8A 4JI6Q 4BBSG 3J80i 1IBMQ 2UUBQ 4LF8Q 4A3MG 2UU9Q 1L2FA 4J15A 4P71A 4B3MQ 4GOPB 1XTDA 4BXXG 1FJGL 2CWAA 4GNXC 4QQBX 4DUYQ 4GOPA 1Q1BA 1VQAA 5HGQA 5GAHC 3GTPH 4L5TA 1VQIA 5IWAL 4LUZA 1UE5A 4DR2Q 4LFAL 2R92H 3HOXH 4B3TL 4JV5Q 1EIYB 3VDYA 3L0OA 1N8RC 2QGQA 1XJVA 1WWEA 1X65A 1YHAA 4JI1L 2B63G 1E7ZA 2F3IA 4LF5L 1Q46A 2WP8J 5IYBH 3CPFA 4LF9Q 4NXNQ 1L0WA 2I5HA 2OQ0A 5GAGC 3I7FA 4LF4Q 2AKWB 4L5SA 3H0GH 3GTGH 4A4IA 4BY7G 1Q3YA 1XMOL 2JA5G 1AAFA 2ZTDA 4IFDI 3I2ZA 2K14A 1VQKA 3MEFA 3EN2A 2ZJPA 3HOYG 2XGTA 4JOIC 4QIWE 4PZ7A 3K0XA 4AIMA 2D62A 4YWKA 1XPRA 3S1QH 3KF6B 2E8GA 1VQHA 3UDIA 4DV2Q 3KF6A 1Q7YC 1XNQQ 1KXLA 3NBHB 4OXPA 4DR6Q 3CC4A 3UE0A 3I4OA 4DR7Q 3G6EA 4L5RC 4OO1G 1DGSA 4MNOA 4A75A 1X3GA 4JI5Q 2NZOA 1C0AA 5AJ3Q 4POGA 2VQEQ 3I4MH 2HHHQ 3U58A 4LF6Q 1JB7A 3T1YQ 3WWVA 2ZM6Q 2R93H 4A3IG 1RL2A 4IJLA 1CKMA 1XMQL 1G51A 3RLNA 2VUMH 5BR8L 4KHZA 1TWHH 4ALPA 1EQQA 4JBMA 2R7ZH 1N36Q 2AHOB 1HNZL 1JE5A 2NVTH 1N33Q 1Q3ZA 5J3BA 4YHHL 2UXBL 2JK8A 4DNIA 1X3FA 1Q86C 1YHBA 4DR1Q 1HR0Q 1C7YA 2JA8H 2UXDL 2OTJA 3U4VA 4IFDJ 1X56A 3CCEA 2E2HH 4C3IH 3BU2A 3EIVA 2N49A 1E1OA 4DK6C 4DV3Q 3HOVG 1JT8A 3PCOB 2ALYB 2K5HA 4X66L 2Q2TA 4DR4L 3RNUA 2DUDA 4NXMQ 5IE8A 3D0FA 3J7ZC 4DV6L 3PF5A 4LF7L 1AE2A 4ME3A 2JA6H 2NN6I 1X3EA 4LW1A 3NYBB 3GDEA 4RMFA 2AWOA 4LWCA 5IYDG 2JZWA 3CD6A 1CKNB 5IP7H 2VNUD 2N8NA 1WOCA 1IBLQ 4GN5A 5C0XJ 1VQOA 1VQNA 2UXDQ 1CKNA 2JA7G 3PO3G 1NE3A 1HZBA 1UE6A 1KHIA 1NY4A 1Y14B 1TWFH 4AQYQ 4UP9A 2MO0A 3CCQA 1N9WA 3GTLH 3HOWH 1L1OB 3ZJYC 4R4IA 1HR0W 2BH8A 2UUCQ 1E24A 2B29A 1QVGA 1N34L 3BJUA 4JI2L 1L1OA 4UPAA 4X65L 4DR3L 1YIJA 1PH5A 4X6AH 1QUQB 2YSAA 4QJFA 1QUQA 4BBRH 4BA2I 3CQZH 1HNXQ 4JI4Q 1CUKA 1YEZA 3KF8B 3M9BA 4JYAL 2AWNA 3Q8DA 2NVXH 1CKOA 3TQYA 5C4JH 3I56A 3CC7A 1V9PA 2IHEA 1U5KA 3KDFB 5JEAG 1OXXK 1V1QA 5FLXc 1GD7A 2NZHA 1Y1WH 1W2BA 1MKHA 3KFUA 1SN8A 2HIVA 4LUVA 3JC66 3F2CA 4KLKA 4LFCL 3KDFA 5GADC 4R4OA 3PUZA 1S40A 1PH7A 1A1TA 3LGJA 3TREA 5M3MG 2KHJA 3EBEA 4GLAC 5GROA 1Q8KA 4BBSH 4DV4L 3CCLA 1KL9A 3G48A 1HH2P 1Y1VH 3HOXG 4PG3A 4X64Q 4B3SL 2R92G 3D31A 3K7AH 4A3CH 3CCJA 4JBJA 1K3RA 1J6QA 1SMXA 3M4QA 5K36G 2CFMA 1VQ8A 4A3DH 3ER0A 3TS0A 4A93G 1K8GA 2ASBA 4GKJQ 1PH4A 5IYBG 2E5LQ 1WCMH 4OWTB 1J5EQ 2Q2UA 1IBKL 3CW2C 4JI0Q 3HOUH 3K80C 3H0GG 1LYLA 1JMCA 4K0KL 4GN3B 4A76A 2VQFQ 4O2DA 4IOCA 1MJCA 3W5OA 5M3FH 1OXSC 1WFQA 1I94Q 4B3RL 4GOPC 2KCTA 2L4LA 1NMFA 4DV0L 1VQLA 5IP9H 1VQPA 2CCZA 2EXFA 2EQSA 2KBNA 4L5QA 1E22A 4GKKQ 3PSIA 1EFWA 3KOJA 1VQ6A 4IO9A 4JBKA 4HJAA 3U4ZA 3I55A 4YCWA 1N32Q 4XTCS 2IHFA 1E3PA 1KRTA 4C2MH 2Q2HA 3FP9A 3J81c 2IX0A 4IJHA 4MZ9A 3NEMA 4A3JH 3I4MG 3PIPA 4YCVA 1EYGA 4OO1I 4P72A 2R93G 1B70B 1V43A 4X62L 1FJGQ 1Z9FA 4XIGS 3SGIA 2VUMG 1WI5A 2R7ZG 3FHWA 3F2BA 5IWAQ 1KAWA 4LFAQ 1D7QA 1P8LA 4B3TQ 3PV0A 1IYJB 4LFBL 3L7ZC 1HZAA 1Z47A 1X54A 1LM0A 2GN5A 2YTVA 2MNAA 1I50H 5IYCH 3U50C 4JI1Q 3GTOH 1VS0A 2JA8G 4A3LG 4HJ7A 3KJPA 4LF5Q 3K7UC 5C0XI 1UWVA 3OTOL 2VY3A 3T1HL 2RHQB 1R9TH 1XMOQ 3AYHB 5JJIA 1G6PA 2HQLA 1PH9A 3S2HH 5LMNL 4JI3L 1IL2A 5ELNA 3STBC 2GVAA 1B7YB 4JBWA 1P16A 2VL6A 4MTNA 2UUAL 2YV5A 4A3FH 1X9NA 1K73C 4GLXA 2ZJQA 2JA6G 3I4NG 3M4OH 1HNWL 1JJCB 3FKIH 2CQOA 3PGZA 1OTCA 5DLQE 1T9HA 2V1CC 3JAMc 5IP7G 1M90C 2CQFA 3OW2A 3K8AA 3PUWA 4DV1L 1PH6A 3CCMA 1FGUA 4C3HH 5HY6A 3S2DH 3W1BA 3RR5A 3A5ZB 4DV7L 1E1TA 2BA1A 4DKAC 3W1GA 2VS1A 4JI3Q 3G71A 2JQOA 5C44H 3AFPA 3RLOA 1XPOA 4HJ9A 2E2IH 4A93H 5C3EH 1XMQQ 2H5XA 4JI7L 5BR8Q 2F52A 1WWFA 2ZJRA 1Q1EA 3PUVA 2I5MX 1TWAH 4HIOA 1MJEA 1HNZQ 3PUYA 3A74A 2A19A 1YJ9A 2UXCL 2YTXA 4AYBG 4YHHQ 2UXBQ 1A62A 2K50A 3CF5A 2EIFA 4BBRG 4HJ8A 4YY3L 3CCSA 4UP8A 3S15H 5M5WH 1VQ5A 1XPUA 2EXDA 1VQ7A 2IX1A 2I0QA 1U0LA 3J80c 3RLFA 2JEAI 4JC0A 1Y1WG 4TVAB 2YYZA 1QZGA 1JJ2A 4X66Q 5FJ8G 1SE8A 1L1OC 5LMUL 4DR4Q 1W3SA 2WB1E 4R4CA 3ERSX 4FDBA 4TQUS 5C4XH 1OXTA 4DK3C 2XTIA 4DV6Q 4HIDA 1GM5A 5GQOA 4LF7Q 3S17H 1WJJA 2JA9A 1Y1VG 2R7DA 3RN2A 4A3KH 1BKBA 3G4SA 2RHSB 4A3CG 1AH9A 4GLVB 1LTLA 1KRSA 4YCUA 3B6YA 1WYDA 3GO5A 4H02A 1XNRL 3NENA 4BA1I 3BZKA 4JI8L 4A3BH 4P74A 1IXRA 2OCEA 4A3DG 1WCMG 3RZDH 4O0AA 1MFSA 1JJGA 3HOUG 3J7A5 4GS3A 1UEBA 4IPDA 3AEVA 1WWGA 1C9OA 4Y52H 1NJIC 1PYBA 5EAYA 4C3JH 4A3EH 1RIPA 1Q12A 1N34Q 2BH2A 1BJ6A 3M3YH 4JI2Q 2QA4A 2I5LX 2NN6G 3HOZH 4X65Q 2RF4A 2ZTEA 4DR3Q 4LUOA 4DUZL 2A8VA 4UP7A 3DM3A 3CAMA 1YNXA 3PIOA 4GN4B 4DV5L 4KHPL 3NELA 3AFQA 2IY5B 4OX9L 1A6BB 2LXKA 3S1NH 5IY0A 4EQ5A 4JYAQ 1PYSB 2A1AA 3RN5A 2OTLA 2UUAQ 1FVIA 2ID0A 1QVCA 5JEAJ 4DAMA 3CXCA 1PA6A 4JI6L 1A8VA 1Q81C 2YU9H 1IBML 3E9IA 1PH1A 2UUBL 4BY1H 4LF8L 2UU9L 4LFCQ 1TXYA 2D0OA 1SR3A 4B3ML 1M1KC 3MXNB 1Q82C 4WJ4A 2K5NA 4DV4Q 3GTMH 1NTGA 3ULLA 4JCVE 2PI2E 2B3GA 3KJOA 4DUYL 1SFOH 4B3SQ 4LNQA 1VQFA 1U6PA 1HZ9A 2VZAA 3PUXA 4DR2L 2Z6KA 5IYCG 4JV5L 1X55A 1EOVA 2DGYA 5IT9c 3IRBA 4IPCA 1IBKQ 1VQCA 2D0PA 2K4KA 4AYBE 4NXNL 4NPSA 2WB1G 1SLJA 4PMWA 4LF9L 4K0KQ 1FL0A 4LF4L 3L2PA 4B3RQ 1PFSA 4IOAA 1SROA 2K52A 3STBD 1BBWA 2PMZE 4DV0Q 4A3FG 1HJPA 4IPGA 5JJLA 3E9HA 4POFA 2MQHA 1YVCA 3FKIG 4DAYB 5M3MH 2L15A 2ZTCA 4GNXB 1PHJA 1GO3E 4HIKA 3F2DA 1KIXA 3KYHC 4R4TA 1PH2A 3GTQH 1EQRA 3CC2A 3PO2H 2IHXA 4GNXA 4R4QA 1G291 4A3GH 5FLMH 4DV2L 3AQQA 2N3SA 1KD1C 1XNQL 1AE3A 4DR6L 3A5UA 4DR7L 3GD7A 3CCVA 2CWPA 5H1SE 1MIUA 3RZOH 4JI5L 5C44G 5AJ3L 2VQEL 1IZ6A 4UY8C 1A0IA 3PF4A 4X62Q 5C3EG 1YJWA 2HHHL 4A3MH 4OONA 3T1YL 2ZM6L 4LF6L 1I6HH 3CMAA 1KQSA 4BXXH 3M4PA 3ULPA 4KI0A
chains in the Genus database with same CATH superfamily
2F0HA 1B2TA 5IGBA 4JG2A 3AMUA 1VQBA 4A3KB 3D4WA 4K5WA 2Q8IB 3TBIB 1ENAA 2QF7A 1J8IA 1SYFA 4QGUA 1PVOA 3H15A 1AZQA 1V1PA 2JYOA 1LUZA 4IFDG 2OXPA 2JJQA 5C4JB 5C4XG 1NBWA 3K0YA 1I4XA 3H3VI 1F6UA 1B53A 3M3YB 2PW7A 2N78A 4DV1Q 4A3BG 2B8FA 1H9RA 3I3CA 1EUJA 2IW3A 1SMYC 3J81i 4A3DB 3K81C 1H95A 1PRTC 3CKIB 1LT3D 2LY7A 5DAUA 1PFMA 1TKWB 3GTJH 2VW9A 1B44D 2FXQA 2RA4A 2C35B 4TRDA 3HOZG 1RD9D 4BY1B 1TR5A 2JEBI 2M3ZA 1O7IA 1WTPA 1L0YB 2K05A 2LSSA 2OWOA 1GUWA 5LMNW 1R4PB 4O1NA 4HIMA 1O7LA 3VR5A 5CC4A 1QZHA 4APVA 3SK6A 3QR8A 1HNXL 4JI4L 1GUOA 3VR3A 5M3FG 2Z0SA 2WFWA 2MO1A 3M85A 1T5EA 2GA4B 4KK7A 3TZDA 2KHSA 5IP9G 1JOOA 1SRUA 1BVSA 5M5YH 1IYUA 3EJIA 3KLWA 3TRZA 1K83H 1K0RA 2K03A 1UEAB 5GAEC 2NVQH 1HUMA 3PO2B 1FNWA 4GKJL 3A8JE 4A3JG 1EEFD 3GTOB 4OWXB 4A3GB 4JI0L 3BVZA 1YHQA 1BBXC 3CCUA 3RZOB 1OXVA 2E2JH 3HKZE 3ULJA 3H3VH 4WJ3M 1STBA 2A73B 2FHTA 2HT1A 2PZWA 2Q2IA 3BZCA 1BCPD 3P20A 3ND9A 3NPPA 1N32L 5E4WC 1KNAA 2NTTA 3UDGA 1PH8A 3WDNA 3DM1A 1QCBD 2F0MA 3QJYA 5JEAH 1L2FA 5IIFA 1EY5A 2D5DA 2CWAA 4GNXC 5JOBA 4QQBX 2KOLA 2JA5B 1Q1BA 1VF7A 2QDBA 5DNFA 4L5TA 1VQIA 1WD0A 3FPUB 3HOXH 4B3TL 2OEOA 3X3MA 3R2IA 1N8RC 1CI3M 1XJVA 1HCZA 2B63G 2I07B 4NXNQ 1Q46A 5IYBH 2F3WA 2E2DC 1K28A 2OQ0A 1EEID 3I7FA 4ZYSA 4C1NK 5M5WB 5ELFA 4A4IA 1SNQA 1XMOL 4IFDI 3I2ZA 2RSOA 1AW7A 3HOYG 1K8MA 4JOIC 4QIWE 1ZKOA 3E6ZX 2D62A 1B4OA 5E3FA 5C4XB 1CZGA 5F2DA 3A8KE 5C5MA 2H4OA 1VQHA 4KY6A 1SNDA 2A74C 3KF6A 1Q7YC 3OWFA 3KBXA 3BG3A 1WTHA 2XNAC 1RTNA 4OO1G 4A3BB 3MZ5A 4JI5Q 3HZXA 4POGA 5FLXL 3U58A 1I4QA 1RL2A 4IJLA 3VYTA 2KECA 5J22A 2R7ZH 1TWHH 4HAEA 2BCOA 2ICIA 3HOVB 3URYA 1N33Q 1Q3ZA 5C3WA 1U4PA 4G7OC 3D6WA 1I3QB 3BDOA 4G57A 4TKOB 3CCEA 4V190 4C3IH 1PFBA 4V0BA 3R8BA 4DNRB 3T13A 2ALYB 2K5HA 3LX0A 2Q2TA 3RNUA 5IE8A 5L37A 2KQ3A 3NYBB 2AWOA 2K33A 2JZWA 3CD6A 1CKNB 2VNUD 3NQIA 1IBLQ 5C0XJ 1VQOA 3BVMA 3J81L 2NVYB 4F8MA 3NHHA 3G6JB 4KHVA 1V1OA 1D1IA 2NZ1D 1TWFH 2Q8TA 4CDFC 2HCCA 1RHPA 3C1FA 2J7ZA 3BS1A 2UUCQ 2BH8A 2B29A 3MTSA 1QVGA 2F0FA 4X6AH 1B1ZA 1QUQB 5M3MB 2YSAA 5EJWA 1AFPA 4BBRH 3DHQA 4RGTA 3C46A 2AWNA 1V9PA 1LTID 2IHEA 2MHVA 2SNMA 1V1QA 3KF8A 1FR3A 3QOLA 2NZHA 3T56B 1B50A 4LUVA 1Y8PB 3TSSA 1PH7A 2O5IC 3H0GB 3PUZA 1S40A 2CH4W 2L11A 4GLAC 3TP6A 1SDFA 1Z7TA 4ZAIA 1HH2P 2K28A 3D31A 1ILPA 1J6QA 5K36G 2CFMA 3ER0A 1K0SA 3QB3A 1K8GA 2R3ZA 5BN3A 4K14A 4F7XA 4QCLA 1KLGD 5M3FH 4RA8A 1OXSC 4KD3A 2KUMA 2KCTA 1DOLA 1EQVA 2LKVA 3RMHA 2L0CA 5IP9H 2QILA 3Q6SA 2EXFA 2JXMB 3A7AB 1II3A 1E22A 4GKKQ 2QCPX 3HOYB 1EFWA 2VUMB 3R3OA 4IO9A 2FINB 2B2TC 4XTCS 4C2MH 3FP9A 4IJHA 4MZ9A 4OO1I 4A3JH 4YCVA 4B08A 2R93G 4LAAA 2K01A 1FD7D 4X62L 1LTBD 2B2UC 1WI5A 2BOSA 4FO2A 1IYJB 3L7ZC 4XT3B 3TN2A 1X54A 2MNAA 3EVQA 1I50H 4DU9A 3CU7A 2F0WA 4LF5Q 5KEEA 2EYHA 2RHQB 2XRSD 3H94A 2MJ8A 1G6PA 5JJIA 1AP0A 2HQLA 2F0PA 3MFYA 4WFN3 1IL2A 3STBC 3DMUA 2VL6A 2YV5A 1X9NA 3M4OH 2C9OA 2JA6G 3NP8A 3J7YW 3FKIH 2CQOA 1T9HA 2A69D 1NCVA 3JAMc 3I72A 4N8X1 4ZQ3A 3PUWA 4DV1L 2VB3X 2FFKB 5C4ZA 5HY6A 1D6EC 3WOEA 3V96A 3RR5A 5FLXE 2L4NA 1BOSA 3W1GA 2VS1A 5TSSA 3NWTA 2B39A 4C56C 5C3EH 5BR8Q 1Y1WB 2ZJRA 4RH6A 1HNZQ 3A74A 3ZYYX 4J8QA 1KDAA 4AYBG 4BBSB 1WTXA 1PZJD 5JPNC 5KNBA 3CCSA 3K7AB 3WOFA 1XPUA 2EXDA 4OHJA 1TVXA 4OO1H 1GUGA 3RLFA 4TVAB 2YYZA 3QIAA 1SE8A 4R4CA 2PYKA 4FDBA 1GM5A 4HIDA 1I4PA 4A3CG 1EWHA 3PQIA 1LTLA 2ZXRA 1WYDA 4ZUJA 4BA1I 3J81E 3BZKA 2OCEA 1PFNA 1WCMG 1YNJD 1JJGA 3SK5A 2E76C 4IPDA 5KIXA 1EIGA 4A3EH 1O7ZA 3S9WA 2BH2A 4XYOA 4FF4A 3NWSA 1QNKA 4X3SA 4DR3Q 2L55A 4LUOA 2B2VC 2A8VA 3CAMA 1YNXA 3NELA 3S1NH 4KKTA 4K5VA 1WTOA 2ID0A 1X3QA 3CXCA 2M2LA 3E9IA 4LFCQ 1IKMA 4HR7B 1O78A 5CYUA 1HRJA 4F88A 3S2HB 4WJ4A 2K5NA 4DV4Q 2PI2E 2B3GA 1SNMA 5ELEA 1SFOH 4B3SQ 1U6PA 1HZ9A 2VZAA 3CRKC 3D6CA 3PUXA 2Z6KA 3ITPA 5CV5A 2DGYA 