3TS2A

Mouse lin28a in complex with let-7g microrna pre-element
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
135
structure length
135
Chain Sequence
QLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSINHMVASCPLKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein lin-28 homolog A
publication title Molecular Basis for Interaction of let-7 MicroRNAs with Lin28.
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein/rna
total genus 27
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00098 zf-CCHC Zinc knuckle
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3ts2A01
4.10.60.10 Few Secondary Structures Irregular HIV-1 Nucleocapsid Protein Zinc finger, CCHC-type 3ts2A02
2BA0A 4GOPA 4YWKA 1XNRQ 5IP7G 3UE1A 4DR2L 3PUZA 1YHQA 3HKZE 1NBWA 1X55A 3ULLA 4NB3A 1Q82C 1EIYB 1C0AA 3S2HH 2VS1A 3GTQH 4P72A 2F4VL 4IPDA 1U5KA 5C4XG 5C3EH 4JBJA 1L1OB 4A93G 2E8GA 4X65L 4KHPQ 3CC4A 1Z9FA 1VQHA 3ULPA 1IBMQ 4LFAL 3HOYG 4JOIA 5ELNA 5C4JH 2YU9H 5FJ8G 1KXLA 4OONA 2VQFL 1VS0A 4MNOA 1W2BA 1Q8KA 3A5ZB 3S1RH 4GKJL 4AH6A 3PO3G 3PV0A 2YYZA 1YJWA 2OTLA 4PG3A 1EOVA 1PYSB 1CKNB 5AJ3Q 1I50H 2UUAL 3FKIG 1S40A 4LF6Q 4IJHA 3HOZH 1WCMG 2ZTCA 2BH2A 4A3LH 1LYLA 1G51A 5IWAQ 5HGQA 5C0XG 1SRUA 1U0LA 1J5EQ 1ASZA 4BXXH 2H5XA 1Y14B 2VY3A 4DK3C 5IP9H 4DV6Q 3RN2A 2NVXH 1JJ2A 4LF4L 2JA8G 2Q2HA 3ICEA 1Z47A 5ELOA 1YZ6A 2R93G 2M3ZA 2PNHA 4DV2L 2K52A 1JJCB 1CUKA 3UDIA 1N36Q 1OXTA 3ERSX 4AIMA 3GTGH 4JG2A 1OXSC 3PSIA 3RR5A 3U58A 3GTKH 4DV1L 3CMEA 4BY1H 2L15A 2R7FA 2OCEA 3CP0A 5FLMG 3K7AH 3F2BA 4A3BH 3S1QH 4OO1I 1QUQB 2EXDA 5GAEC 1KRSA 1Q1BA 1JT8A 3AQQA 1A6BB 4IO9A 3TEHB 2N8NA 3BZKA 2I5MX 3RNUA 1PHJA 3HOWH 3K8AA 4IFDJ 3KDFA 2Z6KC 4DV0L 4DR7L 3STBC 2UUBQ 1IZ6A 3K81C 1NMFA 2VZAA 4OWXB 3HOXG 3J80i 3HOVG 2Q2IA 4JI5Q 2GVBA 2K5NA 3E0EA 4A3EH 2NZOA 3ZJYC 2IHFA 4IPCA 3DLLA 5LMNW 3CC7A 3CXCA 4FDBA 2IX1A 4P71A 4X66L 4O2DA 4DR5L 2E2HH 4BBSH 3TQYA 4NXML 4POGA 2NVYH 2FXQA 2WP8J 1N8RC 2AHOB 5EAYA 5M5WH 1HNZL 5JJKA 1IYJB 1MKHA 4LWCA 2MO1A 4X62L 4X64Q 2MQHA 2VQEL 4DUYL 1Y1WH 2UXDQ 2YTVA 3CCVA 4GNXC 1WWGA 4A3CG 1CSPA 1X56A 1X54A 4QY7A 4NXNQ 2A8VA 3L2PA 4A3JG 1I5FA 3J81j 3JAMc 1OXUA 2NVTH 1Q46A 1NMGA 3I7FA 3PUXA 5LMNQ 4A3KG 4B3RL 1VQLA 1VQIA 3RN5A 2UUCQ 1FJGL 1HR0W 4LF9L 2K4KA 4DV5Q 2UXCQ 1X65A 3M9BA 4B3SL 5JEAG 3KF6B 4YY3Q 1YITA 5HY6A 1VQAA 2AWNA 1TWHH 3MXNB 3NBHB 1Q3ZA 3GTLH 5IP7H 3HOUH 2N3SA 1B8AA 5BR8L 5K36G 1G6PA 3CPWA 5C44G 4JI0Q 1SMXA 1UE1A 4A3MG 3A5UA 2WAQE 4A75A 1J6QA 4HJ7A 2UU9Q 3KF8B 4XIGS 3J81c 1VQGA 1WFQA 4A3FG 1E1OA 4JI4L 1AE2A 1BBUA 2DGYA 3I2ZA 4LUVA 3UDGA 1KC8C 4A3GG 4LFBQ 2OTJA 1L1OC 5M5YH 1EQRA 3LGJA 4DV3Q 4DR1Q 4DK6C 3MEFA 2BA1A 1HNXL 3PIOA 4YCUA 3NEMA 2R7DA 3RZDH 1WWEA 4JI1Q 1YHAA 1PH2A 4JI2Q 5IYBG 4QJFA 2E2IH 1VQKA 4IJLA 3CF5A 5GADC 1PV4A 2VW9A 1GM5A 2IT1A 4LF7Q 1UE5A 1YVCA 1EIFA 4KI0A 4UP8A 4DR2Q 2ID0A 4R4TA 4A4IA 3OW2A 1R9TH 3GTJH 4LFCQ 1XMQL 3CCSA 2JA6H 3TRZA 2QGQA 4YHHQ 4JC0A 2K50A 3PO2H 1LTLA 3CW2C 1GD7A 3L7ZC 3M4QA 4P75A 1KQSA 2JA7H 1HZCA 2NZHA 4HJ9A 2JEBI 3GDEA 2JA5H 3F2CA 4TQUS 1VQJA 2ZTDA 2GVAA 4RG1A 1WOCA 2Y0SG 1A62A 4ALPA 1XJVA 4JBMA 1JMCA 2CCZA 4DV4Q 4A3IG 4UP9A 1WYDA 1IXRA 2PQAA 2VQFQ 3H0GG 4MTNA 1BKBA 1JJGA 2JZWA 1QVFA 4JV5Q 3BU2A 1YHBA 1KAWA 1TXYA 3PUWA 5FLMH 4DUZL 1XPRA 3NELA 1PH6A 1N9WA 3U4ZA 2K5VA 3Q8DA 1JB7A 4LUOA 3CQZH 3W1BA 5IYDH 4DNIA 2YV5A 1HNWL 2UXBQ 3GTPH 4OXPA 5M5XH 3ULJA 3KDFB 3OYYA 4DR6L 1SLJA 2AMCB 4LF8Q 4LF4Q 1K73C 3OTOL 1VQCA 5IT9c 2HHHQ 4GKKQ 3CCUA 5JJLA 3TS2A 2MO0A 1HZBA 3GTOH 3HKSA 4B3TL 4AQYL 1RIPA 3I4MH 3KJOA 4QIWE 2E5LL 2YSAA 3PIPA 3I4NH 1TWCH 1PH4A 3BZCA 2Y0SE 3UDXA 2B63H 2AKWB 1I3QH 5IE8A 2L4LA 5M3MH 1I6HH 3J7ZC 3CCMA 4JI8Q 1IBLQ 4A3DG 4B3TQ 2ATWA 4WJ4A 3RZOH 3L0OA 1VQMA 3VDYA 1VQ4A 2ZJRA 3UDFA 3DM3A 1FL0A 1N32Q 1IBKL 1IBML 1HZ9A 1C7YA 3H3VH 2VL6A 