1JCKB 4BS9A 5IT9c 4Z9CB 2K7VA 1SYDA 3L9AX 3LWEA 4NPSA 4NXNL 4PMWA 1FL0A 2G9DA 1HA5A 1SROA 2K52A 4IPGA 1YVCA 4FP5D 3KLSA 1PHJA 3GTQH 4RCOA 4RHRA 1BCPF 2JA6B 2DY7A 5EKKA 1AE3A 3GD7A 4JI5L 2ZXPA 5C44G 3PF4A 2IWHA 1EY7A 3HKZB 5ISRA 2XWBB 1KQSA 3ULPA 1JE4A 1VQ4A 3HOWB 2K5WA 4LFBQ 2EVBA 1D8LA 2PI2A 2WAQG 1N33L 2EC7A 1IYVA 3OMCA 1EZ6A 4AYBB 3T1HQ 2EE1A 3KK7A 1BUVT 1XXGA 3CQZB 4RG1A 2LFNA 2K04A 2GVBA 3EQLC 1VQJA 3OYYA 4DPGA 1UE1A 2EY5A 4A3KG 2BE5D 2DN8A 2EY2A 1DOMA 1D1KA 3GV3A 5KYLA 1W6JA 5D65A 1IBLL 5C0XG 4R1JA 2DJFC 2PQAB 2VXWA 2NUCA 1PV4A 1LT4D 1S4ZA 4Q0FA 3K5NA 4CHTB 2F4VL 1ESRA 5KYIA 5KNCA 2RDFA 2UUCL 1TWCH 5IGFA 1BBUA 3CMEA 2IT1A 4FXGC 4YY3Q 1K3BC 4Y7NH 1CSPA 1HTLD 1ENFA 1YZ6A 3A0JA 5FO8B 1X6OA 4QF4A 4BY1G 4DR5Q 1KABA 4P75A 1EY6A 4PZ6A 1LACA 4IUTA 4AH6A 2PNHA 4IUQA 5JJZA 2KENA 3UDXA 3CP0A 1YJNA 2N88A 2EXZA 1XNRQ 1RF2D 2BA0A 3F8TA 3RD4A 1QVFA 2JA7H 3CCRA 3GQBA 3S14H 1TY2A 3BVGA 3F2UA 3R93A 3IFDA 2DY8A 1EIHA 2KHIA 2BDOA 1KC8C 2F0TA 3HGBA 2RCNA 1PLFA 1I6HB 1SSOA 5FKAC 3BDLA 3PO2G 1A3TA 4GKKL 1ILQA 4EX5A 1YI2A 4QY7A 1RODA 2MFIA 4HSPA 3PIP3 4DV5Q 2JE6I 4A3GG 1HHVA 2Y0SE 4EQPA 3NUCA 2K75A 1DONA 5KRUA 5DM63 1HQRD 3HEJA 1IBMQ 2UUBQ 2UU9Q 1I4RA 2B2YA 4J15A 1EZ8A 1XTDA 4GOPB 1LTSD 4X3KA 4BWGB 5C44B 5EQ0A 4DUYQ 2F0GA 3GTPH 4LUZA 1RDPD 4JV5Q 1IKLA 4KMUC 1TWAB 3L0OA 2QDLA 2QGQA 4HSVA 4K2LA 1E7ZA 3O13A 2WAQB 3MC0B 4LF5L 1EU4A 3S15B 3GTGH 2I46A 4BY7G 1Q3YA 2JA5G 2DNEA 2AQ1B 1UNSA 2RKSA 5I2YA 2XGTA 1ZEQX 3T16A 3GTJB 4AIMA 2V4DA 1STGA 2KEEA 1F2ZA 3S1QH 1NSNS 3UDIA 4DV2Q 4FXDA 1XNQQ 4OXPA 1ESFA 5DM73 4DR7Q 3I4OA 3G6EA 2O2LD 1DGSA 2AQ3B 4MNOA 3NBHA 2CQAA 2NZOA 3RZDB 5G3LF 1DZ1A 2VQEQ 3I4MH 3DWAA 1JB7A 1NR4A 2ZM6Q 4A3IG 2MPMA 1F9RA 2SDFA 4B9WA 2A6ED 3RLNA 5JVG3 4ZKBB 5BR8L 1LO5D 4IALA 1EQQA 3K6OA 1N36Q 1HNZL 2RBMA 5M5YB 4RAUC 3OSOA 1B3QA 5J3BA 1S5CD 1CHQD 4NKLA 2JA8H 3FRPB 4UHVA 2EJGC 1HR0Q 2F0NA 3U4VA 2E2HH 1JT8A 3HOVG 1ML0D 4NXMQ 3J7ZC 3K5LA 4N9TA 1AE2A 2PZUA 4RMFA 2A69C 5CR3A 5IYDG 4K8JA 3TP8A 4GN5A 1VQNA 2F0OA 2K6AA 2UXDQ 3PO3G 1NE3A 1KHIA 3I4LA 1A2UA 4R8IA 5IGDA 1H9SB 2MO0A 4PV1C 1N9WA 3CCQA 1PTOF 3GTLH 1L1OB 2L9HA 3ZJYC 1NUCA 4HMJA 1YIJA 4DR3L 1QOHA 1EY4A 2PQEA 4JVZA 1SNCA 3U9SA 3HOXB 5HGTA 1VMCA 1CUKA 4RWSC 3DUZA 2CW0C 3Q8DA 1LTAD 2NVXH 1CKOA 3TQYA 5C4JH 1HA6A 3CC7A 1W2BA 1OXXK 1MKHA 2RQXA 1SN8A 3JC66 4KLKA 4LFCL 3KDFA 4FNFA 4R4OA 1HFNA 3LGJA 3TREA 5M3MG 2A68D 3HP3A 4DV4L 3CCLA 2R92G 4B3SL 1K3RA 1SMXA 3M4QA 2A6HD 3SK8A 4QUFA 2F0JA 1YNJC 4A3DH 1PH4A 4OWTB 1J5EQ 1Q3LA 3I73A 3H0GG 1LYLA 1MGSA 1EWCA 4A76A 2VQFQ 4O2DA 4ZLTF 1I94Q 3FEWX 4GOPC 1EOTA 1KNEA 1VQPA 5LHY1 4BY7B 3NK9A 2PPBC 3TP7A 1H9KA 1VQ6A 1TWHB 1EL0A 4HJAA 2O5JC 1S5ED 1G6ZA 2IX0A 2B2WA 1Q8IA 2VUMG 3OIQA 4C3IB 3A8IE 3F2BA 1NR2A 1AEXA 5IWAQ 4A3IB 4LFAQ 1TS2A 1P8LA 2LS01 1D7QA 3PV0A 4LFBL 2GN5A 3I4NB 1LM0A 3ONAB 5IYCH 4JW0A 3GTOH 4A3LG 3KJPA 5EGTA 3K7UC 1LTRD 1UWVA 3T1HL 4IUPA 3AYHB 4EGVA 2ENBA 4ILWA 3I91A 2GVAA 2UUAL 1P16A 1TWFB 2AUKA 2TMPA 4GLXA 1K73C 2PO4A 4S3SA 5DLQE 5IP7G 2JN4A 1A6XA 1TWGB 3S2DH 1E2WA 2M00A 3A5ZB 1E1TA 5IODA 4JI3Q 1XPOA 3RLOA 2E2IH 1PZKD 2JP1A 4HJ9A 4A93H 3PO3B 1XMQQ 2H5XA 2VB2X 3DXJC 3S16B 3Q23A 4HIOA 1KAAA 1AN8A 4H0LC 2YTXA 4YHHQ 4DXGA 3OHXC 2F0SA 4HJ8A 4YY3L 4Q5VA 1D5XC 5M5WH 5A2QL 2IX1A 3J80c 2Z9HA 1RKNA 2WINB 1Y1WG 2D2CC 4IFDH 3SR1A 3D8GA 1CT1D 1XTCD 4X66Q 1L1OC 1BO0A 3E0JA 5C4XH 1C4QA 4L63B 4BBSG 5M9OA 1WJJA 3W2DA 1Y1VG 4RKLA 1AH9A 3H91A 4FF3A 3G4SA 1TT2A 1KRSA 3B6YA 4XXEA 4H02A 1F2YA 1XNRL 3NENA 4A3BH 4FXKC 1IXRA 4KJOA 2R92B 1EY0A 4O0AA 1DD2A 3HOUG 4GS3A 5EBDA 1UEBA 2KVMA 4C2MB 4LMQD 3GP7A 1Q12A 3A54A 1KTKA 1N34Q 1BJ6A 2I5LX 2NN6G 1HPCA 3EA6A 3HOZH 4X65Q 3K59A 1O7YA 3SVMA 4RKBA 3GV6A 4DV5L 4GN4B 3AFQA 2KA7A 3K5MA 5LL6S 2CH4A 1PYSB 2A1AA 2EY6A 2OTLA 1I50B 1STHA 1FVIA 5JEAJ 1PA6A 1IBML 2UUBL 1LLRD 2UU9L 2WB1B 1M1KC 3MXNB 1A15A 3GTMH 4JCVE 4DUYL 4LNQA 1E2VA 3M4OB 4WJWA 1GUNA 4JV5L 4EQNA 1L0XB 1X55A 3I90A 4CGYB 1VQCA 4KV6A 4K0KQ 1PDQA 5G3LD 4B3RQ 1AZPA 4DN4M 1PFSA 4WRDA 4A3FG 1HJPA 3E9HA 5M3MH 2ZTCA 1KIXA 5C3EB 3F2DA 2RVLA 2H1EA 4ZK9B 1EQRA 1M8AA 1V8QA 2NTSA 1IW7D 3CC2A 4GNXA 4R4QA 1BCPB 4DV2L 4C3HG 4IZ8A 5D3DA 1XNQL 1F9PA 3IL8A 4DR7L 3D3RA 1MIUA 4UY8C 2VQEL 1A0IA 1JOKA 4OONA 2ZM6L 4CKEA 5I4DA 3M4PA 3S1RH 5A35A 1EY8A 4HJ5A 4JOIA 1N36L 4QUCA 4LK1C 1S5DD 2Q8RE 3GTKH 1V1PB 5I9OA 1K8AC 4NW2A 2B63H 1HR0L 3K57A 3HKZG 2R6GA 3P7JA 3D4DA 5IGCA 2PMZB 1OXUA 3HOWG 4DK0A 2LXJA 1PTOD 4QMGA 5M5XH 3HOYH 2XN9C 4NXML 5T1IA 2AMCB 4RGMA 1K9MC 2R61A 1GXDC 2CKZB 1CM9A 4WORA 1GKHA 1VCIA 1Y1VB 3VA5A 2K32A 2KCMA 3HFZB 1WTVA 4A3LH 4K6LA 3OWEB 4DV7Q 2PZTA 3S1NB 2F0KA 4YWLA 1UE7A 3BDCA 3HOUB 3TEHB 4J6HA 2A6EC 1PH3A 3UDFA 2UXCQ 2ES2A 2E75C 1CQFA 5D3IB 1ESKA 3AU7A 3C2PA 3TP5A 1SFOB 2EZVA 4HEDA 1YNND 1NMGA 3KLRA 5E7NA 3FDTA 1I5FA 1I4HA 2EYMA 3SHLA 1HQMC 1KLUD 3N52A 3P75A 2ATWA 3HKSA 4QL5A 1E0BA 4JI8Q 3GTQB 2HDLA 4RGNA 3JAMi 2X6GA 5C3XA 1CFMA 1EIFA 1J5EL 4DFAA 2NYZD 4NB3A 2VQFL 4ZKCB 3PMFA 1VQEA 1I94L 2F0DA 4PZ8A 5KNDA 1YBYA 5DEHA 4DUZQ 4CBVA 2SEBD 4A3FB 1VQGA 3OIPA 5FLMG 3SK4A 3RUZA 5ELOA 1ASYA 2K5VA 3S1MH 4JI6Q 4C3HB 2QW7A 4LF8Q 2D9UA 4X3UA 5CORA 4P71A 4A3MG 2F4IA 4BXXG 2C5CA 1TU2B 1U9RA 2A68C 4DNTB 1VQAA 5HGQA 5IWAL 2F0QA 1SYBA 4DAYA 4DR2Q 4LFAL 1BCPC 3QWNA 1EIYB 3VDYA 2A6HC 5K36H 1WWEA 1X65A 1YHAA 2F3IA 2WP8J 4LF9Q 3CPFA 2B2TA 5GAGC 4LF4Q 4FYDA 2WACA 4L5SA 4FF1A 2Z4HA 2QEJC 1C8CA 1VQKA 3MEFA 3EN2A 2ZJPA 4PZ7A 3K0XA 3K58A 2Z8LA 2B2UA 1XPRA 3KF6B 1Q90A 2E8GA 3S17B 1VMPA 1DJRD 1O80A 3EROA 4DR6Q 3UE0A 3NE5B 1TQOA 4Y7NB 1EYCA 2OT2A 4A75A 1X3GA 3NTKA 5AJ3Q 3MA2B 5CV8A 2R93H 1CKMA 1EU3A 1R4QB 1G51A 2AQ2B 4C3JB 1XMQL 2K5QA 4ALPA 4JBMA 4MHEA 2AHOB 2NVTH 1FGBD 1H9JA 4YHHL 3VR2A 2JK8A 3MWYW 4R8NA 4DR1Q 1U4MA 1U4RA 2E74C 1STNA 5NUCA 3BU2A 3EIVA 2N49A 4IURA 4DK6C 4DV3Q 1H9MA 3S14B 2JA7B 3PCOB 1STAA 4QIWB 1HFGA 4X66L 1TIID 2YU9B 3D0FA 4PQXA 2JA6H 3NTIA 2M9VA 3V2TA 4XDXA 2RDGA 4F87A 3A56A 4LWCA 3H6MA 5BN5A 1CKNA 4L8JA 1F2LA 3VYRA 4AQYQ 4UP9A 3HOWH 1PTOB 4R4IA 1HR0W 1SBBB 1N34L 4TSSA 4IUNA 4UPAA 4X65L 1PH5A 1D2BA 3KLSX 1X32A 5ELCA 2DJGC 3BYYB 3GTPB 4JK1C 3I8ZA 4QJFA 3T51B 1QUQA 1CHPD 4H7BA 3CQZH 3KF8B 3M9BA 1QG7A 3I56A 1U5KA 5JEAG 5ELDA 5FLXc 1GD7A 2HIVA 3F2CA 2OTJA 1A1TA 5GADC 5E1FA 1QJOA 2KHJA 3EBEA 5GROA 4HMIA 4A3MB 1Q8KA 3AB9A 1KL9A 4ODGA 2FJ2A 4KKSA 3HOXG 4A3CH 4X64Q 3JAML 3CCJA 4JBJA 2FMMA 2B2VA 4DGZA 1MI2A 5IYBG 2E5LQ 1WCMH 2Q2UA 1G91A 2XVSA 4K0KL 2FMCA 2Z1CA 1JMCA 4IOCA 1MJCA 1A3UA 2SOBA 1WFQA 1ZYRD 2PNRC 4B3RL 3BYTB 1QE6A 3I4MB 1WTQA 1KDCA 4KN7C 2L5TA 5I6WA 2KBNA 3MAQA 4L5QA 4OL7A 2SNSA 3E5SA 3FPPA 2X69A 1ET9A 1XX8A 3U4ZA 1U4LA 5K5PA 2IHFA 1KRTA 1X3PA 2Q2HA 3J81c 1WTWA 4FF2A 4UAIA 1EQTA 3NEMA 1EYGA 4P72A 2JA8B 1JORA 3VYUA 5I6YA 4ME5A 3IAYA 1G2TA 1V43A 1FJGQ 3HS0C 4ID6A 4XIGS 2E2HB 4GZYC 5T1GA 2R7ZG 3FHWA 1CTMA 1KAWA 3U50C 4JI1Q 2JSOA 4I7AA 4HJ7A 3IFTA 5C0XI 5I2XA 2VY3A 1R9TH 4C3IG 1A2TA 1PH9A 5JVH3 5ELNA 4CKBA 4JBWA 5LL6X 2ZJQA 4K6DA 3I4NG 1JJCB 4DA2A 3DWPA 3R2TA 3DEPA 3GTLB 3PGZA 5COYA 1B3AA 3MFGA 1IW7C 2V1CC 1M90C 1K83B 1F77A 2EOTA 4OEMB 3K8AA 3OW2A 1PH6A 5E4XA 1J9OA 3VR4A 2NVQB 3VA7A 1LT6D 1NNXA 4NP5A 5FO9B 3CRLC 4DV7L 2BA1A 1XYIA 4CDEC 3G71A 2NVXB 2JQOA 4I7ZC 5C44H 4KY7A 1A3VA 4XQQA 2CHBD 1JQYD 2F52A 1WWFA 3M4YA 1Q1EA 3NTHA 2I5MX 1TWAH 1MJEA 5IGGA 2UXCL 3PUYA 4XT1B 2E2JB 3EFXD 1UAPA 2UXBQ 1A62A 2DNCA 2K50A 4BBRG 4DAPA 2IPKD 5IT9L 3S15H 1VQ5A 4KN4C 4K8IA 1VQ7A 3N6RA 1CK1A 2I0QA 1U0LA 1PRTF 1GOZA 2JEAI 4JC0A 5CV9A 1EYAA 3MHBA 5FJ8G 4DR4Q 1PTOC 1GHJA 3PIO3 3ERSX 4JPBW 4DV6Q 4LF7Q 3C3LA 3M7GA 5GQOA 2JA9A 2R7DA 4A3KH 1BKBA 2XWJB 4GLVB 1VF5C 3GO5A 4JI8L 1MHWC 4OIJA 3RZDH 3U9OA 4MTKA 4DF7A 5C0XH 3J7A5 4I65A 3VYSA 3VR6A 3AEVA 1WWGA 1C9OA 2Z4IA 1T5XD 1SNOA 4Y52H 3KBGA 1PYBA 1NJIC 2EYJA 1F9QA 5D14A 2IL8A 1DM0B 4ZUIA 1MSGA 3M3YH 4JI2Q 3QOJA 2A5HA 3MXPA 2ZTEA 1CZWA 4IUVA 4DUZL 3SDZA 4UP7A 1XWEA 3DM3A 5J39A 2F1MA 1YNNC 2XIWA 3SE0A 1A6BB 2LXKA 4JYAQ 3Q0AA 4QB4A 1IHZA 1QVCA 4DAMA 4JI6L 1A8VA 4BY1H 4LF8L 1BR9A 2KEDA 5AFWA 4RCNA 3JAME 5EPLA 1VQFA 1ET6A 2EJFC 4DR2L 2R7ZB 1EOVA 1PYWD 1UUPA 1TY0A 4IPCA 1IBKQ 1MSHA 1JWMD 4AYBE 3KUPA 3Q22A 2F3VA 1SLJA 1QWYA 2NB0A 2WB1G 4LF9L 4LF4L 3S2DB 5I9PA 3L2PA 4DV0Q 3I70A 1BBWA 1SE2A 5C5LA 3P1HA 5JJLA 4POFA 3FKIG 1BQQT 4DAYB 4A93B 2E2IB 3DEOA 1EFID 1RCVD 4R4TA 1PH2A 3PO2H 4O42A 1G291 3X3NA 2PW5A 4A3GH 3AQQA 1KD1C 3DWQA 4DR6L 5EKLA 3L3OC 3RZOH 2WIIB 5AJ3L 1IZ6A 3FVQA 5C3EG 1SAPA 2OF1A 4KY5A 3CMAA 5ELBA 3SXHA 4H44C 5JJKA 1EWIA 3OW7A 3V05A 3MEHA 3OTOQ 2YTYA 4DR1L 1RJTA 1SE3A 3UE1A 4KD4A 4BBRB 3TS2A 3MVVA 2KCCA 5LMNQ 5CV7A 4BY7H 4MIUA 2JA5H 3DLLA 4DV3L 4HTHA 2Y0SG 4P73A 4U673 5CBAE 3H3VC 4OWWB 3HOZB 4ZRZA 3M7NA 3TDQA 1GVPA 2R7FA 3HG9A 2HIXA 2RSNA 3UI2A 4X3TA 1B9NA 4A3EG 3S24A 2HUGA 2F03A 4AQYL 2PQAA 4DR5L 4HCSA 1IL8A 1B8AA 4JI7Q 2P5ZX 4A3IH 5M3FB 4IPHA 1JOQA 2BE5C 1SNPA 3I4NH 5EPJA 4KKUA 2G5DA 1G8ZD 4G7ZC 1CSQA 2MUYA 5IT9E 4IUUA 3GTMB 2EY1A 2OQKA 1WWDA 1HZCA 2XRQD 3J81j 3LNNA 1I4GA 2EYOA 1DCZA 2F0UA 2KJXA 3E0EA 4K2KA 2F4VQ 3ICEA 2QKIC 5LMUQ 4A3JB 2QEXA 3HOVH 1HNWQ 1ASZA 1SXTA 3F1ZA 1KDBA 5J1ZA 4UDUC 3Q24A 1TWGH 4X64L 1STYA 5CBEE 5IYDH 1YITA 2HCIA 2HD3A 3TMEA 1I3QH 1JB3A 1GJXA 4YWMA 2E5LL 2WAQE 3PO3H 5CGKA 