2EQSA 4GLAC 4JI7Q 1WJJA 4R4OA 4DR5Q 2ZJQA 4LNQA 3T1YL 5GQOA 3AFPA 1P8LA 3RLFA 4LF5L 3S1MH 2C35B 2VQEQ 3KYHC 1N33L 1DGSA 4DV7Q 3KFUA 5AJ3L 4GOPC 2R7ZH 5GROA 1NTGA 4HIDA 4DR4Q 2VUMH 2XGTA 3I56A 2WAQG 2KCMA 2F52A 4JYAQ 1F6UA 3FP9A 5IWAL 4UPAA 3W5OA 2A19A 4BBRH 5C3EG 2Q2TA 1W3SA 3KJPA 1J5EL 5IYCH 2JK8A 1K9MC 1EWIA 2NN6I 1FJGQ 1XNQQ 3S2DH 1WWDA 3H3VI 5M3FH 4B3SQ 1N36L 1T9HA 2LXKA 3S24A 2HT1A 4L5RC 4JI6Q 1CKNA 1EYGA 2LSSA 1A1TA 4PZ6A 1KIXA 1PVOA 1YJNA 4JOIC 1XPUA 2CWAA 2JA9A 3M85A 4DR3Q 1PH7A 1VQ9A 1PFSA 1Y1VH 4LW1A 4BA1I 1C9OA 4C2MH 2IX0A 4K0KQ 2R92H 4A3LG 2UUBL 1VQPA 1VQ8A 4L5TA 4JI4Q 4BXXG 1ESKA 1V9PA 5IP9G 4JI5L 1LUZA 2K5HA 5GAHC 1D8LA 4OWTB 4HJAA 1VQFA 4C3HH 2F3IA 3A74A 3E9IA 1M90C 4GS3A 4PMWA 3TREA 1WWFA 3T1HL 3S1NH 4GOPB 1AAFA 4YCWA 1D7QA 1SE8A 1BVSA 2Z0SA 1A0IA 1S3OA 1QUQA 1XMOQ 2JEAI 3F8TA 4BY1G 1AH9A 4QL5A 2CQOA 4HIMA 4A3BG 4JI3Q 1X3FA 1I94Q 1Q12A 4R4CA 5C4XH 4GLXA 2PQAB 1HR0Q 1VQ6A 3HOWG 3S17H 4A93H 1VQBA 4IOAA 1BJ6A 4NXNL 3CCLA 4KLKA 1E7ZA 2LI8A 3M3YH 3PF5A 4YWLA 5LMUQ 3HOYH 4A3EG 2A1AA 5FJ8H 1HZAA 4BY7G 2PMZE 3NYBB 5LMNL 3U50C 4AYBG 2UUCL 3PO3H 1PH1A 3AFQA 4DV5L 1GVPA 2UXCL 4NPSA 2XTIA 4BBSG 3FKIH 2K14A 4YY3L 3FHWA 1WCMH 3JAMi 2F4VQ 4J15A 4O0AA 2OQ0A 3S15H 4UY8C 1Y1WG 1E1TA 1XTDA 4DUZQ 3K80C 4X65Q 1SFOH 5E7NA 1P16A 2JA8H 3RLOA 1B7YB 1N34L 4HJ8A 2UU9L 2CKZB 2R93H 2BH8A 3E9HA 4LFAQ 3CAMA 3JC66 1OTCA 2Q2UA 2ZM6L 4LFBL 1HNWQ 3F1ZA 1MJCA 1YJ9A 1MJEA 4GN4B 3BJUA 1YNXA 4XTCS 4DR1L 4DR6Q 4GKJQ 4LUZA 1UE6A 2Z6KA 4ME3A 1U6PA 3IRBA 1QVGA 4DAYB 4C3IH 2MNAA 2UUAQ 1YI2A 4YCVA 5DLQE 4JI1L 1RL2A 3F2DA 1VQ7A 3J81i 4AQYQ 4OX9L 4DKAC 3I4OA 2QEXA 2E5LQ 4EQ5A 3PUVA 2ASBA 1A8VA 4LF7L 3HOUG 4IOCA 2IY5B 4AYBE 3HOXH 2HIVA 3K0XA 4HIOA 1PA6A 4B3ML 3HOVH 4IFDG 2I5HA 3CMAA 1HH2P 5C0XI 1PH5A 4LFCL 2ZJPA 1A63A 3I55A 1EFWA 3CCQA 3SGIA 5FLXc 4DV2Q 4YHHL 2EXFA 1AE3A 1HJPA 2IHEA 3CCJA 2CWPA 3A0JA 3J80c 2NVQH 1XNRL 4L5SA 3W1GA 2RF4A 4DV1Q 4GNXA 1L2FA 3PUYA 4RMFA 3CCRA 1K83H 1PH8A 1IBKQ 1ASYA 4BA2I 1NJIC 1K0RA 4UP7A 1KHIA 3GTMH 3EBEA 1YBYA 4DV4L 1TWGH 4DV0Q 4DR7Q 4A3CH 1Q81C 3T1YQ 4A3JH 1VQNA 4R4IA 2N78A 1X9NA 3S14H 2WB1G 2DUDA 1X3GA 4APVA 4LF5Q 1MIUA 4JV5L 4Y52H 1JE5A 1N33Q 1SR3A 3UE0A 1X6OA 2JA6G 2CFMA 3KLWA 4KHPL 1H95A 4HJ5A 4A3KH 5GAGC 1CSQA 4PZ8A 3M7NA 3AEVA 4OWWB 1VQDA 3K7UC 1TWAH 2EIFA 1M1KC 2LXJA 4X66Q 3PO2G 4POFA 2JA7G 2UXBL 4NXMQ 4JBWA 2JA5G 1E3PA 2PI2E 4LF8L 1HNZQ 2KENA 4KHZA 3RLNA 2B29A 2RHQB 2HHHL 4X62Q 4GKKL 4DUYQ 3GD7A 4LF6L 5C44H 4A3MH 1L1OA 2JE6I 3G48A 4A76A 1FVIA 4A3FH 3CC2A 2KHIA 5IY0A 4DV6L 4JBKA 4A3GH 2OQKA 2VNUD 3GO5A 5JJIA 1Q86C 4B3RQ 3D0FA 5IYDG 1WI5A 3TS0A 1S72A 1QZHA 4LF9Q 1MFSA 4JI8L 1IBLL 2KCTA 4EX5A 4HIKA 2WB1E 2QA4A 1NY4A 5IYBH 1BBWA 4OO1G 4Y7NH 1K8GA 1SN8A 4H02A 1Q3YA 3EN2A 2I5LX 1PH3A 1B70B 1E24A 5BR8Q 4BY7H 3G4SA 1N32L 2R6GA 3PGZA 3T1HQ 3HOZG 5C0XJ 4JI7L 1PYBA 1EUJA 4MZ9A 1CKMA 3I4MG 4QQBX 1PH9A 1QVCA 3I4NG 3HFZB 1IL2A 1FGUA 2B63G 2D62A 4R1JA 2AWOA 4DV7L 1TWFH 4DAMA 2JJQA 5M3MG 1O7IA 1Q1EA 1HNXQ 2I0QA 4TVAB 4DR4L 3U4VA 4PZ7A 1SROA 2YTXA 1LM0A 2N49A 1UWVA 2HQLA 2D0OA 4GLVB 4JYAL 1XPOA 1VCIA 4IPHA 4A3IH 3NENA 3CCEA 3WWVA 4JCVE 2NN6G 3H0GH 2OWOA 3G6EA 2UXDL 4X64L 1GKHA 1Q7YC 1QZGA 3PCOB 1XNQL 1G291 3B6YA 1E22A 4GN5A 1NE3A 3STBD 4DPGA 2PI2A 1VQ5A 1XMQQ 3AYHB 2MFIA 1KRTA 4P74A 3S16H 4X6AH 2K75A 4JI6L 3M4PA 5J3BA 1KL9A 1YEZA 4IPGA 1CKOA 1EQQA 2R7ZG 4DR3L 1X3EA 1V43A 2KHJA 2VUMG 2ZTEA 4C3JH 2RHSB 3HKZG 3CD6A 1UEBA 2WFWA 1N34Q 1KD1C 3M4OH 3H15A 4K0KL 3D31A 4WJ3M 4BBRG 2GN5A 4GN3B 5IYCG 2ZM6Q 2IHXA 3G71A 2ALYB 1YIJA 5H1SE 1GO3E 1K8AC 3PF4A 1UE7A 4JI0L 3EIVA 5M3FG 4YWMA 4GNXB 2EC7A 3J7A5 4QGUA 3KOJA 4L5QA 1XMOL 4OX9Q 2B3GA 2CQFA 2RCNA 1OXVA 4JI3L 2YTYA 4A3DH 1I94L 3ER0A 2JQOA 2V1CC 1Y1VG 5JEAJ 4DV3L 2ES2A 1VQOA 1HR0L 1VQEA 2KBNA 1L0WA 1V1QA 3KF6A 4P73A 3OTOQ 4B3MQ 2R92G 4IFDI 2D0PA 1K3RA 4R4QA 2E2JH 4JI2L 5LMUL 1OXXK 2HIXA 3CPFA
chains in the Genus database with same CATH superfamily
2KHSA 3HS0C 1TS5A 3KF8A 3HKZE 2XRSD 3E0JA 3J80L 1EWHA 3GTQH 1STGA 3FMCA 4K6LA 1WTWA 4UAIA 1EIHA 4S3SA 1FGBD 1E0BA 1HA5A 2MHVA 1VQHA 1IBMQ 2HUGA 4ZRZA 3LWEA 4LFAL 3DHQA 3J7AV 5LL6X 2VQFL 3TBIB 4GKJL 4AH6A 2E2HB 3QOLA 2B2UA 3VYUA 1PYSB 1S40A 5EKKA 3I91A 1LYLA 1SMYC 5HGTA 2NBFA 5HGQA 5IP9H 3K6OA 4DV6Q 2NVXH 1SNCA 1HCZA 3I8ZA 1Z47A 2R93G 1YNNC 2M3ZA 1ZXTA 2A6HC 2HDLA 1N36Q 3ERSX 4JG2A 1OXSC 4F88A 3CMEA 1BR9A 4CJ2C 4OO1I 3S1QH 1STNA 1TWHB 3AQQA 3BZKA 2RDFA 1S5CD 5KIXA 4DV0L 2A68D 1QILA 3K81C 3NTIA 4HAEA 3QIAA 3HOXG 2EVBA 4IUQA 1KTKA 4M1UB 2GVBA 3E0EA 2J7ZA 3DLLA 2IHFA 1GUTA 4P71A 2E2HH 2WP8J 3RZDB 1LTSD 4XQJA 5M5WH 1HNZL 2E2IB 1IYJB 1DM0B 2VQEL 2SEBD 4L6TB 4Z9CB 3T13A 1C4QA 4A3CG 4NXNQ 1X54A 3E6ZX 3GTJB 1B3AA 4C1NI 3C2PA 2EYMA 1NMGA 5LMNQ 3KUPA 4IUTA 4B3RL 1VQLA 2AUJD 3V05A 3RN5A 2JA7B 4KTAA 2L12A 4DV5Q 2F0GA 2JA5B 1O7ZA 2B39A 5CR3A 1K28A 3KF6B 1EY7A 5HY6A 1JWSD 1TWHH 2XNAC 2EXZA 2IW3A 1OO9B 1G6PA 3HOUH 4B9XA 1D1KA 2OEOA 4O1NA 1HFNA 1O7YA 2CW0D 1J6QA 4HJ7A 4A75A 2UU9Q 3OMGA 4DFAA 1BDOA 3MTSA 4OIKA 4ME5A 2XRQD 1AE2A 3ERQA 5ISRA 5EGTA 4KK7A 1L1OC 4JPBW 4DV3Q 5C4JB 3MEFA 4N8FA 2KCNA 1QJOA 3RZDH 1WWEA 5IIFA 4G57A 2E2IH 5IGGA 1VQKA 1QNKA 1LO5D 5IGDA 2KEEA 1H9RA 1UE5A 1YVCA 4LF7Q 2BCOA 5KNCA 1DYQA 4R4TA 2RKSA 4A4IA 3OW2A 1R9TH 5J22A 3GTJH 4LFCQ 4PQXA 1RF2D 4QB4A 2B63B 1FYCA 3VR6A 5NUCA 1GD7A 4C3HG 2JA7H 1XWEA 2NZHA 1EYCA 2JA5H 3GDEA 1VQJA 3RZOB 2ZTDA 2GVAA 2IJ0A 2OF1A 3SK6A 4UP9A 1WYDA 1Q90A 3C1FA 2VQFQ 3H0GG 4MTNA 2JZWA 5DEHA 3ND9A 1A3TA 3BU2A 2QKIC 5FLMH 3PUWA 1PH6A 4KMUC 1XPRA 3X3NA 3UI2A 1JB7A 2F0QA 3W1BA 1STYA 3TZDA 5FK9C 5CV9A 2D5DA 2AMCB 3OTOL 1VQCA 4BBRB 4GKKQ 1FR3A 1ICFB 2NTTA 1KDBA 1PTOC 4B3TL 4WJWA 2XIWA 1PH4A 3BZCA 2Y0SE 2B63H 1L0YB 5CBAE 1HA6A 2NVTB 4L63B 1I6HH 1VDZA 3M4YA 5CGKA 3RZOH 2OT2A 3L0OA 4DAYA 1VQMA 3VDYA 3J7AF 1K0SA 4KKUA 3K59A 3DM3A 1HZ9A 1C7YA 1ET9A 2D2CC 4JI7Q 2ZJQA 2EYJA 3S1MH 2VQEQ 3KFUA 1O7LA 4GOPC 2F0IA 4HIDA 4HCSA 4K2KA 3I56A 2WAQG 2Z4HA 1F2YA 1PTOB 4BBRH 1EY4A 1RDPD 5FLXE 3HRZC 1SYEA 1NR4A 1M4VA 1L0XB 1Z6HA 5CMDA 4JOIC 5CV5A 1TS2A 4BA1I 4C2MH 4A3LG 1ET6A 1VQPA 2F0VA 2WIIB 1V9PA 4K8JA 2R93B 2F0NA 3J81L 5CV6A 2F3IA 4ID6A 3ND8A 5EPLA 3SVMA 2A6HD 4GOPB 1AAFA 5JVH3 2AQ3B 3GV3A 1GHKA 4BY1G 1JC7A 3DWQA 4A3BG 1X3FA 3CQZB 4PMBA 4MN3A 2PQAB 1HR0Q 3T16A 1VQBA 2FHTA 1BJ6A 4X3SA 3HOXB 4KLKA 1E7ZA 1D5XC 2QDLA 3PF5A 4A3EG 4BY7G 1SEBD 2PMZE 4XDXA 3GTOB 3E5SA 3D6CA 4AYBG 1EOTA 1PH1A 1GVPA 5E4WC 1WTRA 3VR3A 2K14A 1CHQD 4YY3L 4JW0A 3JAMi 1SE2A 2F4VQ 2TSSA 2OQ0A 1HPCA 1JWMD 2KJXA 4DN4M 4J6HA 1PRTB 2NYZD 1B7YB 4HJ8A 2R93H 1KDCA 3JC66 1EY0A 3F1ZA 1MJCA 1BCPB 1SJED 2X6LA 3BJUA 4XTCS 2EYLA 4C3IH 2FINB 2UUAQ 5JOBA 1RL2A 2R7ZB 1TS3A 1A8VA 5FLXL 3HOXH 4HIOA 3HGBA 2I5HA 3CMAA 1XTCD 3MA2B 3SGIA 4YHHL 5KNBA 2RVLA 3J80c 2EYHA 4L5SA 1L2FA 5A2QL 3CCRA 1CK1A 1K83H 4DK0A 1ASYA 3BDOA 4DV4L 4A3CH 2QDBA 3QOJA 3U9SA 1Q81C 4R4IA 4RGTA 5EBDA 2WB1G 4Y52H 1SR3A 4QCLA 1IKLA 4KY6A 2J4XA 4PZ8A 4XT3B 4C3HB 4X66Q 4POFA 3VA5A 4ZUJA 4DAVA 4G7OC 2EJFC 2KOLA 3RLNA 4X62Q 1KAAA 3H0GB 4WFN3 1L1OA 1Y8PB 1CHPD 1EY6A 2RA4A 3DWAA 4RGNA 3S16B 3DWPA 1S4ZA 1ZEQX 5IY0A 3Q0AA 1WTXA 2VNUD 1GUNA 1Q86C 3D0FA 3GP7A 1V1PB 1S72A 2DY7A 1DOKA 1ENFA 4HIKA 1BBWA 4OO1G 3SHLA 1U4LA 3M4OB 4G7ZC 2QF7A 5BR8Q 1N32L 3OWFA 5C0XJ 3CRLC 1EUJA 3C1EA 1CKMA 4QQBX 1STHA 2E76C 1QVCA 1IL2A 2NUCA 2F0KA 2DNEA 1PYWD 4K14A 1HNXQ 1NCVA 4G7HC 1M8AA 1SROA 2HQLA 2MGSA 1A2UA 2D0OA 2KECA 3LNNA 3H09A 2NN6G 1TY2A 3H0GH 2UXDL 1GKHA 3O13A 1XNQL 3VA7A 1VQ5A 3D4DA 3NBIA 1KRTA 3S16H 1LT4D 3E3XA 2Q8RE 1CKOA 1EQQA 5IGFA 2WAQB 3VYTA 3HKZG 3I4LA 3PQIA 3CD6A 3M4OH 4WJ3M 1YIJA 1IW7C 4ZAIA 3AU7A 2YU9B 4JI0L 2P5ZX 3J7A5 4B9WA 4L5QA 