1VQMA 1S3OA 1Z6HA 4CJ0B 3S16H 3QO2A 1A63A 1BXTA 5FJ8H 2EYLA 4N8FA 2Z6KC 3CPWA 1S72A 2LI8A 3S1RB 1VQDA 1E2ZA 4KHPQ 2NVYH 3FKIB 4OX9Q 1G2SA 1GUTA 4K5XA 3FMCA 2J4XA 1VQ9A 3GTKB 3J80i 2B63B 3E3XA 4B3MQ 2WV6D 5JAVA 1FJGL 2ICEC 4GOPA 2EPBA 2F0VA 1FYCA 5GAHC 5M5XB 3NBIA 1JWUD 1UE5A 2R92H 1DYQA 1SJHD 1HUNA 1SJED 2HDMA 1ICWA 4JI1L 1LT5D 1EY9A 1L0WA 2I5HA 4EQOA 2AKWB 3H0GH 1ZYRC 1AAFA 2ZTDA 2K14A 4OELB 1LABA 2PCFB 1LV9A 5EPKA 4YWKA 5IOCA 1JWSD 4OGQC 2Y0SB 3H09A 1KXLA 3NBHB 3CC4A 4DXFA 4FVMA 1SMYD 4L5RC 4CJ1B 1STEA 1C0AA 3OPOA 1BDOA 1PRTD 2HHHQ 4LF6Q 4J1MA 3WWVA 3T1YQ 4CDDC 4H13C 3G7LA 4MN3A 4A3EB 2VUMH 4KHZA 1Y69U 2X6LA 3NQTA 1JE5A 2UXBL 4DNIA 2RCFA 1X3FA 1Q86C 1M4VA 1YHBA 1B9MA 1LTTD 2IJ0A 1C7YA 1ONLA 2UXDL 2IX3A 1WVLA 1VDZA 4IFDJ 1X56A 4C3JG 1E1OA 4DR4L 2DUDA 3T4AC 2KCNA 4HN7A 4DV6L 3PF5A 4LF7L 4ME3A 2NN6I 1X3EA 2N55A 4LW1A 3GDEA 2O4XA 1SYGA 4PMCA 5IP7H 2N8NA 1WOCA 2ZT9C 5A2QE 2JA7G 1HZBA 1UE6A 2CW0D 4M1UB 4EVOA 1NY4A 1Y14B 1BF4A 5EKIA 3S1MB 3NSWA 1WTRA 2G9HD 4XQNA 5CMDA 1H9SA 1E24A 3BJUA 4JI2L 1MBYA 1L1OA 2Z6BA 1SYEA 1GUSA 4CJ2C 2K5DA 4BA2I 1QNUA 1HNXQ 4JI4Q 1YEZA 4KTAA 4JYAL 4NMZA 5FK9C 3KDFB 3KFUA 1Y1WH 2ZXOA 1W6KA 2L1BA 3IKJA 4ZCKA 4BBSH 4RGOS 3A55A 3G48A 1Y1VH 4NDXA 4PG3A 3K7AH 1PXUA 4U68A 1F2MA 1TS3A 2RDHA 1VQ8A 3TS0A 2ASBA 4GKJQ 1ICFB 3NXWA 1IBKL 3CW2C 1PMRA 2B2YC 3K80C 4JI0Q 3HOUH 1Y8OB 4GN3B 3W5OA 1NAPA 1NMFA 2L4LA 4DV0L 1VQLA 2CCZA 3SEBA 1CA6A 2R93B 2EQSA 2NN6H 3PSIA 3J7AF 4N9PA 1Y8NB 3KOJA 4CDCC 4JBKA 3W3AA 3I55A 4YCWA 1N32Q 2NVTB 1E3PA 1WD1A 1ENCA 4BXXH 4PMBA 2B8GA 1SE4A 3J80L 3I4MG 3PIPA 1SYCA 1DXMA 1B70B 1D5ZC 1EYDA 4LJZC 1Z9FA 4OIKA 4RFBA 3SGIA 4R9WA 1JICA 1JR0D 1SEBD 4B3TQ 2F0IA 1JC7A 1HZAA 1Z47A 2YTVA 1TWCB 4XYQA 1OO9B 5JPMC 1VS0A 2JA8G 3MXGA 1HXYD 3OTOL 2MGSA 3TZUA 4DAVA 1XMOQ 3S2HH 5LMNL 4JI3L 5IGEA 1B7YB 1PZID 4MTNA 1FNUA 4A3FH 1OTCA 4G7HC 1ZXTA 1RTOA 2CQFA 3OOCA 1MD2D 3CCMA 3D4RA 1FGUA 4C3HH 1CA5A 3W1BA 2F0LA 4DKAC 2LMCB 1FNVA 3AFPA 5EBCA 4RHSA 4JI7L 1C48A 3PUVA 2A19A 1YJ9A 5C4HA 5KGUA 3CF5A 2EIFA 4IN3A 4CKCA 4E6IA 4C1NI 1QILA 4UP8A 4ULLA 1CQVA 1TS4A 4G4KA 5FOBB 2MP1A 1WCMB 1PRTB 1QZGA 1JJ2A 1K8OA 2AUJD 5LMUL 1W3SA 2WB1E 4TQUS 1OXTA 4DK3C 2XTIA 1HNWL 3S17H 3RN2A 2RHSB 4YCUA 2NWGA 4A3DG 4P74A 1S5FD 2HQEA 1MFSA 2EYFA 1D5MC 5CV4A 3OMGA 4C3JH 2WKCA 5EAYA 1RIPA 1DOKA 3GTGB 3HRZC 1BNZA 4XQJA 2QA4A 4B9XA 5BN4A 3A7LA 2RF4A 4L6TB 2WKDA 4M8AA 2EDGA 3PIOA 4KHPL 2L12A 2IY5B 5C6AA 4OX9L 3S1QB 5IY0A 4YIJA 4EQ5A 5CV6A 3RN5A 2CVRA 2NBFA 2UUAQ 2J0TD 3J7AV 1Q81C 2YU9H 4ABNA 1PH1A 1S5BD 1R9TB 3ND8A 1TXYA 2D0OA 1SR3A 4B3ML 2K1BA 4PNYA 1Q82C 1NTGA 3ULLA 3KJOA 3T53B 4HCEA 3MXNA 3CHBD 5IYCG 3IRBA 2D0PA 2B2WC 2EYPA 2K4KA 1PTOH 2TSSA 3MXUA 3C1EA 2XSCA 4IOAA 2BDNA 4IQZA 2PMZE 3STBD 2MQHA 2F0EA 2L15A 4GNXB 1GO3E 4HIKA 3KYHC 3LWUA 1LTGD 2IHXA 2EJMA 4KJNA 3BZDB 1TS5A 5FLMH 2N3SA 3J80E 5FO7B 3A5UA 3K5OA 4DK1A 3CCVA 4P2CB 2CWPA 5H1SE 1I6VC 4A93G 1QB5D 5HURA 4X62Q 1YJWA 2HHHL 4LF6L 4A3MH 3T1YL 1I6HH 1GHKA 3ERQA 1F9SA 3QG1A 4KI0A 1HTPA
chains in the Genus database with same CATH topology
1VQ4A 4HJ5A 4LFBQ 4JOIA 1N36L 1D8LA 2PI2A 2WAQG 4JG2A 1N33L 1VQBA 2EC7A 5JJKA 1EWIA 3GTKH 3OTOQ 2YTYA 4QGUA 1K8AC 3T1HQ 4DR1L 1HR0L 2B63H 1PVOA 3H15A 3UE1A 4RG1A 3HKZG 1LUZA 3TS2A 2R6GA 4IFDG 5LMNQ 4BY7H 2JJQA 2GVBA 2JA5H 3DLLA 3HOWG 1OXUA 4DV3L 1VQJA 2LXJA 3OYYA 4DPGA 5C4XG 1UE1A 5M5XH 1NBWA 3HOYH 4A3KG 4NXML 3H3VI 1F6UA 2Y0SG 4P73A 2AMCB 1K9MC 4OWWB 2N78A 2CKZB 4DV1Q 4A3BG 3M7NA 1GKHA 1VCIA 1EUJA 1GVPA 1IBLL 5C0XG 2KCMA 3HFZB 2R7FA 4A3LH 2HIXA 4R1JA 3J81i 4DV7Q 2PQAB 1PV4A 3K81C 1H95A 4A3EG 4YWLA 3S24A 2F4VL 4AQYL 2PQAA 1UE7A 3GTJH 4DR5L 3TEHB 2VW9A 2FXQA 1B8AA 2C35B 1PH3A 4JI7Q 4A3IH 2UUCL 3UDFA 3HOZG 4IPHA 2JEBI 2UXCQ 2M3ZA 3I4NH 1TWCH 1O7IA 2LSSA 2ES2A 2OWOA 5LMNW 1BBUA 3CMEA 1CSQA 2IT1A 1ESKA 4YY3Q 4HIMA 4Y7NH 1CSPA 1QZHA 1NMGA 4APVA 2OQKA 1YZ6A 3A0JA 5E7NA 1WWDA 1HNXL 1HZCA 3J81j 4JI4L 1I5FA 3ICEA 2F4VQ 3E0EA 5M3FG 2Z0SA 1X6OA 2WFWA 2MO1A 4BY1G 4DR5Q 3M85A 4P75A 5LMUQ 4PZ6A 2QEXA 5IP9G 3HOVH 2ATWA 1SRUA 1BVSA 4AH6A 1HNWQ 5M5YH 3HKSA 3KLWA 1ASZA 3TRZA 2PNHA 1K83H 3F1ZA 4QL5A 1YJNA 1K0RA 2KENA 3CP0A 3UDXA 5GAEC 1TWGH 4X64L 3S1RH 1XNRQ 2NVQH 4JI8Q 5IYDH 3JAMi 2BA0A 3F8TA 1YITA 1I3QH 1QVFA 4GKJL 4YWMA 2E5LL 1EIFA 4A3JG 1J5EL 3CCRA 2WAQE 4OWXB 2JA7H 3S14H 1VQMA 4JI0L 1S3OA 3PO3H 2LI8A 4NB3A 1YHQA 3S16H 2VQFL 3CCUA 1A63A 1VQEA 2KHIA 1I94L 1KC8C 1OXVA 5FJ8H 4PZ8A 2E2JH 2RCNA 3HKZE 3ULJA 1YBYA 3H3VH 4WJ3M 2Z6KC 4DUZQ 3CPWA 1S72A 3PO2G 2HT1A 4GKKL 2Q2IA 4EX5A 1VQDA 1VQGA 4QY7A 3BZCA 2MFIA 4DV5Q 1YI2A 4KHPQ 2NVYH 2JE6I 4A3GG 5FLMG 4OX9Q 2Y0SE 1N32L 2K75A 5ELOA 1ASYA 2K5VA 3S1MH 3UDGA 1VQ9A 1PH8A 4JI6Q 4BBSG 3J80i 1IBMQ 2UUBQ 4LF8Q 4A3MG 2UU9Q 1L2FA 4J15A 4P71A 4B3MQ 4GOPB 1XTDA 4BXXG 1FJGL 2CWAA 4GNXC 4QQBX 4DUYQ 4GOPA 1Q1BA 1VQAA 5HGQA 5GAHC 3GTPH 4L5TA 1VQIA 5IWAL 4LUZA 1UE5A 4DR2Q 4LFAL 2R92H 3HOXH 4B3TL 4JV5Q 1EIYB 3VDYA 3L0OA 1N8RC 2QGQA 1XJVA 1WWEA 1X65A 1YHAA 4JI1L 2B63G 1E7ZA 2F3IA 4LF5L 1Q46A 2WP8J 5IYBH 3CPFA 4LF9Q 4NXNQ 1L0WA 2I5HA 2OQ0A 5GAGC 3I7FA 4LF4Q 2AKWB 4L5SA 3H0GH 3GTGH 4A4IA 4BY7G 1Q3YA 1XMOL 2JA5G 1AAFA 2ZTDA 4IFDI 3I2ZA 2K14A 1VQKA 3MEFA 3EN2A 2ZJPA 3HOYG 2XGTA 4JOIC 4QIWE 4PZ7A 3K0XA 4AIMA 2D62A 4YWKA 1XPRA 3S1QH 3KF6B 2E8GA 1VQHA 3UDIA 4DV2Q 3KF6A 1Q7YC 1XNQQ 1KXLA 3NBHB 4OXPA 4DR6Q 3CC4A 3UE0A 3I4OA 4DR7Q 3G6EA 4L5RC 4OO1G 1DGSA 4MNOA 4A75A 1X3GA 4JI5Q 2NZOA 1C0AA 5AJ3Q 4POGA 2VQEQ 3I4MH 2HHHQ 3U58A 4LF6Q 1JB7A 3T1YQ 3WWVA 2ZM6Q 2R93H 4A3IG 1RL2A 4IJLA 1CKMA 1XMQL 1G51A 3RLNA 2VUMH 5BR8L 4KHZA 1TWHH 4ALPA 1EQQA 4JBMA 2R7ZH 1N36Q 2AHOB 1HNZL 1JE5A 2NVTH 1N33Q 1Q3ZA 5J3BA 4YHHL 2UXBL 2JK8A 4DNIA 1X3FA 1Q86C 1YHBA 4DR1Q 1HR0Q 1C7YA 2JA8H 2UXDL 2OTJA 3U4VA 4IFDJ 1X56A 3CCEA 2E2HH 4C3IH 3BU2A 3EIVA 2N49A 1E1OA 4DK6C 4DV3Q 3HOVG 1JT8A 3PCOB 2ALYB 2K5HA 4X66L 2Q2TA 4DR4L 3RNUA 2DUDA 4NXMQ 5IE8A 3D0FA 3J7ZC 4DV6L 3PF5A 4LF7L 1AE2A 4ME3A 2JA6H 2NN6I 1X3EA 4LW1A 3NYBB 3GDEA 4RMFA 2AWOA 4LWCA 5IYDG 2JZWA 3CD6A 1CKNB 5IP7H 2VNUD 2N8NA 1WOCA 1IBLQ 4GN5A 5C0XJ 1VQOA 1VQNA 2UXDQ 1CKNA 2JA7G 3PO3G 1NE3A 1HZBA 1UE6A 1KHIA 1NY4A 1Y14B 1TWFH 4AQYQ 4UP9A 2MO0A 3CCQA 1N9WA 3GTLH 3HOWH 1L1OB 3ZJYC 4R4IA 1HR0W 2BH8A 2UUCQ 1E24A 2B29A 1QVGA 1N34L 3BJUA 4JI2L 1L1OA 4UPAA 4X65L 4DR3L 1YIJA 1PH5A 4X6AH 1QUQB 2YSAA 4QJFA 1QUQA 4BBRH 4BA2I 3CQZH 1HNXQ 4JI4Q 1CUKA 1YEZA 3KF8B 3M9BA 4JYAL 2AWNA 3Q8DA 2NVXH 1CKOA 3TQYA 5C4JH 3I56A 3CC7A 1V9PA 2IHEA 1U5KA 3KDFB 5JEAG 1OXXK 1V1QA 5FLXc 1GD7A 2NZHA 1Y1WH 1W2BA 1MKHA 3KFUA 1SN8A 2HIVA 4LUVA 3JC66 3F2CA 4KLKA 4LFCL 3KDFA 5GADC 4R4OA 3PUZA 1S40A 1PH7A 1A1TA 3LGJA 3TREA 5M3MG 2KHJA 3EBEA 4GLAC 5GROA 1Q8KA 4BBSH 4DV4L 3CCLA 1KL9A 3G48A 1HH2P 1Y1VH 3HOXG 4PG3A 4X64Q 4B3SL 2R92G 3D31A 3K7AH 4A3CH 3CCJA 4JBJA 1K3RA 1J6QA 1SMXA 3M4QA 5K36G 2CFMA 1VQ8A 4A3DH 3ER0A 3TS0A 4A93G 1K8GA 2ASBA 4GKJQ 1PH4A 5IYBG 2E5LQ 1WCMH 4OWTB 1J5EQ 2Q2UA 1IBKL 3CW2C 4JI0Q 3HOUH 3K80C 3H0GG 1LYLA 1JMCA 4K0KL 4GN3B 4A76A 2VQFQ 4O2DA 4IOCA 1MJCA 3W5OA 5M3FH 1OXSC 1WFQA 1I94Q 4B3RL 4GOPC 2KCTA 2L4LA 1NMFA 4DV0L 1VQLA 5IP9H 1VQPA 2CCZA 2EXFA 2EQSA 2KBNA 4L5QA 1E22A 4GKKQ 3PSIA 1EFWA 3KOJA 1VQ6A 4IO9A 4JBKA 4HJAA 3U4ZA 3I55A 4YCWA 1N32Q 4XTCS 2IHFA 1E3PA 1KRTA 4C2MH 2Q2HA 3FP9A 3J81c 2IX0A 4IJHA 4MZ9A 3NEMA 4A3JH 3I4MG 3PIPA 4YCVA 1EYGA 4OO1I 4P72A 2R93G 1B70B 1V43A 4X62L 1FJGQ 1Z9FA 4XIGS 3SGIA 2VUMG 1WI5A 2R7ZG 3FHWA 3F2BA 5IWAQ 1KAWA 4LFAQ 1D7QA 1P8LA 4B3TQ 3PV0A 1IYJB 4LFBL 3L7ZC 1HZAA 1Z47A 1X54A 1LM0A 2GN5A 2YTVA 2MNAA 1I50H 5IYCH 3U50C 4JI1Q 3GTOH 1VS0A 2JA8G 4A3LG 4HJ7A 3KJPA 4LF5Q 3K7UC 5C0XI 1UWVA 3OTOL 2VY3A 3T1HL 2RHQB 1R9TH 1XMOQ 3AYHB 5JJIA 1G6PA 2HQLA 1PH9A 3S2HH 5LMNL 4JI3L 1IL2A 5ELNA 3STBC 2GVAA 1B7YB 4JBWA 1P16A 2VL6A 4MTNA 2UUAL 2YV5A 4A3FH 1X9NA 1K73C 4GLXA 2ZJQA 2JA6G 3I4NG 3M4OH 1HNWL 1JJCB 3FKIH 2CQOA 3PGZA 1OTCA 5DLQE 1T9HA 2V1CC 3JAMc 5IP7G 1M90C 2CQFA 3OW2A 3K8AA 3PUWA 4DV1L 1PH6A 3CCMA 1FGUA 4C3HH 5HY6A 3S2DH 3W1BA 3RR5A 3A5ZB 4DV7L 1E1TA 2BA1A 4DKAC 3W1GA 2VS1A 4JI3Q 3G71A 2JQOA 5C44H 3AFPA 3RLOA 1XPOA 4HJ9A 2E2IH 4A93H 5C3EH 1XMQQ 2H5XA 4JI7L 5BR8Q 2F52A 1WWFA 2ZJRA 1Q1EA 3PUVA 2I5MX 1TWAH 4HIOA 1MJEA 1HNZQ 3PUYA 3A74A 2A19A 1YJ9A 2UXCL 2YTXA 4AYBG 4YHHQ 2UXBQ 1A62A 2K50A 3CF5A 2EIFA 4BBRG 4HJ8A 4YY3L 3CCSA 4UP8A 3S15H 5M5WH 1VQ5A 1XPUA 2EXDA 1VQ7A 2IX1A 2I0QA 1U0LA 3J80c 3RLFA 2JEAI 4JC0A 1Y1WG 4TVAB 2YYZA 1QZGA 1JJ2A 4X66Q 5FJ8G 1SE8A 1L1OC 5LMUL 4DR4Q 1W3SA 2WB1E 4R4CA 3ERSX 4FDBA 4TQUS 5C4XH 1OXTA 4DK3C 2XTIA 4DV6Q 4HIDA 1GM5A 5GQOA 4LF7Q 3S17H 1WJJA 2JA9A 1Y1VG 2R7DA 3RN2A 4A3KH 1BKBA 3G4SA 2RHSB 4A3CG 1AH9A 4GLVB 1LTLA 1KRSA 4YCUA 3B6YA 1WYDA 3GO5A 4H02A 1XNRL 3NENA 4BA1I 3BZKA 4JI8L 4A3BH 4P74A 1IXRA 2OCEA 4A3DG 1WCMG 3RZDH 4O0AA 1MFSA 1JJGA 3HOUG 3J7A5 4GS3A 1UEBA 4IPDA 3AEVA 1WWGA 1C9OA 4Y52H 1NJIC 1PYBA 5EAYA 4C3JH 4A3EH 1RIPA 1Q12A 1N34Q 2BH2A 1BJ6A 3M3YH 4JI2Q 2QA4A 2I5LX 2NN6G 3HOZH 4X65Q 2RF4A 2ZTEA 4DR3Q 4LUOA 4DUZL 2A8VA 4UP7A 3DM3A 3CAMA 1YNXA 3PIOA 4GN4B 4DV5L 4KHPL 3NELA 3AFQA 2IY5B 4OX9L 1A6BB 2LXKA 3S1NH 5IY0A 4EQ5A 4JYAQ 1PYSB 2A1AA 3RN5A 2OTLA 2UUAQ 1FVIA 2ID0A 1QVCA 5JEAJ 4DAMA 3CXCA 1PA6A 4JI6L 1A8VA 1Q81C 2YU9H 1IBML 3E9IA 1PH1A 