3CKIB 1MBYA 2RCNA 1OXVA 3ER0A 2JQOA 1SNDA 2V1CC 5JEAJ 3WDNA 3K5NA 5JJKA 1TY0A 1V1QA 2R92G 3JAME 1J8IA 3MXNA 4QMGA 2D0PA 3NQTA 4QUFA 4WORA 2M2LA 5LMUL 2HIXA 2BA0A 4GOPA 2KEDA 2MP1A 3GTGB 1RTNA 4DR2L 1FNVA 3ULLA 3KLRA 4BY1B 1EIYB 4A3BB 2J0TD 3KLSX 4A3GB 2FJ2A 1V1OA 1LTTD 4IPDA 1U5KA 5C4XG 2CVRA 2VB2X 4X65L 3ULPA 2NB0A 4A3EB 3H91A 4BY7B 4JOIA 3T53B 2YU9H 1VS0A 5J39A 1E2VA 5I2XA 5T1GA 3PV0A 1YJWA 2G5DA 2OTLA 4PG3A 2XWJB 3BVMA 1STAA 1CKNB 3TSSA 4IJHA 3P75A 3HOZH 4U673 1WCMG 2ZTCA 3BVZA 4A3LH 3QG1A 2PQEA 1II3A 4QIWB 1SRUA 1U0LA 1ASZA 4IUVA 2VY3A 3M7NA 2JA8G 1JJ2A 3ICEA 2PNHA 2PW5A 2K52A 2JN4A 1CUKA 1E2WA 3GTGH 3I73A 1B1ZA 3U58A 1KLGD 3GTKH 1WVLA 4BY1H 2L15A 2R7FA 2OCEA 3CP0A 4CKEA 3K7AH 5JPMC 1SNQA 5FLMG 4A3BH 5GAEC 1Q1BA 1QCBD 2CH4A 3NP8A 4IFDJ 3KDFA 3STBC 1IZ6A 3HOVG 5KRUA 4A3EH 2A5HA 3ZJYC 4IPCA 4NDXA 3IFDA 2XWBB 4NXML 2FXQA 4DNRB 5IT9E 5I4DA 2UXDQ 4LWCA 2MO1A 2WKDA 1CSPA 2A8VA 2WB1B 3Q6SA 3L2PA 1PZKD 2B8GA 3J81j 3V2TA 3I7FA 4XQQA 1FJGL 3P7JA 1HR0W 2K4KA 4LF9L 3CRKC 4B3SL 1QE6A 3EJIA 4WRDA 4I7ZC 1QNUA 1VQAA 2AWNA 1Q3ZA 4PMCA 3GTLH 4CDEC 1Q3LA 4JI0Q 1SMXA 5F2DA 3J81c 1VQGA 4A3FG 4IZ8A 1BBUA 1V1PA 2DGYA 3I2ZA 4LUVA 3UDGA 2OTJA 1B4OA 4DR1Q 3OIQA 4DK6C 1VF7A 3GTPB 1JICA 4YCUA 2R7DA 1XX8A 4JI1Q 1YHAA 1JQYD 4EQNA 3CF5A 2GA4B 5GADC 1D5ZC 1W6KA 1GM5A 1EIFA 4DR2Q 5FO9B 5I2YA 3FPPA 5DM63 2D9UA 3CCSA 3TRZA 2NVXB 5IODA 1RHPA 1NAPA 2K50A 4ZKCB 4RHRA 3LWUA 1LTLA 2O5IC 2Z4IA 3CW2C 1KQSA 2JEBI 3F2CA 4TQUS 2Y0SG 1A62A 1S5BD 1D2BA 4JBMA 3S1QB 4A3IG 3R3OA 1WTOA 2I46A 3NELA 3A7LA 3Q8DA 4LUOA 2R61A 1EL0A 1EEFD 2UXBQ 1EQTA 3GTPH 3ULJA 1ICWA 4DR6L 4OO1H 3Q22A 4LF8Q 4C3JG 4RA8A 3CCUA 4H13C 4IALA 5M5WB 1RIPA 4RKLA 3S2DB 1CFMA 2QEJC 1U4PA 1D1IA 3NK9A 2L4LA 1TU2B 2JSOA 4RCNA 2H4OA 1IBLQ 4A3DG 4DF7A 2XN9C 4WJ4A 2R92B 1UNSA 3D8GA 1VQ4A 2ZJRA 1W6JA 3BDCA 2NN6H 1AEXA 4C3IG 1IBKL 1EFID 3HOUB 3VYSA 3S1NB 1F2ZA 1STBA 2SOBA 1P8LA 3RLFA 2RSNA 2C35B 1R4PB 4K5WA 1N33L 4HN7A 4IUNA 4DV7Q 5AJ3L 1UUPA 5GROA 1B44D 1NTGA 2PYKA 1U9RA 2RBMA 4DR4Q 3KK7A 2XGTA 1CQFA 3OMCA 3S17B 5C4XB 1LLRD 3FP9A 5IWAL 4UPAA 1Z7TA 1W3SA 2DNCA 1SYCA 1J5EL 4N8X1 2F0SA 1K9MC 4LK1C 1WTHA 2NN6I 1JR0D 1FJGQ 3S2DH 1WWDA 5CYUA 4ZUIA 4B3SQ 5CBEE 2LXKA 3S24A 2HT1A 4L5RC 1CKNA 1R9TB 5EBCA 1EYGA 1A1TA 2CWAA 3RMHA 1B9MA 1HUMA 2PZWA 1WCMB 4FXKC 3MAQA 2R92H 4LJZC 2UUBL 1VQ8A 4L5TA 2JA8B 4BXXG 2K04A 1ESKA 5AFWA 4HEDA 4JI5L 1LUZA 2F0HA 3A74A 3E9IA 1PFNA 3S1NH 4YCWA 1D7QA 1SE8A 2ZXOA 1A0IA 4KV6A 1AH9A 1CTMA 4QL5A 1EYDA 2SNMA 2EZVA 3IKJA 2PZTA 5C4XH 4GLXA 3HOWG 3S17H 1SYBA 2L1BA 4YWLA 2BDNA 2A1AA 1HZAA 3NYBB 1DCZA 2UUCL 3AFQA 2UXCL 2H1EA 4BBSG 4Q0FA 5FOBB 3EA6A 1WCMH 2BOSA 2O4XA 4O0AA 1I4QA 1I6HB 4UHVA 1Y1WG 4XYOA 3WOFA 2KQ3A 1P16A 2JA8H 3EVQA 1N34L 4LFAQ 3CAMA 4LFBL 1MJEA 4DR6Q 4GKJQ 4V0BA 1U6PA 3TP5A 1YI2A 5DNFA 3S1MB 3NPPA 1SE4A 4BWGB 4F87A 4OX9L 4DKAC 4RFBA 2QEXA 2K7VA 3PUVA 3J7YW 1SYFA 2HIVA 3K0XA 3HOVH 4I7AA 4A3FB 1A63A 1F9RA 5ELBA 1EY8A 2HD3A 1HJPA 3CCJA 3R2IA 4C1NK 2PNRC 1XNRL 5D65A 3PUYA 5BN3A 2DN8A 1SNMA 1IBKQ 4Y7NB 2L11A 4BA2I 2QCPX 1NJIC 1KHIA 2A73B 3EBEA 4DV0Q 4FNFA 4KJOA 2N78A 4C2MB 1G2SA 2DUDA 4U68A 2F0OA 4JV5L 2BDOA 1JE5A 1N33Q 4EQPA 2CH4W 2F0EA 1X6OA 3UE0A 2JA6G 1H9SA 2F3VA 4KN7C 3CU7A 1WD1A 1IYVA 5GAGC 1TWFB 3PO2G 2LXJA 5E3FA 3Q24A 4JBWA 1E3PA 1HNZQ 2HHHL 4CBVA 5LHY1 3QO2A 3GV6A 4J8QA 2G9HD 1VMCA 2JE6I 3G48A 4A3FH 1CZWA 2OQKA 4B3RQ 5IYDG 1WI5A 3K5OA 5I6WA 1QZHA 1LT5D 1JOQA 4JI8L 4C3JB 2QA4A 3D3RA 4Y7NH 4H02A 1Q3YA 3EN2A 2I5LX 1K8OA 1B70B 3HOZG 1SMYD 1C48A 4DA2A 4MZ9A 4CDCC 3I4NG 3HFZB 4ILWA 1PMRA 1FGUA 4CGYB 1YNND 4R1JA 3OWEB 1TWFH 3MEHA 4DAMA 4FF1A 2JJQA 1PRTC 4A3DB 1H9MA 2RSOA 3I90A 4TVAB 3KBGA 5T1IA 1HRJA 3U4VA 2EXFA 4JYAL 1UWVA 3R93A 4GLVB 1XPOA 4C3IB 4H0LC 1BCPC 1I4HA 3U9OA 4A3IH 4ZYSA 2E2JB 2OWOA 4ZKBB 4X64L 2F1MA 2B2YC 4DPGA 4GN5A 1NE3A 2PI2A 2WKCA 1D6EC 2K75A 4JI6L 3M4PA 4ZQ3A 1KL9A 3S2HB 4IPGA 4RWSC 4DR3L 1X3EA 1A6XA 2K5DA 2VUMG 3FDTA 4C3JH 2RHSB 4K0KL 1N34Q 1RTOA 1B9NA 3D31A 2F3WA 1K83B 3SE0A 4MTKA 5EKLA 5IYCG 4GN3B 3A7AB 5EPKA 3IAYA 3C46A 1K8AC 1SAPA 5M3FG 4KY7A 1PLFA 2RDHA 3S1RB 4GNXB 4PNYA 3KOJA 1XMOL 4OX9Q 2B3GA 1I50B 2CQFA 1A15A 2PMZB 4JI3L 4A3DH 1I94L 4UDUC 4YIJA 1EEID 2KBNA 3KF6A 2Q8TA 3OTOQ 2LS01 2E2JH 4B3TQ 1XNRQ 3VYRA 1YHQA 1X55A 1JE4A 3MXPA 1SDFA 4NB3A 2O5JC 3S2HH 3Q23A 4P72A 3HOWB 3FVQA 2EY1A 1J9OA 4JBJA 3A54A 1Q8IA 1O80A 1ILQA 1GUGA 3X3MA 1KXLA 4OONA 3N52A 3MXUA 1Q8KA 3S1RH 1X3PA 1AN8A 3BS1A 3RUZA 1EOVA 2NVYB 2VXWA 1I50H 4N9PA 5ELFA 3FKIG 1LABA 2NZ1D 4FO2A 2M9VA 1G51A 5C0XG 4BXXH 1MD2D 2H5XA 1Y14B 3RN2A 2Q2HA 1O78A 2RCFA 5ELOA 4DV2L 3HG9A 2HQEA 4M8AA 3UDIA 4ODGA 3PSIA 5JVG3 5I9OA 4DV1L 3ZYYX 1EZ8A 2EXDA 1KRSA 3NXWA 1PHJA 2N8NA 3HOWH 2I5MX 4DR7L 3A8IE 4KJNA 2VZAA 4OWXB 3J80i 1K8MA 1AZPA 1CM9A 2BE5C 1FD7D 2C9OA 5C5LA 1PFBA 4TRDA 4R8NA 2NZOA 3SK5A 3CC7A 5LMNW 1PTOD 3CXCA 3G7LA 4FDBA 3T51B 5KYLA 4GZYC 4O2DA 3TP6A 2CHBD 4BBSH 3TQYA 3ITPA 2NVYH 1LTAD 1QG7A 2IWHA 1MKHA 3QJYA 4X64Q 1CQVA 4DUYL 1Y1WH 1ESFA 4J1MA 1WWGA 1X56A 2NWGA 2JA6B 3PUXA 4A3KG 2AUKA 3PO2B 2SDFA 2E2DC 1BNZA 1A2TA 3M9BA 5JEAG 4YY3Q 1DJRD 5IP7H 1BF4A 2N3SA 1B8AA 5K36G 2L4NA 1UE1A 3G6JB 4A3MG 2MPMA 2WAQE 3A5UA 5EJWA 3KF8B 4XIGS 2F0DA 5D3DA 2ENBA 5M5YH 2HCCA 4CKCA 3PIOA 4N9TA 1PH2A 5IYBG 5CC4A 2AQ1B 1DXMA 1DONA 1PV4A 4OGQC 3HOZB 1S5FD 2KA7A 3V96A 3NTKA 2ZXRA 1XMQL 2JA6H 4YHHQ 3NHHA 4JC0A 2L0CA 1I3QB 3PO2H 1DOLA 4P75A 1PRTD 2LMCB 1HZCA 2EYPA 4NKLA 4OIJA 4G4KA 3GTKB 1WOCA 2K1BA 3K5MA 3MFGA 4ALPA 3K7AB 1BCPD 3MC0B 1MI2A 4DV4Q 4RAUC 2PQAA 1JJGA 1YHBA 1KAWA 1TXYA 3T56B 1N9WA 3U4ZA 1CA5A 2LKVA 5IYDH 4DNIA 1G6ZA 1AW7A 1HNWL 2VUMB 4OXPA 4AYBB 3F2UA 3OYYA 2XSCA 3TDQA 5JJLA 4V190 3TS2A 2MO0A 1HZBA 4OHJA 4AQYL 4DXFA 2LY7A 2IX3A 3KJOA 4QIWE 2R3ZA 2E5LL 3I4NH 2EOTA 3I3CA 5M9OA 3UDXA 1HQMC 1I3QH 1JWUD 2IL8A 2Z6BA 5C4ZA 3CCMA 3VR4A 4EQOA 2O2LD 3WOEA 2K5WA 3UDFA 1N32Q 3OHXC 1IBML 3H3VH 2VL6A 3GTLB 4GLAC 1WJJA 4R4OA 1Y8OB 2F0MA 4LNQA 1G91A 3KLSA 3DXJC 5GQOA 2EY5A 2B2VC 1DGSA 4X3TA 1HHVA 4OL7A 2VUMH 4RH6A 2KVMA 1CT1D 2K03A 2CW0C 1IKMA 3W5OA 5C3EG 2Q2TA 3A8KE 1JT8A 5IYCH 2JK8A 5IGCA 3JAML 1EWIA 1XNQQ 3J80E 2X69A 3H3VI 5M3FH 1N36L 5L37A 3PIO3 2X6GA 3KBXA 1IHZA 1QOHA 1SYGA 1PVOA 3MWYW 3M85A 1PH7A 1PFSA 3OPOA 1GUSA 2DJGC 4F7XA 1D8LA 1VQFA 5EKIA 1M90C 4GS3A 3TREA 1WTQA 1BVSA 2F0TA 1S3OA 3F8TA 2CQOA 4HIMA 3GQBA 2AQ2B 3AB9A 3BG3A 4CJ0B 1VQ6A 4IOAA 1I4PA 4NXNL 2A69C 3P1HA 2LI8A 5EQ0A 2BE5D 5LMUQ 5C5MA 5LMNL 3U50C 3VR5A 1XYIA 3DEOA 4DV5L 4O42A 4RHSA 3QB3A 5DM73 3FKIH 5DAUA 3FHWA 4H7BA 5IGEA 1IL8A 4J15A 3S15H 3GTMB 1LTRD 2K05A 2PZUA 5E1FA 1E1TA 5C0XH 4X65Q 1SFOH 5E7NA 1G2TA 3RLOA 4IQZA 2UU9L 2CKZB 1MHWC 4XYQA 4A3KB 3IFTA 2ZM6L 1DOMA 1HNWQ 3BVGA 4CHTB 3SXHA 1UE6A 1ESRA 1QVGA 4DAYB 1PTOF 2MNAA 3NSWA 4YCVA 4DK1A 5DLQE 3R8BA 3F2DA 1VQ7A 3J81i 4AQYQ 5IT9L 4KD3A 2E5LQ 2ASBA 4LF7L 4A3MB 3HKZB 1QWYA 1PA6A 1EIGA 1F77A 2MJ8A 2F0FA 5C0XI 4LFCL 1PH5A 3ONAB 3I55A 3EROA 1T5EA 5FLXc 3CCQA 1AE3A 1IW7D 2CWPA 3A0JA 1ZYRC 2PCFB 1PXUA 2IPKD 4R9WA 4RMFA 1PH8A 1K0RA 4UP7A 1MSHA 3GTMH 1VQNA 4X3UA 1RODA 1F2MA 2F4IA 3OIPA 1MIUA 1X32A 3TP7A 2E75C 4KHPL 1H95A 2CFMA 2K5QA 4A3KH 1LV9A 1CSQA 1TR5A 3K7UC 2EIFA 4L8JA 1Y69U 5I9PA 2M00A 4NXMQ 4OELB 5JEAH 3K5LA 5FKAC 2PI2E 3OOCA 5C4HA 1SBBB 2B29A 2RHQB 4GKKL 5K36H 3GD7A 4LF6L 1F9SA 1HQRD 3BDLA 2Z1CA 4F8MA 4FF2A 4P2CB 4A3MH 3W2DA 1FNUA 1FVIA 5D14A 3CC2A 1TIID 3EFXD 4JBKA 5JJIA 3GO5A 2LFNA 4HSVA 3TS0A 4LF9Q 1MFSA 1BUVT 2KCTA 1NY4A 5IYBH 2A6EC 1BOSA 2RDGA 4KD4A 1NR2A 1PRTF 1SN8A 1GXDC 4JI7L 1PYBA 1BCPF 2ICIA 1ML0D 5FO7B 1I4GA 3I4MG 4BS9A 1TVXA 3L3OC 4X3KA 3VR2A 4IUPA 5M3MG 2K28A 1Q1EA 2I0QA 4K2LA 3D4RA 1KLUD 4EVOA 1LM0A 