2UUBL 4BY1H 4LF8L 2UU9L 4LFCQ 1TXYA 2D0OA 1SR3A 4B3ML 1M1KC 3MXNB 1Q82C 4WJ4A 2K5NA 4DV4Q 3GTMH 1NTGA 3ULLA 4JCVE 2PI2E 2B3GA 3KJOA 4DUYL 1SFOH 4B3SQ 4LNQA 1VQFA 1U6PA 1HZ9A 2VZAA 3PUXA 4DR2L 2Z6KA 5IYCG 4JV5L 1X55A 1EOVA 2DGYA 5IT9c 3IRBA 4IPCA 1IBKQ 1VQCA 2D0PA 2K4KA 4AYBE 4NXNL 4NPSA 2WB1G 1SLJA 4PMWA 4LF9L 4K0KQ 1FL0A 4LF4L 3L2PA 4B3RQ 1PFSA 4IOAA 1SROA 2K52A 3STBD 1BBWA 2PMZE 4DV0Q 4A3FG 1HJPA 4IPGA 5JJLA 3E9HA 4POFA 2MQHA 1YVCA 3FKIG 4DAYB 5M3MH 2L15A 2ZTCA 4GNXB 1PHJA 1GO3E 4HIKA 3F2DA 1KIXA 3KYHC 4R4TA 1PH2A 3GTQH 1EQRA 3CC2A 3PO2H 2IHXA 4GNXA 4R4QA 1G291 4A3GH 5FLMH 4DV2L 3AQQA 2N3SA 1KD1C 1XNQL 1AE3A 4DR6L 3A5UA 4DR7L 3GD7A 3CCVA 2CWPA 5H1SE 1MIUA 3RZOH 4JI5L 5C44G 5AJ3L 2VQEL 1IZ6A 4UY8C 1A0IA 3PF4A 4X62Q 5C3EG 1YJWA 2HHHL 4A3MH 4OONA 3T1YL 2ZM6L 4LF6L 1I6HH 3CMAA 1KQSA 4BXXH 3M4PA 3ULPA 4KI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 A;  4HJ5 A;  4LFB Q;  4JOI A;  1N36 L;  1D8L A;  2PI2 A;  2WAQ G;  4JG2 A;  1N33 L;  1VQB A;  2EC7 A;  5JJK A;  1EWI A;  3GTK H;  3OTO Q;  2YTY A;  4QGU A;  1K8A C;  3T1H Q;  4DR1 L;  1HR0 L;  2B63 H;  1PVO A;  3H15 A;  3UE1 A;  4RG1 A;  3HKZ G;  1LUZ A;  3TS2 A;  2R6G A;  4IFD G;  5LMN Q;  4BY7 H;  2JJQ A;  2GVB A;  2JA5 H;  3DLL A;  3HOW G;  1OXU A;  4DV3 L;  1VQJ A;  2LXJ A;  3OYY A;  4DPG A;  5C4X G;  1UE1 A;  5M5X H;  1NBW A;  3HOY H;  4A3K G;  4NXM L;  3H3V I;  1F6U A;  2Y0S G;  4P73 A;  2AMC B;  1K9M C;  4OWW B;  2N78 A;  2CKZ B;  4DV1 Q;  4A3B G;  3M7N A;  1GKH A;  1VCI A;  1EUJ A;  1GVP A;  1IBL L;  5C0X G;  2KCM A;  3HFZ B;  2R7F A;  4A3L H;  2HIX A;  4R1J A;  3J81 i;  4DV7 Q;  2PQA B;  1PV4 A;  3K81 C;  1H95 A;  4A3E G;  4YWL A;  3S24 A;  2F4V L;  4AQY L;  2PQA A;  1UE7 A;  3GTJ H;  4DR5 L;  3TEH B;  2VW9 A;  2FXQ A;  1B8A A;  2C35 B;  1PH3 A;  4JI7 Q;  4A3I H;  2UUC L;  3UDF A;  3HOZ G;  4IPH A;  2JEB I;  2UXC Q;  2M3Z A;  3I4N H;  1TWC H;  1O7I A;  2LSS A;  2ES2 A;  2OWO A;  5LMN W;  1BBU A;  3CME A;  1CSQ A;  2IT1 A;  1ESK A;  4YY3 Q;  4HIM A;  4Y7N H;  1CSP A;  1QZH A;  1NMG A;  4APV A;  2OQK A;  1YZ6 A;  3A0J A;  5E7N A;  1WWD A;  1HNX L;  1HZC A;  3J81 j;  4JI4 L;  1I5F A;  3ICE A;  2F4V Q;  3E0E A;  5M3F G;  2Z0S A;  1X6O A;  2WFW A;  2MO1 A;  4BY1 G;  4DR5 Q;  3M85 A;  4P75 A;  5LMU Q;  4PZ6 A;  2QEX A;  5IP9 G;  3HOV H;  2ATW A;  1SRU A;  1BVS A;  4AH6 A;  1HNW Q;  5M5Y H;  3HKS A;  3KLW A;  1ASZ A;  3TRZ A;  2PNH A;  1K83 H;  3F1Z A;  4QL5 A;  1YJN A;  1K0R A;  2KEN A;  3CP0 A;  3UDX A;  5GAE C;  1TWG H;  4X64 L;  3S1R H;  1XNR Q;  2NVQ H;  4JI8 Q;  5IYD H;  3JAM i;  2BA0 A;  3F8T A;  1YIT A;  1I3Q H;  1QVF A;  4GKJ L;  4YWM A;  2E5L L;  1EIF A;  4A3J G;  1J5E L;  3CCR A;  2WAQ E;  4OWX B;  2JA7 H;  3S14 H;  1VQM A;  4JI0 L;  1S3O A;  3PO3 H;  2LI8 A;  4NB3 A;  1YHQ A;  3S16 H;  2VQF L;  3CCU A;  1A63 A;  1VQE A;  2KHI A;  1I94 L;  1KC8 C;  1OXV A;  5FJ8 H;  4PZ8 A;  2E2J H;  2RCN A;  3HKZ E;  3ULJ A;  1YBY A;  3H3V H;  4WJ3 M;  2Z6K C;  4DUZ Q;  3CPW A;  1S72 A;  3PO2 G;  2HT1 A;  4GKK L;  2Q2I A;  4EX5 A;  1VQD A;  1VQG A;  4QY7 A;  3BZC A;  2MFI A;  4DV5 Q;  1YI2 A;  4KHP Q;  2NVY H;  2JE6 I;  4A3G G;  5FLM G;  4OX9 Q;  2Y0S E;  1N32 L;  2K75 A;  5ELO A;  1ASY A;  2K5V A;  3S1M H;  3UDG A;  1VQ9 A;  1PH8 A;  4JI6 Q;  4BBS G;  3J80 i;  1IBM Q;  2UUB Q;  4LF8 Q;  4A3M G;  2UU9 Q;  1L2F A;  4J15 A;  4P71 A;  4B3M Q;  4GOP B;  1XTD A;  4BXX G;  1FJG L;  2CWA A;  4GNX C;  4QQB X;  4DUY Q;  4GOP A;  1Q1B A;  1VQA A;  5HGQ A;  5GAH C;  3GTP H;  4L5T A;  1VQI A;  5IWA L;  4LUZ A;  1UE5 A;  4DR2 Q;  4LFA L;  2R92 H;  3HOX H;  4B3T L;  4JV5 Q;  1EIY B;  3VDY A;  3L0O A;  1N8R C;  2QGQ A;  1XJV A;  1WWE A;  1X65 A;  1YHA A;  4JI1 L;  2B63 G;  1E7Z A;  2F3I A;  4LF5 L;  1Q46 A;  2WP8 J;  5IYB H;  3CPF A;  4LF9 Q;  4NXN Q;  1L0W A;  2I5H A;  2OQ0 A;  5GAG C;  3I7F A;  4LF4 Q;  2AKW B;  4L5S A;  3H0G H;  3GTG H;  4A4I A;  4BY7 G;  1Q3Y A;  1XMO L;  2JA5 G;  1AAF A;  2ZTD A;  4IFD I;  3I2Z A;  2K14 A;  1VQK A;  3MEF A;  3EN2 A;  2ZJP A;  3HOY G;  2XGT A;  4JOI C;  4QIW E;  4PZ7 A;  3K0X A;  4AIM A;  2D62 A;  4YWK A;  1XPR A;  3S1Q H;  3KF6 B;  2E8G A;  1VQH A;  3UDI A;  4DV2 Q;  3KF6 A;  1Q7Y C;  1XNQ Q;  1KXL A;  3NBH B;  4OXP A;  4DR6 Q;  3CC4 A;  3UE0 A;  3I4O A;  4DR7 Q;  3G6E A;  4L5R C;  4OO1 G;  1DGS A;  4MNO A;  4A75 A;  1X3G A;  4JI5 Q;  2NZO A;  1C0A A;  5AJ3 Q;  4POG A;  2VQE Q;  3I4M H;  2HHH Q;  3U58 A;  4LF6 Q;  1JB7 A;  3T1Y Q;  3WWV A;  2ZM6 Q;  2R93 H;  4A3I G;  1RL2 A;  4IJL A;  1CKM A;  1XMQ L;  1G51 A;  3RLN A;  2VUM H;  5BR8 L;  4KHZ A;  1TWH H;  4ALP A;  1EQQ A;  4JBM A;  2R7Z H;  1N36 Q;  2AHO B;  1HNZ L;  1JE5 A;  2NVT H;  1N33 Q;  1Q3Z A;  5J3B A;  4YHH L;  2UXB L;  2JK8 A;  4DNI A;  1X3F A;  1Q86 C;  1YHB A;  4DR1 Q;  1HR0 Q;  1C7Y A;  2JA8 H;  2UXD L;  2OTJ A;  3U4V A;  4IFD J;  1X56 A;  3CCE A;  2E2H H;  4C3I H;  3BU2 A;  3EIV A;  2N49 A;  1E1O A;  4DK6 C;  4DV3 Q;  3HOV G;  1JT8 A;  3PCO B;  2ALY B;  2K5H A;  4X66 L;  2Q2T A;  4DR4 L;  3RNU A;  2DUD A;  4NXM Q;  5IE8 A;  3D0F A;  3J7Z C;  4DV6 L;  3PF5 A;  4LF7 L;  1AE2 A;  4ME3 A;  2JA6 H;  2NN6 I;  1X3E A;  4LW1 A;  3NYB B;  3GDE A;  4RMF A;  2AWO A;  4LWC A;  5IYD G;  2JZW A;  3CD6 A;  1CKN B;  5IP7 H;  2VNU D;  2N8N A;  1WOC A;  1IBL Q;  4GN5 A;  5C0X J;  1VQO A;  1VQN A;  2UXD Q;  1CKN A;  2JA7 G;  3PO3 G;  1NE3 A;  1HZB A;  1UE6 A;  1KHI A;  1NY4 A;  1Y14 B;  1TWF H;  4AQY Q;  4UP9 A;  2MO0 A;  3CCQ A;  1N9W A;  3GTL H;  3HOW H;  1L1O B;  3ZJY C;  4R4I A;  1HR0 W;  2BH8 A;  2UUC Q;  1E24 A;  2B29 A;  1QVG A;  1N34 L;  3BJU A;  4JI2 L;  1L1O A;  4UPA A;  4X65 L;  4DR3 L;  1YIJ A;  1PH5 A;  4X6A H;  1QUQ B;  2YSA A;  4QJF A;  1QUQ A;  4BBR H;  4BA2 I;  3CQZ H;  1HNX Q;  4JI4 Q;  1CUK A;  1YEZ A;  3KF8 B;  3M9B A;  4JYA L;  2AWN A;  3Q8D A;  2NVX H;  1CKO A;  3TQY A;  5C4J H;  3I56 A;  3CC7 A;  1V9P A;  2IHE A;  1U5K A;  3KDF B;  5JEA G;  1OXX K;  1V1Q A;  5FLX c;  1GD7 A;  2NZH A;  1Y1W H;  1W2B A;  1MKH A;  3KFU A;  1SN8 A;  2HIV A;  4LUV A;  3JC6 6;  3F2C A;  4KLK A;  4LFC L;  3KDF A;  5GAD C;  4R4O A;  3PUZ A;  1S40 A;  1PH7 A;  1A1T A;  3LGJ A;  3TRE A;  5M3M G;  2KHJ A;  3EBE A;  4GLA C;  5GRO A;  1Q8K A;  4BBS H;  4DV4 L;  3CCL A;  1KL9 A;  3G48 A;  1HH2 P;  1Y1V H;  3HOX G;  4PG3 A;  4X64 Q;  4B3S L;  2R92 G;  3D31 A;  3K7A H;  4A3C H;  3CCJ A;  4JBJ A;  1K3R A;  1J6Q A;  1SMX A;  3M4Q A;  5K36 G;  2CFM A;  1VQ8 A;  4A3D H;  3ER0 A;  3TS0 A;  4A93 G;  1K8G A;  2ASB A;  4GKJ Q;  1PH4 A;  5IYB G;  2E5L Q;  1WCM H;  4OWT B;  1J5E Q;  2Q2U A;  1IBK L;  3CW2 C;  4JI0 Q;  3HOU H;  3K80 C;  3H0G G;  1LYL A;  1JMC A;  4K0K L;  4GN3 B;  4A76 A;  2VQF Q;  4O2D A;  4IOC A;  1MJC A;  3W5O A;  5M3F H;  1OXS C;  1WFQ A;  1I94 Q;  4B3R L;  4GOP C;  2KCT A;  2L4L A;  1NMF A;  4DV0 L;  1VQL A;  5IP9 H;  1VQP A;  2CCZ A;  2EXF A;  2EQS A;  2KBN A;  4L5Q A;  1E22 A;  4GKK Q;  3PSI A;  1EFW A;  3KOJ A;  1VQ6 A;  4IO9 A;  4JBK A;  4HJA A;  3U4Z A;  3I55 A;  4YCW A;  1N32 Q;  4XTC S;  2IHF A;  1E3P A;  1KRT A;  4C2M H;  2Q2H A;  3FP9 A;  3J81 c;  2IX0 A;  4IJH A;  4MZ9 A;  3NEM A;  4A3J H;  3I4M G;  3PIP A;  4YCV A;  1EYG A;  4OO1 I;  4P72 A;  2R93 G;  1B70 B;  1V43 A;  4X62 L;  1FJG Q;  1Z9F A;  4XIG S;  3SGI A;  2VUM G;  1WI5 A;  2R7Z G;  3FHW A;  3F2B A;  5IWA Q;  1KAW A;  4LFA Q;  1D7Q A;  1P8L A;  4B3T Q;  3PV0 A;  1IYJ B;  4LFB L;  3L7Z C;  1HZA A;  1Z47 A;  1X54 A;  1LM0 A;  2GN5 A;  2YTV A;  2MNA A;  1I50 H;  5IYC H;  3U50 C;  4JI1 Q;  3GTO H;  1VS0 A;  2JA8 G;  4A3L G;  4HJ7 A;  3KJP A;  4LF5 Q;  3K7U C;  5C0X I;  1UWV A;  3OTO L;  2VY3 A;  3T1H L;  2RHQ B;  1R9T H;  1XMO Q;  3AYH B;  5JJI A;  1G6P A;  2HQL A;  1PH9 A;  3S2H H;  5LMN L;  4JI3 L;  1IL2 A;  5ELN A;  3STB C;  2GVA A;  1B7Y B;  4JBW A;  1P16 A;  2VL6 A;  4MTN A;  2UUA L;  2YV5 A;  4A3F H;  1X9N A;  1K73 C;  4GLX A;  2ZJQ A;  2JA6 G;  3I4N G;  3M4O H;  1HNW L;  1JJC B;  3FKI H;  2CQO A;  3PGZ A;  1OTC A;  5DLQ E;  1T9H A;  2V1C C;  3JAM c;  5IP7 G;  1M90 C;  2CQF A;  3OW2 A;  3K8A A;  3PUW A;  4DV1 L;  1PH6 A;  3CCM A;  1FGU A;  4C3H H;  5HY6 A;  3S2D H;  3W1B A;  3RR5 A;  3A5Z B;  4DV7 L;  1E1T A;  2BA1 A;  4DKA C;  3W1G A;  2VS1 A;  4JI3 Q;  3G71 A;  2JQO A;  5C44 H;  3AFP A;  3RLO A;  1XPO A;  4HJ9 A;  2E2I H;  4A93 H;  5C3E H;  1XMQ Q;  2H5X A;  4JI7 L;  5BR8 Q;  2F52 A;  1WWF A;  2ZJR A;  1Q1E A;  3PUV A;  2I5M X;  1TWA H;  4HIO A;  1MJE A;  1HNZ Q;  3PUY A;  3A74 A;  2A19 A;  1YJ9 A;  2UXC L;  2YTX A;  4AYB G;  4YHH Q;  2UXB Q;  1A62 A;  2K50 A;  3CF5 A;  2EIF A;  4BBR G;  4HJ8 A;  4YY3 L;  3CCS A;  4UP8 A;  3S15 H;  5M5W H;  1VQ5 A;  1XPU A;  2EXD A;  1VQ7 A;  2IX1 A;  2I0Q A;  1U0L A;  3J80 c;  3RLF A;  2JEA I;  4JC0 A;  1Y1W G;  4TVA B;  2YYZ A;  1QZG A;  1JJ2 A;  4X66 Q;  5FJ8 G;  1SE8 A;  1L1O C;  5LMU L;  4DR4 Q;  1W3S A;  2WB1 E;  4R4C A;  3ERS X;  4FDB A;  4TQU S;  5C4X H;  1OXT A;  4DK3 C;  2XTI A;  4DV6 Q;  4HID A;  1GM5 A;  5GQO A;  4LF7 Q;  3S17 H;  1WJJ A;  2JA9 A;  1Y1V G;  2R7D A;  3RN2 A;  4A3K H;  1BKB A;  3G4S A;  2RHS B;  4A3C G;  1AH9 A;  4GLV B;  1LTL A;  1KRS A;  4YCU A;  3B6Y A;  1WYD A;  3GO5 A;  4H02 A;  1XNR L;  3NEN A;  4BA1 I;  3BZK A;  4JI8 L;  4A3B H;  4P74 A;  1IXR A;  2OCE A;  4A3D G;  1WCM G;  3RZD H;  4O0A A;  1MFS A;  1JJG A;  3HOU G;  3J7A 5;  4GS3 A;  1UEB A;  4IPD A;  3AEV A;  1WWG A;  1C9O A;  4Y52 H;  1NJI C;  1PYB A;  5EAY A;  4C3J H;  4A3E H;  1RIP A;  1Q12 A;  1N34 Q;  2BH2 A;  1BJ6 A;  3M3Y H;  4JI2 Q;  2QA4 A;  2I5L X;  2NN6 G;  3HOZ H;  4X65 Q;  2RF4 A;  2ZTE A;  4DR3 Q;  4LUO A;  4DUZ L;  2A8V A;  4UP7 A;  3DM3 A;  3CAM A;  1YNX A;  3PIO A;  4GN4 B;  4DV5 L;  4KHP L;  3NEL A;  3AFQ A;  2IY5 B;  4OX9 L;  1A6B B;  2LXK A;  3S1N H;  5IY0 A;  4EQ5 A;  4JYA Q;  1PYS B;  2A1A A;  3RN5 A;  2OTL A;  2UUA Q;  1FVI A;  2ID0 A;  1QVC A;  5JEA J;  4DAM A;  3CXC A;  1PA6 A;  4JI6 L;  1A8V A;  1Q81 C;  2YU9 H;  1IBM L;  3E9I A;  1PH1 A;  2UUB L;  4BY1 H;  4LF8 L;  2UU9 L;  4LFC Q;  1TXY A;  2D0O A;  1SR3 A;  4B3M L;  1M1K C;  3MXN B;  1Q82 C;  4WJ4 A;  2K5N A;  4DV4 Q;  3GTM H;  1NTG A;  3ULL A;  4JCV E;  2PI2 E;  2B3G A;  3KJO A;  4DUY L;  1SFO H;  4B3S Q;  4LNQ A;  1VQF A;  1U6P A;  1HZ9 A;  2VZA A;  3PUX A;  4DR2 L;  2Z6K A;  5IYC G;  4JV5 L;  1X55 A;  1EOV A;  2DGY A;  5IT9 c;  3IRB A;  4IPC A;  1IBK Q;  1VQC A;  2D0P A;  2K4K A;  4AYB E;  4NXN L;  4NPS A;  2WB1 G;  1SLJ A;  4PMW A;  4LF9 L;  4K0K Q;  1FL0 A;  4LF4 L;  3L2P A;  4B3R Q;  1PFS A;  4IOA A;  1SRO A;  2K52 A;  3STB D;  1BBW A;  2PMZ E;  4DV0 Q;  4A3F G;  1HJP A;  4IPG A;  5JJL A;  3E9H A;  4POF A;  2MQH A;  1YVC A;  3FKI G;  4DAY B;  5M3M H;  2L15 A;  2ZTC A;  4GNX B;  1PHJ A;  1GO3 E;  4HIK A;  3F2D A;  1KIX A;  3KYH C;  4R4T A;  1PH2 A;  3GTQ H;  1EQR A;  3CC2 A;  3PO2 H;  2IHX A;  4GNX A;  4R4Q A;  1G29 1;  4A3G H;  5FLM H;  4DV2 L;  3AQQ A;  2N3S A;  1KD1 C;  1XNQ L;  1AE3 A;  4DR6 L;  3A5U A;  4DR7 L;  3GD7 A;  3CCV A;  2CWP A;  5H1S E;  1MIU A;  3RZO H;  4JI5 L;  5C44 G;  5AJ3 L;  2VQE L;  1IZ6 A;  4UY8 C;  1A0I A;  3PF4 A;  4X62 Q;  5C3E G;  1YJW A;  2HHH L;  4A3M H;  4OON A;  3T1Y L;  2ZM6 L;  4LF6 L;  1I6H H;  3CMA A;  1KQS A;  4BXX H;  3M4P A;  3ULP A;  4KI0 A; 
#chains in the Genus database with same CATH topology
 2F0H A;  1B2T A;  5IGB A;  4JG2 A;  3AMU A;  1VQB A;  4A3K B;  3D4W A;  4K5W A;  2Q8I B;  3TBI B;  1ENA A;  2QF7 A;  1J8I A;  1SYF A;  4QGU A;  1PVO A;  3H15 A;  1AZQ A;  1V1P A;  2JYO A;  1LUZ A;  4IFD G;  2OXP A;  2JJQ A;  5C4J B;  5C4X G;  1NBW A;  3K0Y A;  1I4X A;  3H3V I;  1F6U A;  1B53 A;  3M3Y B;  2PW7 A;  2N78 A;  4DV1 Q;  4A3B G;  2B8F A;  1H9R A;  3I3C A;  1EUJ A;  2IW3 A;  1SMY C;  3J81 i;  4A3D B;  3K81 C;  1H95 A;  1PRT C;  3CKI B;  1LT3 D;  2LY7 A;  5DAU A;  1PFM A;  1TKW B;  3GTJ H;  2VW9 A;  1B44 D;  2FXQ A;  2RA4 A;  2C35 B;  4TRD A;  3HOZ G;  1RD9 D;  4BY1 B;  1TR5 A;  2JEB I;  2M3Z A;  1O7I A;  1WTP A;  1L0Y B;  2K05 A;  2LSS A;  2OWO A;  1GUW A;  5LMN W;  1R4P B;  4O1N A;  4HIM A;  1O7L A;  3VR5 A;  5CC4 A;  1QZH A;  4APV A;  3SK6 A;  3QR8 A;  1HNX L;  4JI4 L;  1GUO A;  3VR3 A;  5M3F G;  2Z0S A;  2WFW A;  2MO1 A;  3M85 A;  1T5E A;  2GA4 B;  4KK7 A;  3TZD A;  2KHS A;  5IP9 G;  1JOO A;  1SRU A;  1BVS A;  5M5Y H;  1IYU A;  3EJI A;  3KLW A;  3TRZ A;  1K83 H;  1K0R A;  2K03 A;  1UEA B;  5GAE C;  2NVQ H;  1HUM A;  3PO2 B;  1FNW A;  4GKJ L;  3A8J E;  4A3J G;  1EEF D;  3GTO B;  4OWX B;  4A3G B;  4JI0 L;  3BVZ A;  1YHQ A;  1BBX C;  3CCU A;  3RZO B;  1OXV A;  2E2J H;  3HKZ E;  3ULJ A;  3H3V H;  4WJ3 M;  1STB A;  2A73 B;  2FHT A;  2HT1 A;  2PZW A;  2Q2I A;  3BZC A;  1BCP D;  3P20 A;  3ND9 A;  3NPP A;  1N32 L;  5E4W C;  1KNA A;  2NTT A;  3UDG A;  1PH8 A;  3WDN A;  3DM1 A;  1QCB D;  2F0M A;  3QJY A;  5JEA H;  1L2F A;  5IIF A;  1EY5 A;  2D5D A;  2CWA A;  4GNX C;  5JOB A;  4QQB X;  2KOL A;  2JA5 B;  1Q1B A;  1VF7 A;  2QDB A;  5DNF A;  4L5T A;  1VQI A;  1WD0 A;  3FPU B;  3HOX H;  4B3T L;  2OEO A;  3X3M A;  3R2I A;  1N8R C;  1CI3 M;  1XJV A;  1HCZ A;  2B63 G;  2I07 B;  4NXN Q;  1Q46 A;  5IYB H;  2F3W A;  2E2D C;  1K28 A;  2OQ0 A;  1EEI D;  3I7F A;  4ZYS A;  4C1N K;  5M5W B;  5ELF A;  4A4I A;  1SNQ A;  1XMO L;  4IFD I;  3I2Z A;  2RSO A;  1AW7 A;  3HOY G;  1K8M A;  4JOI C;  4QIW E;  1ZKO A;  3E6Z X;  2D62 A;  1B4O A;  5E3F A;  5C4X B;  1CZG A;  5F2D A;  3A8K E;  5C5M A;  2H4O A;  1VQH A;  4KY6 A;  1SND A;  2A74 C;  3KF6 A;  1Q7Y C;  3OWF A;  3KBX A;  3BG3 A;  1WTH A;  2XNA C;  1RTN A;  4OO1 G;  4A3B B;  3MZ5 A;  4JI5 Q;  3HZX A;  4POG A;  5FLX L;  3U58 A;  1I4Q A;  1RL2 A;  4IJL A;  3VYT A;  2KEC A;  5J22 A;  2R7Z H;  1TWH H;  4HAE A;  2BCO A;  2ICI A;  3HOV B;  3URY A;  1N33 Q;  1Q3Z A;  5C3W A;  1U4P A;  4G7O C;  3D6W A;  1I3Q B;  3BDO A;  4G57 A;  4TKO B;  3CCE A;  4V19 0;  4C3I H;  1PFB A;  4V0B A;  3R8B A;  4DNR B;  3T13 A;  2ALY B;  2K5H A;  3LX0 A;  2Q2T A;  3RNU A;  5IE8 A;  5L37 A;  2KQ3 A;  3NYB B;  2AWO A;  2K33 A;  2JZW A;  3CD6 A;  1CKN B;  2VNU D;  3NQI A;  1IBL Q;  5C0X J;  1VQO A;  3BVM A;  3J81 L;  2NVY B;  4F8M A;  3NHH A;  3G6J B;  4KHV A;  1V1O A;  1D1I A;  2NZ1 D;  1TWF H;  2Q8T A;  4CDF C;  2HCC A;  1RHP A;  3C1F A;  2J7Z A;  3BS1 A;  2UUC Q;  2BH8 A;  2B29 A;  3MTS A;  1QVG A;  2F0F A;  4X6A H;  1B1Z A;  1QUQ B;  5M3M B;  2YSA A;  5EJW A;  1AFP A;  4BBR H;  3DHQ A;  4RGT A;  3C46 A;  2AWN A;  1V9P A;  1LTI D;  2IHE A;  2MHV A;  2SNM A;  1V1Q A;  3KF8 A;  1FR3 A;  3QOL A;  2NZH A;  3T56 B;  1B50 A;  4LUV A;  1Y8P B;  3TSS A;  1PH7 A;  2O5I C;  3H0G B;  3PUZ A;  1S40 A;  2CH4 W;  2L11 A;  4GLA C;  3TP6 A;  1SDF A;  1Z7T A;  4ZAI A;  1HH2 P;  2K28 A;  3D31 A;  1ILP A;  1J6Q A;  5K36 G;  2CFM A;  3ER0 A;  1K0S A;  3QB3 A;  1K8G A;  2R3Z A;  5BN3 A;  4K14 A;  4F7X A;  4QCL A;  1KLG D;  5M3F H;  4RA8 A;  1OXS C;  4KD3 A;  2KUM A;  2KCT A;  1DOL A;  1EQV A;  2LKV A;  3RMH A;  2L0C A;  5IP9 H;  2QIL A;  3Q6S A;  2EXF A;  2JXM B;  3A7A B;  1II3 A;  1E22 A;  4GKK Q;  2QCP X;  3HOY B;  1EFW A;  2VUM B;  3R3O A;  4IO9 A;  2FIN B;  2B2T C;  4XTC S;  4C2M H;  3FP9 A;  4IJH A;  4MZ9 A;  4OO1 I;  4A3J H;  4YCV A;  4B08 A;  2R93 G;  4LAA A;  2K01 A;  1FD7 D;  4X62 L;  1LTB D;  2B2U C;  1WI5 A;  2BOS A;  4FO2 A;  1IYJ B;  3L7Z C;  4XT3 B;  3TN2 A;  1X54 A;  2MNA A;  3EVQ A;  1I50 H;  4DU9 A;  3CU7 A;  2F0W A;  4LF5 Q;  5KEE A;  2EYH A;  2RHQ B;  2XRS D;  3H94 A;  2MJ8 A;  1G6P A;  5JJI A;  1AP0 A;  2HQL A;  2F0P A;  3MFY A;  4WFN 3;  1IL2 A;  3STB C;  3DMU A;  2VL6 A;  2YV5 A;  1X9N A;  3M4O H;  2C9O A;  2JA6 G;  3NP8 A;  3J7Y W;  3FKI H;  2CQO A;  1T9H A;  2A69 D;  1NCV A;  3JAM c;  3I72 A;  4N8X 1;  4ZQ3 A;  3PUW A;  4DV1 L;  2VB3 X;  2FFK B;  5C4Z A;  5HY6 A;  1D6E C;  3WOE A;  3V96 A;  3RR5 A;  5FLX E;  2L4N A;  1BOS A;  3W1G A;  2VS1 A;  5TSS A;  3NWT A;  2B39 A;  4C56 C;  5C3E H;  5BR8 Q;  1Y1W B;  2ZJR A;  4RH6 A;  1HNZ Q;  3A74 A;  3ZYY X;  4J8Q A;  1KDA A;  4AYB G;  4BBS B;  1WTX A;  1PZJ D;  5JPN C;  5KNB A;  3CCS A;  3K7A B;  3WOF A;  1XPU A;  2EXD A;  4OHJ A;  1TVX A;  4OO1 H;  1GUG A;  3RLF A;  4TVA B;  2YYZ A;  3QIA A;  1SE8 A;  4R4C A;  2PYK A;  4FDB A;  1GM5 A;  4HID A;  1I4P A;  4A3C G;  1EWH A;  3PQI A;  1LTL A;  2ZXR A;  1WYD A;  4ZUJ A;  4BA1 I;  3J81 E;  3BZK A;  2OCE A;  1PFN A;  1WCM G;  1YNJ D;  1JJG A;  3SK5 A;  2E76 C;  4IPD A;  5KIX A;  1EIG A;  4A3E H;  1O7Z A;  3S9W A;  2BH2 A;  4XYO A;  4FF4 A;  3NWS A;  1QNK A;  4X3S A;  4DR3 Q;  2L55 A;  4LUO A;  2B2V C;  2A8V A;  3CAM A;  1YNX A;  3NEL A;  3S1N H;  4KKT A;  4K5V A;  1WTO A;  2ID0 A;  1X3Q A;  3CXC A;  2M2L A;  3E9I A;  4LFC Q;  1IKM A;  4HR7 B;  1O78 A;  5CYU A;  1HRJ A;  4F88 A;  3S2H B;  4WJ4 A;  2K5N A;  4DV4 Q;  2PI2 E;  2B3G A;  1SNM A;  5ELE A;  1SFO H;  4B3S Q;  1U6P A;  1HZ9 A;  2VZA A;  3CRK C;  3D6C A;  3PUX A;  2Z6K A;  3ITP A;  5CV5 A;  2DGY A;  1JCK B;  4BS9 A;  5IT9 c;  4Z9C B;  2K7V A;  1SYD A;  3L9A X;  3LWE A;  4NPS A;  4NXN L;  4PMW A;  1FL0 A;  2G9D A;  1HA5 A;  1SRO A;  2K52 A;  4IPG A;  1YVC A;  4FP5 D;  3KLS A;  1PHJ A;  3GTQ H;  4RCO A;  4RHR A;  1BCP F;  2JA6 B;  2DY7 A;  5EKK A;  1AE3 A;  3GD7 A;  4JI5 L;  2ZXP A;  5C44 G;  3PF4 A;  2IWH A;  1EY7 A;  3HKZ B;  5ISR A;  2XWB B;  1KQS A;  3ULP A;  1JE4 A;  1VQ4 A;  3HOW B;  2K5W A;  4LFB Q;  2EVB A;  1D8L A;  2PI2 A;  2WAQ G;  1N33 L;  2EC7 A;  1IYV A;  3OMC A;  1EZ6 A;  4AYB B;  3T1H Q;  2EE1 A;  3KK7 A;  1BUV T;  1XXG A;  3CQZ B;  4RG1 A;  2LFN A;  2K04 A;  2GVB A;  3EQL C;  1VQJ A;  3OYY A;  4DPG A;  1UE1 A;  2EY5 A;  4A3K G;  2BE5 D;  2DN8 A;  2EY2 A;  1DOM A;  1D1K A;  3GV3 A;  5KYL A;  1W6J A;  5D65 A;  1IBL L;  5C0X G;  4R1J A;  2DJF C;  2PQA B;  2VXW A;  2NUC A;  1PV4 A;  1LT4 D;  1S4Z A;  4Q0F A;  3K5N A;  4CHT B;  2F4V L;  1ESR A;  5KYI A;  5KNC A;  2RDF A;  2UUC L;  1TWC H;  5IGF A;  1BBU A;  3CME A;  2IT1 A;  4FXG C;  4YY3 Q;  1K3B C;  4Y7N H;  1CSP A;  1HTL D;  1ENF A;  1YZ6 A;  3A0J A;  5FO8 B;  1X6O A;  4QF4 A;  4BY1 G;  4DR5 Q;  1KAB A;  4P75 A;  1EY6 A;  4PZ6 A;  1LAC A;  4IUT A;  4AH6 A;  2PNH A;  4IUQ A;  5JJZ A;  2KEN A;  3UDX A;  3CP0 A;  1YJN A;  2N88 A;  2EXZ A;  1XNR Q;  1RF2 D;  2BA0 A;  