2YTXA 3A8JE 1VCIA 4IPHA 3NENA 5CV4A 3WWVA 2WACA 4JCVE 1HUNA 2B8FA 1Q7YC 4K6DA 4LAAA 3PCOB 1G291 3B6YA 3OSOA 3K0YA 3STBD 4LMQD 5COYA 3AYHB 3HOVB 1DZ1A 5J3BA 1CI3M 5CORA 2R7ZG 2KHJA 4IFDH 2ZTEA 3NTHA 3IL8A 5C3EB 1KD1C 5KEEA 1GUWA 2CQAA 2GN5A 2ZM6Q 5H1SE 1GO3E 2EY2A 3PF4A 4EGVA 5C3XA 5JPNC 3EIVA 1EU4A 2EC7A 1TQOA 4QGUA 5ELCA 4PV1C 3RD4A 2YTYA 2XVSA 4OEMB 1Y1VG 2ES2A 1VQOA 1HR0L 1L0WA 4IFDI 1K3RA 1KABA 2FMMA 1EY9A 4R4QA 1H9JA 4JI2L 2FMCA 2PW7A 2B2VA 1A3VA 2ZT9C 4YWKA 4NW2A 5IP7G 4ZCKA 3UE1A 3PUZA 1NBWA 2EJGC 5JAVA 1Q82C 1C0AA 1F2LA 1YNJC 2VS1A 3W3AA 2Z9HA 1JB3A 2DY8A 2F4VL 2B2WC 5J1ZA 1BXTA 5C3EH 1L1OB 4A93G 2E8GA 2A69D 3J81E 4KHPQ 3CC4A 1Z9FA 1TT2A 2F0WA 2MUYA 3HOYG 5ELNA 5C4JH 5FJ8G 4MNOA 1W2BA 3A5ZB 3TZUA 1ENAA 3PO3G 2YYZA 5AJ3Q 2UUAL 4LF6Q 1EU3A 2SNSA 2BH2A 5CV8A 2K01A 5IWAQ 4ABNA 4ZK9B 1J5EQ 2Y0SB 4DK3C 4LF4L 4A3IB 1YZ6A 4DAPA 3TP8A 3FRPB 1JJCB 1D5MC 1E2ZA 1OXTA 4AIMA 1KNAA 3RR5A 4FXDA 1TKWB 3F2BA 1QUQB 1RJTA 2NTSA 1A6BB 4RGOS 4IO9A 3TEHB 3RNUA 3K8AA 1GJXA 2Z6KC 4MIUA 2UUBQ 1A3UA 1NMFA 1EWCA 2Q2IA 1LT3D 2K5NA 4JI5Q 3NUCA 5A35A 2V4DA 1EZ6A 1ZYRD 2IX1A 4X66L 4DR5L 4POGA 2EE1A 1N8RC 1Y8NB 2AHOB 5EAYA 2F03A 4X62L 1SYDA 2MQHA 2YTVA 3CCVA 4GNXC 4FP5D 3A56A 4FVMA 4QY7A 4A3JG 1I5FA 2N88A 2VB3X 3JAMc 1OXUA 2NVTH 1Q46A 4FXGC 1LTID 5A2QE 1VQIA 2UUCQ 1JORA 2UXCQ 4FF4A 1X65A 3LX0A 5BN4A 5G3LD 1YITA 3MXNB 1I6VC 3HEJA 3NBHB 4QUCA 3DMUA 5BR8L 4CKBA 5C44G 3CPWA 1PFMA 5FO8B 1U4MA 3S9WA 2QW7A 1WFQA 1RKNA 1NSNS 1E1OA 4C56C 4JI4L 1KC8C 4LFBQ 4A3GG 4HMJA 1EQRA 3LGJA 2BA1A 3QWNA 1HNXL 3MHBA 1PTOH 5M5XB 3NEMA 2B2TC 1PZID 2A6ED 4CDDC 2RQXA 4JI2Q 4QJFA 4IJLA 4TSSA 2VW9A 2IT1A 4UP8A 4KI0A 2ID0A 3N6RA 3I4MB 1B2TA 1HXYD 2Z8LA 1TWCB 2QGQA 2F0JA 5M3MB 3L7ZC 3BYTB 3M4QA 5C3WA 1WTVA 4HJ9A 1SSOA 3EQLC 1F9QA 4RG1A 1XJVA 1JMCA 5D3IB 2CCZA 1IXRA 3BYYB 1BKBA 5LL6S 2WINB 1QVFA 4JV5Q 4DUZL 1EQVA 2K5VA 3CQZH 3I72A 4HTHA 5EPJA 2YV5A 1VF5C 1HTLD 4IUUA 5M5XH 3KDFB 4DNTB 1SLJA 2Q8IB 1V8QA 1R4QB 1K73C 4LF4Q 4KY5A 4BBSB 5IT9c 2HHHQ 4ULLA 5IOCA 2K6AA 1B53A 4K5XA 4HCEA 3CHBD 3GTOH 3HKSA 5BN5A 1Y1WB 3I4MH 1U4RA 3QR8A 2YSAA 2E74C 3DM1A 3PIPA 1TWCH 1LTGD 2AKWB 1JCKB 5IE8A 5M3MH 4CDFC 3J7ZC 1ILPA 4JI8Q 1Y1VB 2EPBA 2ATWA 4E6IA 2F0UA 1VMPA 2L55A 1FL0A 4RGMA 2EQSA 5ELDA 1MGSA 2HDMA 4DR5Q 5E4XA 4MHEA 3T1YL 1UAPA 1BO0A 3AFPA 3C3LA 4LF5L 4DU9A 2DJFC 3KYHC 1YNJD 3MVVA 2R7ZH 3NE5B 3FEWX 1SE3A 2F0LA 5M5YB 2EY6A 1F6UA 1EYAA 2F52A 2KCMA 4JYAQ 4A93B 1XXGA 2A19A 3KJPA 3M3YB 2FFKB 4Q5VA 3HOYB 4K5VA 4TKOB 5C6AA 1T9HA 3PO3B 4JI6Q 2LSSA 4PZ6A 2I07B 3TMEA 4XQNA 1KIXA 1YJNA 1GOZA 1XPUA 2JA9A 4DR3Q 1VQ9A 2ICEC 1Y1VH 1SNPA 4LW1A 1C9OA 3PMFA 2IX0A 4K0KQ 2B2UC 1H9KA 4JI4Q 3URYA 2L9HA 5IP9G 5GAHC 2K5HA 4OWTB 4HJAA 4IURA 4C3HH 4PMWA 3P20A 5IGBA 1WWFA 3T1HL 2B2WA 2Z0SA 1AFPA 1QUQA 1XMOQ 2JEAI 3H3VC 1ENCA 4JI3Q 3NQIA 1I94Q 1Q12A 4R4CA 1JOKA 5ELEA 4A93H 1NUCA 2WV6D 3CCLA 3M3YH 1WD0A 1BQQT 1PZJD 2ZXPA 3HOYH 5FJ8H 4K8IA 3HP3A 2NVQB 3PO3H 3I4NB 3A55A 2XTIA 4NPSA 1AP0A 3I70A 2JXMB 5KNDA 3DUZA 4UY8C 1TWGB 4XXEA 4DUZQ 1XTDA 4A3JB 3S14B 3K80C 4HSPA 3PIP3 1LTBD 1AZQA 2BH8A 3E9HA 1OTCA 3NWSA 2Q2UA 1YJ9A 1TWAB 4GN4B 1YNXA 1QB5D 4DR1L 1RCVD 4LUZA 1NNXA 2Z6KA 4ME3A 3IRBA 1S5DD 2K32A 2L5TA 2TMPA 3NBHA 4JI1L 3M7GA 3OW7A 3K58A 3I4OA 5C44B 1GUOA 4EQ5A 3HOUG 1SXTA 2IY5B 4IOCA 2EYFA 2A68C 3DEPA 4QF4A 4AYBE 2KCCA 4IFDG 4B3ML 1HH2P 2ZJPA 4R8IA 1EFWA 4DV2Q 2A74C 5K5PA 2IHEA 4RKBA 2NVQH 3W1GA 2RF4A 4DXGA 4DV1Q 4GNXA 3L9AX 5M3FB 4HR7B 3SEBA 1SJHD 1HTPA 3AMUA 4DGZA 5G3LF 1YBYA 1TWGH 4DR7Q 1ONLA 3MXGA 1DD2A 4ZLTF 3T1YQ 4A3JH 1X9NA 3S14H 4KKTA 5KGUA 2B2YA 5I6YA 1X3GA 4APVA 4LF5Q 1CA6A 1MSGA 3KLWA 5CV7A 4HJ5A 1STEA 1LT6D 3AEVA 4OWWB 1VQDA 1TWAH 1BBXC 1M1KC 2JA7G 2UXBL 2EJMA 2EDGA 2JA5G 4LF8L 2KENA 4KHZA 1B3QA 4DUYQ 4CJ1B 5C44H 3SR1A 1I4RA 1ZKOA 1PDQA 4A76A 1F9PA 