3F8T A;  3RD4 A;  1QVF A;  2JA7 H;  3CCR A;  3GQB A;  3S14 H;  1TY2 A;  3BVG A;  3F2U A;  3R93 A;  3IFD A;  2DY8 A;  1EIH A;  2KHI A;  2BDO A;  1KC8 C;  2F0T A;  3HGB A;  2RCN A;  1PLF A;  1I6H B;  1SSO A;  5FKA C;  3BDL A;  3PO2 G;  1A3T A;  4GKK L;  1ILQ A;  4EX5 A;  1YI2 A;  4QY7 A;  1ROD A;  2MFI A;  4HSP A;  3PIP 3;  4DV5 Q;  2JE6 I;  4A3G G;  1HHV A;  2Y0S E;  4EQP A;  3NUC A;  2K75 A;  1DON A;  5KRU A;  5DM6 3;  1HQR D;  3HEJ A;  1IBM Q;  2UUB Q;  2UU9 Q;  1I4R A;  2B2Y A;  4J15 A;  1EZ8 A;  1XTD A;  4GOP B;  1LTS D;  4X3K A;  4BWG B;  5C44 B;  5EQ0 A;  4DUY Q;  2F0G A;  3GTP H;  4LUZ A;  1RDP D;  4JV5 Q;  1IKL A;  4KMU C;  1TWA B;  3L0O A;  2QDL A;  2QGQ A;  4HSV A;  4K2L A;  1E7Z A;  3O13 A;  2WAQ B;  3MC0 B;  4LF5 L;  1EU4 A;  3S15 B;  3GTG H;  2I46 A;  4BY7 G;  1Q3Y A;  2JA5 G;  2DNE A;  2AQ1 B;  1UNS A;  2RKS A;  5I2Y A;  2XGT A;  1ZEQ X;  3T16 A;  3GTJ B;  4AIM A;  2V4D A;  1STG A;  2KEE A;  1F2Z A;  3S1Q H;  1NSN S;  3UDI A;  4DV2 Q;  4FXD A;  1XNQ Q;  4OXP A;  1ESF A;  5DM7 3;  4DR7 Q;  3I4O A;  3G6E A;  2O2L D;  1DGS A;  2AQ3 B;  4MNO A;  3NBH A;  2CQA A;  2NZO A;  3RZD B;  5G3L F;  1DZ1 A;  2VQE Q;  3I4M H;  3DWA A;  1JB7 A;  1NR4 A;  2ZM6 Q;  4A3I G;  2MPM A;  1F9R A;  2SDF A;  4B9W A;  2A6E D;  3RLN A;  5JVG 3;  4ZKB B;  5BR8 L;  1LO5 D;  4IAL A;  1EQQ A;  3K6O A;  1N36 Q;  1HNZ L;  2RBM A;  5M5Y B;  4RAU C;  3OSO A;  1B3Q A;  5J3B A;  1S5C D;  1CHQ D;  4NKL A;  2JA8 H;  3FRP B;  4UHV A;  2EJG C;  1HR0 Q;  2F0N A;  3U4V A;  2E2H H;  1JT8 A;  3HOV G;  1ML0 D;  4NXM Q;  3J7Z C;  3K5L A;  4N9T A;  1AE2 A;  2PZU A;  4RMF A;  2A69 C;  5CR3 A;  5IYD G;  4K8J A;  3TP8 A;  4GN5 A;  1VQN A;  2F0O A;  2K6A A;  2UXD Q;  3PO3 G;  1NE3 A;  1KHI A;  3I4L A;  1A2U A;  4R8I A;  5IGD A;  1H9S B;  2MO0 A;  4PV1 C;  1N9W A;  3CCQ A;  1PTO F;  3GTL H;  1L1O B;  2L9H A;  3ZJY C;  1NUC A;  4HMJ A;  1YIJ A;  4DR3 L;  1QOH A;  1EY4 A;  2PQE A;  4JVZ A;  1SNC A;  3U9S A;  3HOX B;  5HGT A;  1VMC A;  1CUK A;  4RWS C;  3DUZ A;  2CW0 C;  3Q8D A;  1LTA D;  2NVX H;  1CKO A;  3TQY A;  5C4J H;  1HA6 A;  3CC7 A;  1W2B A;  1OXX K;  1MKH A;  2RQX A;  1SN8 A;  3JC6 6;  4KLK A;  4LFC L;  3KDF A;  4FNF A;  4R4O A;  1HFN A;  3LGJ A;  3TRE A;  5M3M G;  2A68 D;  3HP3 A;  4DV4 L;  3CCL A;  2R92 G;  4B3S L;  1K3R A;  1SMX A;  3M4Q A;  2A6H D;  3SK8 A;  4QUF A;  2F0J A;  1YNJ C;  4A3D H;  1PH4 A;  4OWT B;  1J5E Q;  1Q3L A;  3I73 A;  3H0G G;  1LYL A;  1MGS A;  1EWC A;  4A76 A;  2VQF Q;  4O2D A;  4ZLT F;  1I94 Q;  3FEW X;  4GOP C;  1EOT A;  1KNE A;  1VQP A;  5LHY 1;  4BY7 B;  3NK9 A;  2PPB C;  3TP7 A;  1H9K A;  1VQ6 A;  1TWH B;  1EL0 A;  4HJA A;  2O5J C;  1S5E D;  1G6Z A;  2IX0 A;  2B2W A;  1Q8I A;  2VUM G;  3OIQ A;  4C3I B;  3A8I E;  3F2B A;  1NR2 A;  1AEX A;  5IWA Q;  4A3I B;  4LFA Q;  1TS2 A;  1P8L A;  2LS0 1;  1D7Q A;  3PV0 A;  4LFB L;  2GN5 A;  3I4N B;  1LM0 A;  3ONA B;  5IYC H;  4JW0 A;  3GTO H;  4A3L G;  3KJP A;  5EGT A;  3K7U C;  1LTR D;  1UWV A;  3T1H L;  4IUP A;  3AYH B;  4EGV A;  2ENB A;  4ILW A;  3I91 A;  2GVA A;  2UUA L;  1P16 A;  1TWF B;  2AUK A;  2TMP A;  4GLX A;  1K73 C;  2PO4 A;  4S3S A;  5DLQ E;  5IP7 G;  2JN4 A;  1A6X A;  1TWG B;  3S2D H;  1E2W A;  2M00 A;  3A5Z B;  1E1T A;  5IOD A;  4JI3 Q;  1XPO A;  3RLO A;  2E2I H;  1PZK D;  2JP1 A;  4HJ9 A;  4A93 H;  3PO3 B;  1XMQ Q;  2H5X A;  2VB2 X;  3DXJ C;  3S16 B;  3Q23 A;  4HIO A;  1KAA A;  1AN8 A;  4H0L C;  2YTX A;  4YHH Q;  4DXG A;  3OHX C;  2F0S A;  4HJ8 A;  4YY3 L;  4Q5V A;  1D5X C;  5M5W H;  5A2Q L;  2IX1 A;  3J80 c;  2Z9H A;  1RKN A;  2WIN B;  1Y1W G;  2D2C C;  4IFD H;  3SR1 A;  3D8G A;  1CT1 D;  1XTC D;  4X66 Q;  1L1O C;  1BO0 A;  3E0J A;  5C4X H;  1C4Q A;  4L63 B;  4BBS G;  5M9O A;  1WJJ A;  3W2D A;  1Y1V G;  4RKL A;  1AH9 A;  3H91 A;  4FF3 A;  3G4S A;  1TT2 A;  1KRS A;  3B6Y A;  4XXE A;  4H02 A;  1F2Y A;  1XNR L;  3NEN A;  4A3B H;  4FXK C;  1IXR A;  4KJO A;  2R92 B;  1EY0 A;  4O0A A;  1DD2 A;  3HOU G;  4GS3 A;  5EBD A;  1UEB A;  2KVM A;  4C2M B;  4LMQ D;  3GP7 A;  1Q12 A;  3A54 A;  1KTK A;  1N34 Q;  1BJ6 A;  2I5L X;  2NN6 G;  1HPC A;  3EA6 A;  3HOZ H;  4X65 Q;  3K59 A;  1O7Y A;  3SVM A;  4RKB A;  3GV6 A;  4DV5 L;  4GN4 B;  3AFQ A;  2KA7 A;  3K5M A;  5LL6 S;  2CH4 A;  1PYS B;  2A1A A;  2EY6 A;  2OTL A;  1I50 B;  1STH A;  1FVI A;  5JEA J;  1PA6 A;  1IBM L;  2UUB L;  1LLR D;  2UU9 L;  2WB1 B;  1M1K C;  3MXN B;  1A15 A;  3GTM H;  4JCV E;  4DUY L;  4LNQ A;  1E2V A;  3M4O B;  4WJW A;  1GUN A;  4JV5 L;  4EQN A;  1L0X B;  1X55 A;  3I90 A;  4CGY B;  1VQC A;  4KV6 A;  4K0K Q;  1PDQ A;  5G3L D;  4B3R Q;  1AZP A;  4DN4 M;  1PFS A;  4WRD A;  4A3F G;  1HJP A;  3E9H A;  5M3M H;  2ZTC A;  1KIX A;  5C3E B;  3F2D A;  2RVL A;  2H1E A;  4ZK9 B;  1EQR A;  1M8A A;  1V8Q A;  2NTS A;  1IW7 D;  3CC2 A;  4GNX A;  4R4Q A;  1BCP B;  4DV2 L;  4C3H G;  4IZ8 A;  5D3D A;  1XNQ L;  1F9P A;  3IL8 A;  4DR7 L;  3D3R A;  1MIU A;  4UY8 C;  2VQE L;  1A0I A;  1JOK A;  4OON A;  2ZM6 L;  4CKE A;  5I4D A;  3M4P A;  3S1R H;  5A35 A;  1EY8 A;  4HJ5 A;  4JOI A;  1N36 L;  4QUC A;  4LK1 C;  1S5D D;  2Q8R E;  3GTK H;  1V1P B;  5I9O A;  1K8A C;  4NW2 A;  2B63 H;  1HR0 L;  3K57 A;  3HKZ G;  2R6G A;  3P7J A;  3D4D A;  5IGC A;  2PMZ B;  1OXU A;  3HOW G;  4DK0 A;  2LXJ A;  1PTO D;  4QMG A;  5M5X H;  3HOY H;  2XN9 C;  4NXM L;  5T1I A;  2AMC B;  4RGM A;  1K9M C;  2R61 A;  1GXD C;  2CKZ B;  1CM9 A;  4WOR A;  1GKH A;  1VCI A;  1Y1V B;  3VA5 A;  2K32 A;  2KCM A;  3HFZ B;  1WTV A;  4A3L H;  4K6L A;  3OWE B;  4DV7 Q;  2PZT A;  3S1N B;  2F0K A;  4YWL A;  1UE7 A;  3BDC A;  3HOU B;  3TEH B;  4J6H A;  2A6E C;  1PH3 A;  3UDF A;  2UXC Q;  2ES2 A;  2E75 C;  1CQF A;  5D3I B;  1ESK A;  3AU7 A;  3C2P A;  3TP5 A;  1SFO B;  2EZV A;  4HED A;  1YNN D;  1NMG A;  3KLR A;  5E7N A;  3FDT A;  1I5F A;  1I4H A;  2EYM A;  3SHL A;  1HQM C;  1KLU D;  3N52 A;  3P75 A;  2ATW A;  3HKS A;  4QL5 A;  1E0B A;  4JI8 Q;  3GTQ B;  2HDL A;  4RGN A;  3JAM i;  2X6G A;  5C3X A;  1CFM A;  1EIF A;  1J5E L;  4DFA A;  2NYZ D;  4NB3 A;  2VQF L;  4ZKC B;  3PMF A;  1VQE A;  1I94 L;  2F0D A;  4PZ8 A;  5KND A;  1YBY A;  5DEH A;  4DUZ Q;  4CBV A;  2SEB D;  4A3F B;  1VQG A;  3OIP A;  5FLM G;  3SK4 A;  3RUZ A;  5ELO A;  1ASY A;  2K5V A;  3S1M H;  4JI6 Q;  4C3H B;  2QW7 A;  4LF8 Q;  2D9U A;  4X3U A;  5COR A;  4P71 A;  4A3M G;  2F4I A;  4BXX G;  2C5C A;  1TU2 B;  1U9R A;  2A68 C;  4DNT B;  1VQA A;  5HGQ A;  5IWA L;  2F0Q A;  1SYB A;  4DAY A;  4DR2 Q;  4LFA L;  1BCP C;  3QWN A;  1EIY B;  3VDY A;  2A6H C;  5K36 H;  1WWE A;  1X65 A;  1YHA A;  2F3I A;  2WP8 J;  4LF9 Q;  3CPF A;  2B2T A;  5GAG C;  4LF4 Q;  4FYD A;  2WAC A;  4L5S A;  4FF1 A;  2Z4H A;  2QEJ C;  1C8C A;  1VQK A;  3MEF A;  3EN2 A;  2ZJP A;  4PZ7 A;  3K0X A;  3K58 A;  2Z8L A;  2B2U A;  1XPR A;  3KF6 B;  1Q90 A;  2E8G A;  3S17 B;  1VMP A;  1DJR D;  1O80 A;  3ERO A;  4DR6 Q;  3UE0 A;  3NE5 B;  1TQO A;  4Y7N B;  1EYC A;  2OT2 A;  4A75 A;  1X3G A;  3NTK A;  5AJ3 Q;  3MA2 B;  5CV8 A;  2R93 H;  1CKM A;  1EU3 A;  1R4Q B;  1G51 A;  2AQ2 B;  4C3J B;  1XMQ L;  2K5Q A;  4ALP A;  4JBM A;  4MHE A;  2AHO B;  2NVT H;  1FGB D;  1H9J A;  4YHH L;  3VR2 A;  2JK8 A;  3MWY W;  4R8N A;  4DR1 Q;  1U4M A;  1U4R A;  2E74 C;  1STN A;  5NUC A;  3BU2 A;  3EIV A;  2N49 A;  4IUR A;  4DK6 C;  4DV3 Q;  1H9M A;  3S14 B;  2JA7 B;  3PCO B;  1STA A;  4QIW B;  1HFG A;  4X66 L;  1TII D;  2YU9 B;  3D0F A;  4PQX A;  2JA6 H;  3NTI A;  2M9V A;  3V2T A;  4XDX A;  2RDG A;  4F87 A;  3A56 A;  4LWC A;  3H6M A;  5BN5 A;  1CKN A;  4L8J A;  1F2L A;  3VYR A;  4AQY Q;  4UP9 A;  3HOW H;  1PTO B;  4R4I A;  1HR0 W;  1SBB B;  1N34 L;  4TSS A;  4IUN A;  4UPA A;  4X65 L;  1PH5 A;  1D2B A;  3KLS X;  1X32 A;  5ELC A;  2DJG C;  3BYY B;  3GTP B;  4JK1 C;  3I8Z A;  4QJF A;  3T51 B;  1QUQ A;  1CHP D;  4H7B A;  3CQZ H;  3KF8 B;  3M9B A;  1QG7 A;  3I56 A;  1U5K A;  5JEA G;  5ELD A;  5FLX c;  1GD7 A;  2HIV A;  3F2C A;  2OTJ A;  1A1T A;  5GAD C;  5E1F A;  1QJO A;  2KHJ A;  3EBE A;  5GRO A;  4HMI A;  4A3M B;  1Q8K A;  3AB9 A;  1KL9 A;  4ODG A;  2FJ2 A;  4KKS A;  3HOX G;  4A3C H;  4X64 Q;  3JAM L;  3CCJ A;  4JBJ A;  2FMM A;  2B2V A;  4DGZ A;  1MI2 A;  5IYB G;  2E5L Q;  1WCM H;  2Q2U A;  1G91 A;  2XVS A;  4K0K L;  2FMC A;  2Z1C A;  1JMC A;  4IOC A;  1MJC A;  1A3U A;  2SOB A;  1WFQ A;  1ZYR D;  2PNR C;  4B3R L;  3BYT B;  1QE6 A;  3I4M B;  1WTQ A;  1KDC A;  4KN7 C;  2L5T A;  5I6W A;  2KBN A;  3MAQ A;  4L5Q A;  4OL7 A;  2SNS A;  3E5S A;  3FPP A;  2X69 A;  1ET9 A;  1XX8 A;  3U4Z A;  1U4L A;  5K5P A;  2IHF A;  1KRT A;  1X3P A;  2Q2H A;  3J81 c;  1WTW A;  4FF2 A;  4UAI A;  1EQT A;  3NEM A;  1EYG A;  4P72 A;  2JA8 B;  1JOR A;  3VYU A;  5I6Y A;  4ME5 A;  3IAY A;  1G2T A;  1V43 A;  1FJG Q;  3HS0 C;  4ID6 A;  4XIG S;  2E2H B;  4GZY C;  5T1G A;  2R7Z G;  3FHW A;  1CTM A;  1KAW A;  3U50 C;  4JI1 Q;  2JSO A;  4I7A A;  4HJ7 A;  3IFT A;  5C0X I;  5I2X A;  2VY3 A;  1R9T H;  4C3I G;  1A2T A;  1PH9 A;  5JVH 3;  5ELN A;  4CKB A;  4JBW A;  5LL6 X;  2ZJQ A;  4K6D A;  3I4N G;  1JJC B;  4DA2 A;  3DWP A;  3R2T A;  3DEP A;  3GTL B;  3PGZ A;  5COY A;  1B3A A;  3MFG A;  1IW7 C;  2V1C C;  1M90 C;  1K83 B;  1F77 A;  2EOT A;  4OEM B;  3K8A A;  3OW2 A;  1PH6 A;  5E4X A;  1J9O A;  3VR4 A;  2NVQ B;  3VA7 A;  1LT6 D;  1NNX A;  4NP5 A;  5FO9 B;  3CRL C;  4DV7 L;  2BA1 A;  1XYI A;  4CDE C;  3G71 A;  2NVX B;  2JQO A;  4I7Z C;  5C44 H;  4KY7 A;  1A3V A;  4XQQ A;  2CHB D;  1JQY D;  2F52 A;  1WWF A;  3M4Y A;  1Q1E A;  3NTH A;  2I5M X;  1TWA H;  1MJE A;  5IGG A;  2UXC L;  3PUY A;  4XT1 B;  2E2J B;  3EFX D;  1UAP A;  2UXB Q;  1A62 A;  2DNC A;  2K50 A;  4BBR G;  4DAP A;  2IPK D;  5IT9 L;  3S15 H;  1VQ5 A;  4KN4 C;  4K8I A;  1VQ7 A;  3N6R A;  1CK1 A;  2I0Q A;  1U0L A;  1PRT F;  1GOZ A;  2JEA I;  4JC0 A;  5CV9 A;  1EYA A;  3MHB A;  5FJ8 G;  4DR4 Q;  1PTO C;  1GHJ A;  3PIO 3;  3ERS X;  4JPB W;  4DV6 Q;  4LF7 Q;  3C3L A;  3M7G A;  5GQO A;  2JA9 A;  2R7D A;  4A3K H;  1BKB A;  2XWJ B;  4GLV B;  1VF5 C;  3GO5 A;  4JI8 L;  1MHW C;  4OIJ A;  3RZD H;  3U9O A;  4MTK A;  4DF7 A;  5C0X H;  3J7A 5;  4I65 A;  3VYS A;  3VR6 A;  3AEV A;  1WWG A;  1C9O A;  2Z4I A;  1T5X D;  1SNO A;  4Y52 H;  3KBG A;  1PYB A;  1NJI C;  2EYJ A;  1F9Q A;  5D14 A;  2IL8 A;  1DM0 B;  4ZUI A;  1MSG A;  3M3Y H;  4JI2 Q;  3QOJ A;  2A5H A;  3MXP A;  2ZTE A;  1CZW A;  4IUV A;  4DUZ L;  3SDZ A;  4UP7 A;  1XWE A;  3DM3 A;  5J39 A;  2F1M A;  1YNN C;  2XIW A;  3SE0 A;  1A6B B;  2LXK A;  4JYA Q;  3Q0A A;  4QB4 A;  1IHZ A;  1QVC A;  4DAM A;  4JI6 L;  1A8V A;  4BY1 H;  4LF8 L;  1BR9 A;  2KED A;  5AFW A;  4RCN A;  3JAM E;  5EPL A;  1VQF A;  1ET6 A;  2EJF C;  4DR2 L;  2R7Z B;  1EOV A;  1PYW D;  1UUP A;  1TY0 A;  4IPC A;  1IBK Q;  1MSH A;  1JWM D;  4AYB E;  3KUP A;  3Q22 A;  2F3V A;  1SLJ A;  1QWY A;  2NB0 A;  2WB1 G;  4LF9 L;  4LF4 L;  3S2D B;  5I9P A;  3L2P A;  4DV0 Q;  3I70 A;  1BBW A;  1SE2 A;  5C5L A;  3P1H A;  5JJL A;  4POF A;  3FKI G;  1BQQ T;  4DAY B;  4A93 B;  2E2I B;  3DEO A;  1EFI D;  1RCV D;  4R4T A;  1PH2 A;  3PO2 H;  4O42 A;  1G29 1;  3X3N A;  2PW5 A;  4A3G H;  3AQQ A;  1KD1 C;  3DWQ A;  4DR6 L;  5EKL A;  3L3O C;  3RZO H;  2WII B;  5AJ3 L;  1IZ6 A;  3FVQ A;  5C3E G;  1SAP A;  2OF1 A;  4KY5 A;  3CMA A;  5ELB A;  3SXH A;  4H44 C;  5JJK A;  1EWI A;  3OW7 A;  3V05 A;  3MEH A;  3OTO Q;  2YTY A;  4DR1 L;  1RJT A;  1SE3 A;  3UE1 A;  4KD4 A;  4BBR B;  3TS2 A;  3MVV A;  2KCC A;  5LMN Q;  5CV7 A;  4BY7 H;  4MIU A;  2JA5 H;  3DLL A;  4DV3 L;  4HTH A;  2Y0S G;  4P73 A;  4U67 3;  5CBA E;  3H3V C;  4OWW B;  3HOZ B;  4ZRZ A;  3M7N A;  3TDQ A;  1GVP A;  2R7F A;  3HG9 A;  2HIX A;  2RSN A;  3UI2 A;  4X3T A;  1B9N A;  4A3E G;  3S24 A;  2HUG A;  2F03 A;  4AQY L;  2PQA A;  4DR5 L;  4HCS A;  1IL8 A;  1B8A A;  4JI7 Q;  2P5Z X;  4A3I H;  5M3F B;  4IPH A;  1JOQ A;  2BE5 C;  1SNP A;  3I4N H;  5EPJ A;  4KKU A;  2G5D A;  1G8Z D;  4G7Z C;  1CSQ A;  2MUY A;  5IT9 E;  4IUU A;  3GTM B;  2EY1 A;  2OQK A;  1WWD A;  1HZC A;  2XRQ D;  3J81 j;  3LNN A;  1I4G A;  2EYO A;  1DCZ A;  2F0U A;  2KJX A;  3E0E A;  4K2K A;  2F4V Q;  3ICE A;  2QKI C;  5LMU Q;  4A3J B;  2QEX A;  3HOV H;  1HNW Q;  1ASZ A;  1SXT A;  3F1Z A;  1KDB A;  5J1Z A;  4UDU C;  3Q24 A;  1TWG H;  4X64 L;  1STY A;  5CBE E;  5IYD H;  1YIT A;  2HCI A;  2HD3 A;  3TME A;  1I3Q H;  1JB3 A;  1GJX A;  4YWM A;  2E5L L;  2WAQ E;  3PO3 H;  5CGK A;  1VQM A;  1S3O A;  1Z6H A;  4CJ0 B;  3S16 H;  3QO2 A;  1A63 A;  1BXT A;  5FJ8 H;  2EYL A;  4N8F A;  2Z6K C;  3CPW A;  1S72 A;  2LI8 A;  3S1R B;  1VQD A;  1E2Z A;  4KHP Q;  2NVY H;  3FKI B;  4OX9 Q;  1G2S A;  1GUT A;  4K5X A;  3FMC A;  2J4X A;  1VQ9 A;  3GTK B;  3J80 i;  2B63 B;  3E3X A;  4B3M Q;  2WV6 D;  5JAV A;  1FJG L;  2ICE C;  4GOP A;  2EPB A;  2F0V A;  1FYC A;  5GAH C;  5M5X B;  3NBI A;  1JWU D;  1UE5 A;  2R92 H;  1DYQ A;  1SJH D;  1HUN A;  1SJE D;  2HDM A;  1ICW A;  4JI1 L;  1LT5 D;  1EY9 A;  1L0W A;  2I5H A;  4EQO A;  2AKW B;  3H0G H;  1ZYR C;  1AAF A;  2ZTD A;  2K14 A;  4OEL B;  1LAB A;  2PCF B;  1LV9 A;  5EPK A;  4YWK A;  5IOC A;  1JWS D;  4OGQ C;  2Y0S B;  3H09 A;  1KXL A;  3NBH B;  3CC4 A;  4DXF A;  4FVM A;  1SMY D;  4L5R C;  4CJ1 B;  1STE A;  1C0A A;  3OPO A;  1BDO A;  1PRT D;  2HHH Q;  4LF6 Q;  4J1M A;  3WWV A;  3T1Y Q;  4CDD C;  4H13 C;  3G7L A;  4MN3 A;  4A3E B;  2VUM H;  4KHZ A;  1Y69 U;  2X6L A;  3NQT A;  1JE5 A;  2UXB L;  4DNI A;  2RCF A;  1X3F A;  1Q86 C;  1M4V A;  1YHB A;  1B9M A;  1LTT D;  2IJ0 A;  1C7Y A;  1ONL A;  2UXD L;  2IX3 A;  1WVL A;  1VDZ A;  4IFD J;  1X56 A;  4C3J G;  1E1O A;  4DR4 L;  2DUD A;  3T4A C;  2KCN A;  4HN7 A;  4DV6 L;  3PF5 A;  4LF7 L;  4ME3 A;  2NN6 I;  1X3E A;  2N55 A;  4LW1 A;  3GDE A;  2O4X A;  1SYG A;  4PMC A;  5IP7 H;  2N8N A;  1WOC A;  2ZT9 C;  5A2Q E;  2JA7 G;  1HZB A;  1UE6 A;  2CW0 D;  4M1U B;  4EVO A;  1NY4 A;  1Y14 B;  1BF4 A;  5EKI A;  3S1M B;  3NSW A;  1WTR A;  2G9H D;  4XQN A;  5CMD A;  1H9S A;  1E24 A;  3BJU A;  4JI2 L;  1MBY A;  1L1O A;  2Z6B A;  1SYE A;  1GUS A;  4CJ2 C;  2K5D A;  4BA2 I;  1QNU A;  1HNX Q;  4JI4 Q;  1YEZ A;  4KTA A;  4JYA L;  4NMZ A;  5FK9 C;  3KDF B;  3KFU A;  1Y1W H;  2ZXO A;  1W6K A;  2L1B A;  3IKJ A;  4ZCK A;  4BBS H;  4RGO S;  3A55 A;  3G48 A;  1Y1V H;  4NDX A;  4PG3 A;  3K7A H;  1PXU A;  4U68 A;  1F2M A;  1TS3 A;  2RDH A;  1VQ8 A;  3TS0 A;  2ASB A;  4GKJ Q;  1ICF B;  3NXW A;  1IBK L;  3CW2 C;  1PMR A;  2B2Y C;  3K80 C;  4JI0 Q;  3HOU H;  1Y8O B;  4GN3 B;  3W5O A;  1NAP A;  1NMF A;  2L4L A;  4DV0 L;  1VQL A;  2CCZ A;  3SEB A;  1CA6 A;  2R93 B;  2EQS A;  2NN6 H;  3PSI A;  3J7A F;  4N9P A;  1Y8N B;  3KOJ A;  4CDC C;  4JBK A;  3W3A A;  3I55 A;  4YCW A;  1N32 Q;  2NVT B;  1E3P A;  1WD1 A;  1ENC A;  4BXX H;  4PMB A;  2B8G A;  1SE4 A;  3J80 L;  3I4M G;  3PIP A;  1SYC A;  1DXM A;  1B70 B;  1D5Z C;  1EYD A;  4LJZ C;  1Z9F A;  4OIK A;  4RFB A;  3SGI A;  4R9W A;  1JIC A;  1JR0 D;  1SEB D;  4B3T Q;  2F0I A;  1JC7 A;  1HZA A;  1Z47 A;  2YTV A;  1TWC B;  4XYQ A;  1OO9 B;  5JPM C;  1VS0 A;  2JA8 G;  3MXG A;  1HXY D;  3OTO L;  2MGS A;  3TZU A;  4DAV A;  1XMO Q;  3S2H H;  5LMN L;  4JI3 L;  5IGE A;  1B7Y B;  1PZI D;  4MTN A;  1FNU A;  4A3F H;  1OTC A;  4G7H C;  1ZXT A;  1RTO A;  2CQF A;  3OOC A;  1MD2 D;  3CCM A;  3D4R A;  1FGU A;  4C3H H;  1CA5 A;  3W1B A;  2F0L A;  4DKA C;  2LMC B;  1FNV A;  3AFP A;  5EBC A;  4RHS A;  4JI7 L;  1C48 A;  3PUV A;  2A19 A;  1YJ9 A;  5C4H A;  5KGU A;  3CF5 A;  2EIF A;  4IN3 A;  4CKC A;  4E6I A;  4C1N I;  1QIL A;  4UP8 A;  4ULL A;  1CQV A;  1TS4 A;  4G4K A;  5FOB B;  2MP1 A;  1WCM B;  1PRT B;  1QZG A;  1JJ2 A;  1K8O A;  2AUJ D;  5LMU L;  1W3S A;  2WB1 E;  4TQU S;  1OXT A;  4DK3 C;  2XTI A;  1HNW L;  3S17 H;  3RN2 A;  2RHS B;  4YCU A;  2NWG A;  4A3D G;  4P74 A;  1S5F D;  2HQE A;  1MFS A;  2EYF A;  1D5M C;  5CV4 A;  3OMG A;  4C3J H;  2WKC A;  5EAY A;  1RIP A;  1DOK A;  3GTG B;  3HRZ C;  1BNZ A;  4XQJ A;  2QA4 A;  4B9X A;  5BN4 A;  3A7L A;  2RF4 A;  4L6T B;  2WKD A;  4M8A A;  2EDG A;  3PIO A;  4KHP L;  2L12 A;  2IY5 B;  5C6A A;  4OX9 L;  3S1Q B;  5IY0 A;  4YIJ A;  4EQ5 A;  5CV6 A;  3RN5 A;  2CVR A;  2NBF A;  2UUA Q;  2J0T D;  3J7A V;  1Q81 C;  2YU9 H;  4ABN A;  1PH1 A;  1S5B D;  1R9T B;  3ND8 A;  1TXY A;  2D0O A;  1SR3 A;  4B3M L;  2K1B A;  4PNY A;  1Q82 C;  1NTG A;  3ULL A;  3KJO A;  3T53 B;  4HCE A;  3MXN A;  3CHB D;  5IYC G;  3IRB A;  2D0P A;  2B2W C;  2EYP A;  2K4K A;  1PTO H;  2TSS A;  3MXU A;  3C1E A;  2XSC A;  4IOA A;  2BDN A;  4IQZ A;  2PMZ E;  3STB D;  2MQH A;  2F0E A;  2L15 A;  4GNX B;  1GO3 E;  4HIK A;  3KYH C;  3LWU A;  1LTG D;  2IHX A;  2EJM A;  4KJN A;  3BZD B;  1TS5 A;  5FLM H;  2N3S A;  3J80 E;  5FO7 B;  3A5U A;  3K5O A;  4DK1 A;  3CCV A;  4P2C B;  2CWP A;  5H1S E;  1I6V C;  4A93 G;  1QB5 D;  5HUR A;  4X62 Q;  1YJW A;  2HHH L;  4LF6 L;  4A3M H;  3T1Y L;  1I6H H;  1GHK A;  3ERQ A;  1F9S A;  3QG1 A;  4KI0 A;  1HTP A; 
#chains in the Genus database with same CATH homology