1WTPA 2G9DA 4NMZA 2KHIA 2B2TA 4DV6L 4A3GH 3H94A 3TN2A 3FPUB 1IBLL 4EX5A 2EYOA 2WB1E 1KNEA 1K8GA 3MFYA 1PH3A 3SDZA 3FKIB 4KN4C 1FNWA 1E24A 4XT1B 2N55A 4RCOA 3G4SA 4BY7H 4NP5A 1T5XD 2R6GA 3PGZA 3T4AC 3T1HQ 3S15B 2PPBC 1PH9A 1SFOB 1LACA 2KUMA 2JP1A 5JJZA 2B63G 1X3QA 2D62A 2AWOA 3HZXA 4DV7L 5TSSA 4IN3A 1O7IA 4DR4L 3K57A 1GHJA 3R2TA 4KHVA 4PZ7A 5HURA 2N49A 1JOOA 2K33A 1C8CA 3CCEA 1G8ZD 4JVZA 3G6EA 1S5ED 1QZGA 1E22A 1EY5A 4H44C 1XMQQ 2MFIA 4P74A 3MZ5A 4X6AH 1SNOA 1YEZA 3GTQB 4FYDA 1HFGA 1V43A 3H6MA 1CZGA 1KDAA 1UEBA 2WFWA 3H15A 4I65A 1B50A 4BBRG 1IYUA 2PO4A 4JK1C 2IHXA 3D4WA 3G71A 1RD9D 2ALYB 2OXPA 3NWTA 1UE7A 2F0PA 2QILA 4YWMA 1K3BC 3BZDB 4FF3A 2HCIA 3D6WA 3SK8A 4HMIA 1I4XA 1UEAB 4KKSA 1TS4A 4DV3L 4B3MQ 1VQEA 4P73A 5KYIA 4B08A 2C5CA 3SK4A 2JYOA 1H9SB 1OXXK 3CPFA
chains in the Genus database with same CATH topology
2BA0A 4GOPA 4YWKA 1XNRQ 5IP7G 3UE1A 4DR2L 3PUZA 1YHQA 3HKZE 1NBWA 1X55A 3ULLA 4NB3A 1Q82C 1EIYB 1C0AA 3S2HH 2VS1A 3GTQH 4P72A 2F4VL 4IPDA 1U5KA 5C4XG 5C3EH 4JBJA 1L1OB 4A93G 2E8GA 4X65L 4KHPQ 3CC4A 1Z9FA 1VQHA 3ULPA 1IBMQ 4LFAL 3HOYG 4JOIA 5ELNA 5C4JH 2YU9H 5FJ8G 1KXLA 4OONA 2VQFL 1VS0A 4MNOA 1W2BA 1Q8KA 3A5ZB 3S1RH 4GKJL 4AH6A 3PO3G 3PV0A 2YYZA 1YJWA 2OTLA 4PG3A 1EOVA 1PYSB 1CKNB 5AJ3Q 1I50H 2UUAL 3FKIG 1S40A 4LF6Q 4IJHA 3HOZH 1WCMG 2ZTCA 2BH2A 4A3LH 1LYLA 1G51A 5IWAQ 5HGQA 5C0XG 1SRUA 1U0LA 1J5EQ 1ASZA 4BXXH 2H5XA 1Y14B 2VY3A 4DK3C 5IP9H 4DV6Q 3RN2A 2NVXH 1JJ2A 4LF4L 2JA8G 2Q2HA 3ICEA 1Z47A 5ELOA 1YZ6A 2R93G 2M3ZA 2PNHA 4DV2L 2K52A 1JJCB 1CUKA 3UDIA 1N36Q 1OXTA 3ERSX 4AIMA 3GTGH 4JG2A 1OXSC 3PSIA 3RR5A 3U58A 3GTKH 4DV1L 3CMEA 4BY1H 2L15A 2R7FA 2OCEA 3CP0A 5FLMG 3K7AH 3F2BA 4A3BH 3S1QH 4OO1I 1QUQB 2EXDA 5GAEC 1KRSA 1Q1BA 1JT8A 3AQQA 1A6BB 4IO9A 3TEHB 2N8NA 3BZKA 2I5MX 3RNUA 1PHJA 3HOWH 3K8AA 4IFDJ 3KDFA 2Z6KC 4DV0L 4DR7L 3STBC 2UUBQ 1IZ6A 3K81C 1NMFA 2VZAA 4OWXB 3HOXG 3J80i 3HOVG 2Q2IA 4JI5Q 2GVBA 2K5NA 3E0EA 4A3EH 2NZOA 3ZJYC 2IHFA 4IPCA 3DLLA 5LMNW 3CC7A 3CXCA 4FDBA 2IX1A 4P71A 4X66L 4O2DA 4DR5L 2E2HH 4BBSH 3TQYA 4NXML 4POGA 2NVYH 2FXQA 2WP8J 1N8RC 2AHOB 5EAYA 5M5WH 1HNZL 5JJKA 1IYJB 1MKHA 4LWCA 2MO1A 4X62L 4X64Q 2MQHA 2VQEL 4DUYL 1Y1WH 2UXDQ 2YTVA 3CCVA 4GNXC 1WWGA 4A3CG 1CSPA 1X56A 1X54A 4QY7A 4NXNQ 2A8VA 3L2PA 4A3JG 1I5FA 3J81j 3JAMc 1OXUA 2NVTH 1Q46A 1NMGA 3I7FA 3PUXA 5LMNQ 4A3KG 4B3RL 1VQLA 1VQIA 3RN5A 2UUCQ 1FJGL 1HR0W 4LF9L 2K4KA 4DV5Q 2UXCQ 1X65A 3M9BA 4B3SL 5JEAG 3KF6B 4YY3Q 1YITA 5HY6A 1VQAA 2AWNA 1TWHH 3MXNB 3NBHB 1Q3ZA 3GTLH 5IP7H 3HOUH 2N3SA 1B8AA 5BR8L 5K36G 1G6PA 3CPWA 5C44G 4JI0Q 1SMXA 1UE1A 4A3MG 3A5UA 2WAQE 4A75A 1J6QA 4HJ7A 2UU9Q 3KF8B 4XIGS 3J81c 1VQGA 1WFQA 4A3FG 1E1OA 4JI4L 1AE2A 1BBUA 2DGYA 3I2ZA 4LUVA 3UDGA 1KC8C 4A3GG 4LFBQ 2OTJA 1L1OC 5M5YH 1EQRA 3LGJA 4DV3Q 4DR1Q 4DK6C 3MEFA 2BA1A 1HNXL 3PIOA 4YCUA 3NEMA 2R7DA 3RZDH 1WWEA 4JI1Q 1YHAA 1PH2A 4JI2Q 5IYBG 4QJFA 2E2IH 1VQKA 4IJLA 3CF5A 5GADC 1PV4A 2VW9A 1GM5A 2IT1A 4LF7Q 1UE5A 1YVCA 1EIFA 4KI0A 4UP8A 4DR2Q 2ID0A 4R4TA 4A4IA 3OW2A 1R9TH 3GTJH 4LFCQ 1XMQL 3CCSA 2JA6H 3TRZA 2QGQA 4YHHQ 4JC0A 2K50A 3PO2H 1LTLA 3CW2C 1GD7A 3L7ZC 3M4QA 4P75A 1KQSA 2JA7H 1HZCA 2NZHA 4HJ9A 2JEBI 3GDEA 2JA5H 3F2CA 4TQUS 1VQJA 2ZTDA 2GVAA 4RG1A 1WOCA 2Y0SG 1A62A 4ALPA 1XJVA 4JBMA 1JMCA 2CCZA 4DV4Q 4A3IG 4UP9A 1WYDA 1IXRA 2PQAA 2VQFQ 3H0GG 4MTNA 1BKBA 1JJGA 2JZWA 1QVFA 4JV5Q 3BU2A 1YHBA 1KAWA 1TXYA 3PUWA 5FLMH 4DUZL 1XPRA 3NELA 1PH6A 1N9WA 3U4ZA 2K5VA 3Q8DA 1JB7A 4LUOA 3CQZH 3W1BA 5IYDH 4DNIA 2YV5A 1HNWL 2UXBQ 3GTPH 4OXPA 5M5XH 3ULJA 3KDFB 3OYYA 4DR6L 1SLJA 2AMCB 4LF8Q 4LF4Q 1K73C 3OTOL 1VQCA 5IT9c 2HHHQ 4GKKQ 3CCUA 5JJLA 3TS2A 2MO0A 1HZBA 3GTOH 3HKSA 4B3TL 4AQYL 1RIPA 3I4MH 3KJOA 4QIWE 2E5LL 2YSAA 3PIPA 3I4NH 1TWCH 1PH4A 3BZCA 2Y0SE 3UDXA 2B63H 2AKWB 1I3QH 5IE8A 2L4LA 5M3MH 1I6HH 3J7ZC 3CCMA 4JI8Q 1IBLQ 