 1VQ4 A;  4HJ5 A;  4LFB Q;  4JOI A;  1N36 L;  1D8L A;  2PI2 A;  2WAQ G;  4JG2 A;  1N33 L;  1VQB A;  2EC7 A;  5JJK A;  1EWI A;  3GTK H;  3OTO Q;  2YTY A;  4QGU A;  1K8A C;  3T1H Q;  4DR1 L;  1HR0 L;  2B63 H;  1PVO A;  3H15 A;  3UE1 A;  4RG1 A;  3HKZ G;  1LUZ A;  3TS2 A;  2R6G A;  4IFD G;  5LMN Q;  4BY7 H;  2JJQ A;  2GVB A;  2JA5 H;  3DLL A;  3HOW G;  1OXU A;  4DV3 L;  1VQJ A;  2LXJ A;  3OYY A;  4DPG A;  5C4X G;  1UE1 A;  5M5X H;  1NBW A;  3HOY H;  4A3K G;  4NXM L;  3H3V I;  1F6U A;  2Y0S G;  4P73 A;  2AMC B;  1K9M C;  4OWW B;  2N78 A;  2CKZ B;  4DV1 Q;  4A3B G;  3M7N A;  1GKH A;  1VCI A;  1EUJ A;  1GVP A;  1IBL L;  5C0X G;  2KCM A;  3HFZ B;  2R7F A;  4A3L H;  2HIX A;  4R1J A;  3J81 i;  4DV7 Q;  2PQA B;  1PV4 A;  3K81 C;  1H95 A;  4A3E G;  4YWL A;  3S24 A;  2F4V L;  4AQY L;  2PQA A;  1UE7 A;  3GTJ H;  4DR5 L;  3TEH B;  2VW9 A;  2FXQ A;  1B8A A;  2C35 B;  1PH3 A;  4JI7 Q;  4A3I H;  2UUC L;  3UDF A;  3HOZ G;  4IPH A;  2JEB I;  2UXC Q;  2M3Z A;  3I4N H;  1TWC H;  1O7I A;  2LSS A;  2ES2 A;  2OWO A;  5LMN W;  1BBU A;  3CME A;  1CSQ A;  2IT1 A;  1ESK A;  4YY3 Q;  4HIM A;  4Y7N H;  1CSP A;  1QZH A;  1NMG A;  4APV A;  2OQK A;  1YZ6 A;  3A0J A;  5E7N A;  1WWD A;  1HNX L;  1HZC A;  3J81 j;  4JI4 L;  1I5F A;  3ICE A;  2F4V Q;  3E0E A;  5M3F G;  2Z0S A;  1X6O A;  2WFW A;  2MO1 A;  4BY1 G;  4DR5 Q;  3M85 A;  4P75 A;  5LMU Q;  4PZ6 A;  2QEX A;  5IP9 G;  3HOV H;  2ATW A;  1SRU A;  1BVS A;  4AH6 A;  1HNW Q;  5M5Y H;  3HKS A;  3KLW A;  1ASZ A;  3TRZ A;  2PNH A;  1K83 H;  3F1Z A;  4QL5 A;  1YJN A;  1K0R A;  2KEN A;  3CP0 A;  3UDX A;  5GAE C;  1TWG H;  4X64 L;  3S1R H;  1XNR Q;  2NVQ H;  4JI8 Q;  5IYD H;  3JAM i;  2BA0 A;  3F8T A;  1YIT A;  1I3Q H;  1QVF A;  4GKJ L;  4YWM A;  2E5L L;  1EIF A;  4A3J G;  1J5E L;  3CCR A;  2WAQ E;  4OWX B;  2JA7 H;  3S14 H;  1VQM A;  4JI0 L;  1S3O A;  3PO3 H;  2LI8 A;  4NB3 A;  1YHQ A;  3S16 H;  2VQF L;  3CCU A;  1A63 A;  1VQE A;  2KHI A;  1I94 L;  1KC8 C;  1OXV A;  5FJ8 H;  4PZ8 A;  2E2J H;  2RCN A;  3HKZ E;  3ULJ A;  1YBY A;  3H3V H;  4WJ3 M;  2Z6K C;  4DUZ Q;  3CPW A;  1S72 A;  3PO2 G;  2HT1 A;  4GKK L;  2Q2I A;  4EX5 A;  1VQD A;  1VQG A;  4QY7 A;  3BZC A;  2MFI A;  4DV5 Q;  1YI2 A;  4KHP Q;  2NVY H;  2JE6 I;  4A3G G;  5FLM G;  4OX9 Q;  2Y0S E;  1N32 L;  2K75 A;  5ELO A;  1ASY A;  2K5V A;  3S1M H;  3UDG A;  1VQ9 A;  1PH8 A;  4JI6 Q;  4BBS G;  3J80 i;  1IBM Q;  2UUB Q;  4LF8 Q;  4A3M G;  2UU9 Q;  1L2F A;  4J15 A;  4P71 A;  4B3M Q;  4GOP B;  1XTD A;  4BXX G;  1FJG L;  2CWA A;  4GNX C;  4QQB X;  4DUY Q;  4GOP A;  1Q1B A;  1VQA A;  5HGQ A;  5GAH C;  3GTP H;  4L5T A;  1VQI A;  5IWA L;  4LUZ A;  1UE5 A;  4DR2 Q;  4LFA L;  2R92 H;  3HOX H;  4B3T L;  4JV5 Q;  1EIY B;  3VDY A;  3L0O A;  1N8R C;  2QGQ A;  1XJV A;  1WWE A;  1X65 A;  1YHA A;  4JI1 L;  2B63 G;  1E7Z A;  2F3I A;  4LF5 L;  1Q46 A;  2WP8 J;  5IYB H;  3CPF A;  4LF9 Q;  4NXN Q;  1L0W A;  2I5H A;  2OQ0 A;  5GAG C;  3I7F A;  4LF4 Q;  2AKW B;  4L5S A;  3H0G H;  3GTG H;  4A4I A;  4BY7 G;  1Q3Y A;  1XMO L;  2JA5 G;  1AAF A;  2ZTD A;  4IFD I;  3I2Z A;  2K14 A;  1VQK A;  3MEF A;  3EN2 A;  2ZJP A;  3HOY G;  2XGT A;  4JOI C;  4QIW E;  4PZ7 A;  3K0X A;  4AIM A;  2D62 A;  4YWK A;  1XPR A;  3S1Q H;  3KF6 B;  2E8G A;  1VQH A;  3UDI A;  4DV2 Q;  3KF6 A;  1Q7Y C;  1XNQ Q;  1KXL A;  3NBH B;  4OXP A;  4DR6 Q;  3CC4 A;  3UE0 A;  3I4O A;  4DR7 Q;  3G6E A;  4L5R C;  4OO1 G;  1DGS A;  4MNO A;  4A75 A;  1X3G A;  4JI5 Q;  2NZO A;  1C0A A;  5AJ3 Q;  4POG A;  2VQE Q;  3I4M H;  2HHH Q;  3U58 A;  4LF6 Q;  1JB7 A;  3T1Y Q;  3WWV A;  2ZM6 Q;  2R93 H;  4A3I G;  1RL2 A;  4IJL A;  1CKM A;  1XMQ L;  1G51 A;  3RLN A;  2VUM H;  5BR8 L;  4KHZ A;  1TWH H;  4ALP A;  1EQQ A;  4JBM A;  2R7Z H;  1N36 Q;  2AHO B;  1HNZ L;  1JE5 A;  2NVT H;  1N33 Q;  1Q3Z A;  5J3B A;  4YHH L;  2UXB L;  2JK8 A;  4DNI A;  1X3F A;  1Q86 C;  1YHB A;  4DR1 Q;  1HR0 Q;  1C7Y A;  2JA8 H;  2UXD L;  2OTJ A;  3U4V A;  4IFD J;  1X56 A;  3CCE A;  2E2H H;  4C3I H;  3BU2 A;  3EIV A;  2N49 A;  1E1O A;  4DK6 C;  4DV3 Q;  3HOV G;  1JT8 A;  3PCO B;  2ALY B;  2K5H A;  4X66 L;  2Q2T A;  4DR4 L;  3RNU A;  2DUD A;  4NXM Q;  5IE8 A;  3D0F A;  3J7Z C;  4DV6 L;  3PF5 A;  4LF7 L;  1AE2 A;  4ME3 A;  2JA6 H;  2NN6 I;  1X3E A;  4LW1 A;  3NYB B;  3GDE A;  4RMF A;  2AWO A;  4LWC A;  5IYD G;  2JZW A;  3CD6 A;  1CKN B;  5IP7 H;  2VNU D;  2N8N A;  1WOC A;  1IBL Q;  4GN5 A;  5C0X J;  1VQO A;  1VQN A;  2UXD Q;  1CKN A;  2JA7 G;  3PO3 G;  1NE3 A;  1HZB A;  1UE6 A;  1KHI A;  1NY4 A;  1Y14 B;  1TWF H;  4AQY Q;  4UP9 A;  2MO0 A;  3CCQ A;  1N9W A;  3GTL H;  3HOW H;  1L1O B;  3ZJY C;  4R4I A;  1HR0 W;  2BH8 A;  2UUC Q;  1E24 A;  2B29 A;  1QVG A;  1N34 L;  3BJU A;  4JI2 L;  1L1O A;  4UPA A;  4X65 L;  4DR3 L;  1YIJ A;  1PH5 A;  4X6A H;  1QUQ B;  2YSA A;  4QJF A;  1QUQ A;  4BBR H;  4BA2 I;  3CQZ H;  1HNX Q;  4JI4 Q;  1CUK A;  1YEZ A;  3KF8 B;  3M9B A;  4JYA L;  2AWN A;  3Q8D A;  2NVX H;  1CKO A;  3TQY A;  5C4J H;  3I56 A;  3CC7 A;  1V9P A;  2IHE A;  1U5K A;  3KDF B;  5JEA G;  1OXX K;  1V1Q A;  5FLX c;  1GD7 A;  2NZH A;  1Y1W H;  1W2B A;  1MKH A;  3KFU A;  1SN8 A;  2HIV A;  4LUV A;  3JC6 6;  3F2C A;  4KLK A;  4LFC L;  3KDF A;  5GAD C;  4R4O A;  3PUZ A;  1S40 A;  1PH7 A;  1A1T A;  3LGJ A;  3TRE A;  5M3M G;  2KHJ A;  3EBE A;  4GLA C;  5GRO A;  1Q8K A;  4BBS H;  4DV4 L;  3CCL A;  1KL9 A;  3G48 A;  1HH2 P;  1Y1V H;  3HOX G;  4PG3 A;  4X64 Q;  4B3S L;  2R92 G;  3D31 A;  3K7A H;  4A3C H;  3CCJ A;  4JBJ A;  1K3R A;  1J6Q A;  1SMX A;  3M4Q A;  5K36 G;  2CFM A;  1VQ8 A;  4A3D H;  3ER0 A;  3TS0 A;  4A93 G;  1K8G A;  2ASB A;  4GKJ Q;  1PH4 A;  5IYB G;  2E5L Q;  1WCM H;  4OWT B;  1J5E Q;  2Q2U A;  1IBK L;  3CW2 C;  4JI0 Q;  3HOU H;  3K80 C;  3H0G G;  1LYL A;  1JMC A;  4K0K L;  4GN3 B;  4A76 A;  2VQF Q;  4O2D A;  4IOC A;  1MJC A;  3W5O A;  5M3F H;  1OXS C;  1WFQ A;  1I94 Q;  4B3R L;  4GOP C;  2KCT A;  2L4L A;  1NMF A;  4DV0 L;  1VQL A;  5IP9 H;  1VQP A;  2CCZ A;  2EXF A;  2EQS A;  2KBN A;  4L5Q A;  1E22 A;  4GKK Q;  3PSI A;  1EFW A;  3KOJ A;  1VQ6 A;  4IO9 A;  4JBK A;  4HJA A;  3U4Z A;  3I55 A;  4YCW A;  1N32 Q;  4XTC S;  2IHF A;  1E3P A;  1KRT A;  4C2M H;  2Q2H A;  3FP9 A;  3J81 c;  2IX0 A;  4IJH A;  4MZ9 A;  3NEM A;  4A3J H;  3I4M G;  3PIP A;  4YCV A;  1EYG A;  4OO1 I;  4P72 A;  2R93 G;  1B70 B;  1V43 A;  4X62 L;  1FJG Q;  1Z9F A;  4XIG S;  3SGI A;  2VUM G;  1WI5 A;  2R7Z G;  3FHW A;  3F2B A;  5IWA Q;  1KAW A;  4LFA Q;  1D7Q A;  1P8L A;  4B3T Q;  3PV0 A;  1IYJ B;  4LFB L;  3L7Z C;  1HZA A;  1Z47 A;  1X54 A;  1LM0 A;  2GN5 A;  2YTV A;  2MNA A;  1I50 H;  5IYC H;  3U50 C;  4JI1 Q;  3GTO H;  1VS0 A;  2JA8 G;  4A3L G;  4HJ7 A;  3KJP A;  4LF5 Q;  3K7U C;  5C0X I;  1UWV A;  3OTO L;  2VY3 A;  3T1H L;  2RHQ B;  1R9T H;  1XMO Q;  3AYH B;  5JJI A;  1G6P A;  2HQL A;  1PH9 A;  3S2H H;  5LMN L;  4JI3 L;  1IL2 A;  5ELN A;  3STB C;  2GVA A;  1B7Y B;  4JBW A;  1P16 A;  2VL6 A;  4MTN A;  2UUA L;  2YV5 A;  4A3F H;  1X9N A;  1K73 C;  4GLX A;  2ZJQ A;  2JA6 G;  3I4N G;  3M4O H;  1HNW L;  1JJC B;  3FKI H;  2CQO A;  3PGZ A;  1OTC A;  5DLQ E;  1T9H A;  2V1C C;  3JAM c;  5IP7 G;  1M90 C;  2CQF A;  3OW2 A;  3K8A A;  3PUW A;  4DV1 L;  1PH6 A;  3CCM A;  1FGU A;  4C3H H;  5HY6 A;  3S2D H;  3W1B A;  3RR5 A;  3A5Z B;  4DV7 L;  1E1T A;  2BA1 A;  4DKA C;  3W1G A;  2VS1 A;  4JI3 Q;  3G71 A;  2JQO A;  5C44 H;  3AFP A;  3RLO A;  1XPO A;  4HJ9 A;  2E2I H;  4A93 H;  5C3E H;  1XMQ Q;  2H5X A;  4JI7 L;  5BR8 Q;  2F52 A;  1WWF A;  2ZJR A;  1Q1E A;  3PUV A;  2I5M X;  1TWA H;  4HIO A;  1MJE A;  1HNZ Q;  3PUY A;  3A74 A;  2A19 A;  1YJ9 A;  2UXC L;  2YTX A;  4AYB G;  4YHH Q;  2UXB Q;  1A62 A;  2K50 A;  3CF5 A;  2EIF A;  4BBR G;  4HJ8 A;  4YY3 L;  3CCS A;  4UP8 A;  3S15 H;  5M5W H;  1VQ5 A;  1XPU A;  2EXD A;  1VQ7 A;  2IX1 A;  2I0Q A;  1U0L A;  3J80 c;  3RLF A;  2JEA I;  4JC0 A;  1Y1W G;  4TVA B;  2YYZ A;  1QZG A;  1JJ2 A;  4X66 Q;  5FJ8 G;  1SE8 A;  1L1O C;  5LMU L;  4DR4 Q;  1W3S A;  2WB1 E;  4R4C A;  3ERS X;  4FDB A;  4TQU S;  5C4X H;  1OXT A;  4DK3 C;  2XTI A;  4DV6 Q;  4HID A;  1GM5 A;  5GQO A;  4LF7 Q;  3S17 H;  1WJJ A;  2JA9 A;  1Y1V G;  2R7D A;  3RN2 A;  4A3K H;  1BKB A;  3G4S A;  2RHS B;  4A3C G;  1AH9 A;  4GLV B;  1LTL A;  1KRS A;  4YCU A;  3B6Y A;  1WYD A;  3GO5 A;  4H02 A;  1XNR L;  3NEN A;  4BA1 I;  3BZK A;  4JI8 L;  4A3B H;  4P74 A;  1IXR A;  2OCE A;  4A3D G;  1WCM G;  3RZD H;  4O0A A;  1MFS A;  1JJG A;  3HOU G;  3J7A 5;  4GS3 A;  1UEB A;  4IPD A;  3AEV A;  1WWG A;  1C9O A;  4Y52 H;  1NJI C;  1PYB A;  5EAY A;  4C3J H;  4A3E H;  1RIP A;  1Q12 A;  1N34 Q;  2BH2 A;  1BJ6 A;  3M3Y H;  4JI2 Q;  2QA4 A;  2I5L X;  2NN6 G;  3HOZ H;  4X65 Q;  2RF4 A;  2ZTE A;  4DR3 Q;  4LUO A;  4DUZ L;  2A8V A;  4UP7 A;  3DM3 A;  3CAM A;  1YNX A;  3PIO A;  4GN4 B;  4DV5 L;  4KHP L;  3NEL A;  3AFQ A;  2IY5 B;  4OX9 L;  1A6B B;  2LXK A;  3S1N H;  5IY0 A;  4EQ5 A;  4JYA Q;  1PYS B;  2A1A A;  3RN5 A;  2OTL A;  2UUA Q;  1FVI A;  2ID0 A;  1QVC A;  5JEA J;  4DAM A;  3CXC A;  1PA6 A;  4JI6 L;  1A8V A;  1Q81 C;  2YU9 H;  1IBM L;  3E9I A;  1PH1 A;  2UUB L;  4BY1 H;  4LF8 L;  2UU9 L;  4LFC Q;  1TXY A;  2D0O A;  1SR3 A;  4B3M L;  1M1K C;  3MXN B;  1Q82 C;  4WJ4 A;  2K5N A;  4DV4 Q;  3GTM H;  1NTG A;  3ULL A;  4JCV E;  2PI2 E;  2B3G A;  3KJO A;  4DUY L;  1SFO H;  4B3S Q;  4LNQ A;  1VQF A;  1U6P A;  1HZ9 A;  2VZA A;  3PUX A;  4DR2 L;  2Z6K A;  5IYC G;  4JV5 L;  1X55 A;  1EOV A;  2DGY A;  5IT9 c;  3IRB A;  4IPC A;  1IBK Q;  1VQC A;  2D0P A;  2K4K A;  4AYB E;  4NXN L;  4NPS A;  2WB1 G;  1SLJ A;  4PMW A;  4LF9 L;  4K0K Q;  1FL0 A;  4LF4 L;  3L2P A;  4B3R Q;  1PFS A;  4IOA A;  1SRO A;  2K52 A;  3STB D;  1BBW A;  2PMZ E;  4DV0 Q;  4A3F G;  1HJP A;  4IPG A;  5JJL A;  3E9H A;  4POF A;  2MQH A;  1YVC A;  3FKI G;  4DAY B;  5M3M H;  2L15 A;  2ZTC A;  4GNX B;  1PHJ A;  1GO3 E;  4HIK A;  3F2D A;  1KIX A;  3KYH C;  4R4T A;  1PH2 A;  3GTQ H;  1EQR A;  3CC2 A;  3PO2 H;  2IHX A;  4GNX A;  4R4Q A;  1G29 1;  4A3G H;  5FLM H;  4DV2 L;  3AQQ A;  2N3S A;  1KD1 C;  1XNQ L;  1AE3 A;  4DR6 L;  3A5U A;  4DR7 L;  3GD7 A;  3CCV A;  2CWP A;  5H1S E;  1MIU A;  3RZO H;  4JI5 L;  5C44 G;  5AJ3 L;  2VQE L;  1IZ6 A;  4UY8 C;  1A0I A;  3PF4 A;  4X62 Q;  5C3E G;  1YJW A;  2HHH L;  4A3M H;  4OON A;  3T1Y L;  2ZM6 L;  4LF6 L;  1I6H H;  3CMA A;  1KQS A;  4BXX H;  3M4P A;  3ULP A;  4KI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...