4A3DG 4B3TQ 2ATWA 4WJ4A 3RZOH 3L0OA 1VQMA 3VDYA 1VQ4A 2ZJRA 3UDFA 3DM3A 1FL0A 1N32Q 1IBKL 1IBML 1HZ9A 1C7YA 3H3VH 2VL6A 2EQSA 4GLAC 4JI7Q 1WJJA 4R4OA 4DR5Q 2ZJQA 4LNQA 3T1YL 5GQOA 3AFPA 1P8LA 3RLFA 4LF5L 3S1MH 2C35B 2VQEQ 3KYHC 1N33L 1DGSA 4DV7Q 3KFUA 5AJ3L 4GOPC 2R7ZH 5GROA 1NTGA 4HIDA 4DR4Q 2VUMH 2XGTA 3I56A 2WAQG 2KCMA 2F52A 4JYAQ 1F6UA 3FP9A 5IWAL 4UPAA 3W5OA 2A19A 4BBRH 5C3EG 2Q2TA 1W3SA 3KJPA 1J5EL 5IYCH 2JK8A 1K9MC 1EWIA 2NN6I 1FJGQ 1XNQQ 3S2DH 1WWDA 3H3VI 5M3FH 4B3SQ 1N36L 1T9HA 2LXKA 3S24A 2HT1A 4L5RC 4JI6Q 1CKNA 1EYGA 2LSSA 1A1TA 4PZ6A 1KIXA 1PVOA 1YJNA 4JOIC 1XPUA 2CWAA 2JA9A 3M85A 4DR3Q 1PH7A 1VQ9A 1PFSA 1Y1VH 4LW1A 4BA1I 1C9OA 4C2MH 2IX0A 4K0KQ 2R92H 4A3LG 2UUBL 1VQPA 1VQ8A 4L5TA 4JI4Q 4BXXG 1ESKA 1V9PA 5IP9G 4JI5L 1LUZA 2K5HA 5GAHC 1D8LA 4OWTB 4HJAA 1VQFA 4C3HH 2F3IA 3A74A 3E9IA 1M90C 4GS3A 4PMWA 3TREA 1WWFA 3T1HL 3S1NH 4GOPB 1AAFA 4YCWA 1D7QA 1SE8A 1BVSA 2Z0SA 1A0IA 1S3OA 1QUQA 1XMOQ 2JEAI 3F8TA 4BY1G 1AH9A 4QL5A 2CQOA 4HIMA 4A3BG 4JI3Q 1X3FA 1I94Q 1Q12A 4R4CA 5C4XH 4GLXA 2PQAB 1HR0Q 1VQ6A 3HOWG 3S17H 4A93H 1VQBA 4IOAA 1BJ6A 4NXNL 3CCLA 4KLKA 1E7ZA 2LI8A 3M3YH 3PF5A 4YWLA 5LMUQ 3HOYH 4A3EG 2A1AA 5FJ8H 1HZAA 4BY7G 2PMZE 3NYBB 5LMNL 3U50C 4AYBG 2UUCL 3PO3H 1PH1A 3AFQA 4DV5L 1GVPA 2UXCL 4NPSA 2XTIA 4BBSG 3FKIH 2K14A 4YY3L 3FHWA 1WCMH 3JAMi 2F4VQ 4J15A 4O0AA 2OQ0A 3S15H 4UY8C 1Y1WG 1E1TA 1XTDA 4DUZQ 3K80C 4X65Q 1SFOH 5E7NA 1P16A 2JA8H 3RLOA 1B7YB 1N34L 4HJ8A 2UU9L 2CKZB 2R93H 2BH8A 3E9HA 4LFAQ 3CAMA 3JC66 1OTCA 2Q2UA 2ZM6L 4LFBL 1HNWQ 3F1ZA 1MJCA 1YJ9A 1MJEA 4GN4B 3BJUA 1YNXA 4XTCS 4DR1L 4DR6Q 4GKJQ 4LUZA 1UE6A 2Z6KA 4ME3A 1U6PA 3IRBA 1QVGA 4DAYB 4C3IH 2MNAA 2UUAQ 1YI2A 4YCVA 5DLQE 4JI1L 1RL2A 3F2DA 1VQ7A 3J81i 4AQYQ 4OX9L 4DKAC 3I4OA 2QEXA 2E5LQ 4EQ5A 3PUVA 2ASBA 1A8VA 4LF7L 3HOUG 4IOCA 2IY5B 4AYBE 3HOXH 2HIVA 3K0XA 4HIOA 1PA6A 4B3ML 3HOVH 4IFDG 2I5HA 3CMAA 1HH2P 5C0XI 1PH5A 4LFCL 2ZJPA 1A63A 3I55A 1EFWA 3CCQA 3SGIA 5FLXc 4DV2Q 4YHHL 2EXFA 1AE3A 1HJPA 2IHEA 3CCJA 2CWPA 3A0JA 3J80c 2NVQH 1XNRL 4L5SA 3W1GA 2RF4A 4DV1Q 4GNXA 1L2FA 3PUYA 4RMFA 3CCRA 1K83H 1PH8A 1IBKQ 1ASYA 4BA2I 1NJIC 1K0RA 4UP7A 1KHIA 3GTMH 3EBEA 1YBYA 4DV4L 1TWGH 4DV0Q 4DR7Q 4A3CH 1Q81C 3T1YQ 4A3JH 1VQNA 4R4IA 2N78A 1X9NA 3S14H 2WB1G 2DUDA 1X3GA 4APVA 4LF5Q 1MIUA 4JV5L 4Y52H 1JE5A 1N33Q 1SR3A 3UE0A 1X6OA 2JA6G 2CFMA 3KLWA 4KHPL 1H95A 4HJ5A 4A3KH 5GAGC 1CSQA 4PZ8A 3M7NA 3AEVA 4OWWB 1VQDA 3K7UC 1TWAH 2EIFA 1M1KC 2LXJA 4X66Q 3PO2G 4POFA 2JA7G 2UXBL 4NXMQ 4JBWA 2JA5G 1E3PA 2PI2E 4LF8L 1HNZQ 2KENA 4KHZA 3RLNA 2B29A 2RHQB 2HHHL 4X62Q 4GKKL 4DUYQ 3GD7A 4LF6L 5C44H 4A3MH 1L1OA 2JE6I 3G48A 4A76A 1FVIA 4A3FH 3CC2A 2KHIA 5IY0A 4DV6L 4JBKA 4A3GH 2OQKA 2VNUD 3GO5A 5JJIA 1Q86C 4B3RQ 3D0FA 5IYDG 1WI5A 3TS0A 1S72A 1QZHA 4LF9Q 1MFSA 4JI8L 1IBLL 2KCTA 4EX5A 4HIKA 2WB1E 2QA4A 1NY4A 5IYBH 1BBWA 4OO1G 4Y7NH 1K8GA 1SN8A 4H02A 1Q3YA 3EN2A 2I5LX 1PH3A 1B70B 1E24A 5BR8Q 4BY7H 3G4SA 1N32L 2R6GA 3PGZA 3T1HQ 3HOZG 5C0XJ 4JI7L 1PYBA 1EUJA 4MZ9A 1CKMA 3I4MG 4QQBX 1PH9A 1QVCA 3I4NG 3HFZB 1IL2A 1FGUA 2B63G 2D62A 4R1JA 2AWOA 4DV7L 1TWFH 4DAMA 2JJQA 5M3MG 1O7IA 1Q1EA 1HNXQ 2I0QA 4TVAB 4DR4L 3U4VA 4PZ7A 1SROA 2YTXA 1LM0A 2N49A 1UWVA 2HQLA 2D0OA 4GLVB 4JYAL 1XPOA 1VCIA 4IPHA 4A3IH 3NENA 3CCEA 3WWVA 4JCVE 2NN6G 3H0GH 2OWOA 3G6EA 2UXDL 4X64L 1GKHA 1Q7YC 1QZGA 3PCOB 1XNQL 1G291 3B6YA 1E22A 4GN5A 1NE3A 3STBD 4DPGA 2PI2A 1VQ5A 1XMQQ 3AYHB 2MFIA 1KRTA 4P74A 3S16H 4X6AH 2K75A 4JI6L 3M4PA 5J3BA 1KL9A 1YEZA 4IPGA 1CKOA 1EQQA 2R7ZG 4DR3L 1X3EA 1V43A 2KHJA 2VUMG 2ZTEA 4C3JH 2RHSB 3HKZG 3CD6A 1UEBA 2WFWA 1N34Q 1KD1C 3M4OH 3H15A 4K0KL 3D31A 4WJ3M 4BBRG 2GN5A 4GN3B 5IYCG 2ZM6Q 2IHXA 3G71A 2ALYB 1YIJA 5H1SE 1GO3E 1K8AC 3PF4A 1UE7A 4JI0L 3EIVA 5M3FG 4YWMA 4GNXB 2EC7A 3J7A5 4QGUA 3KOJA 4L5QA 1XMOL 4OX9Q 2B3GA 2CQFA 2RCNA 1OXVA 4JI3L 2YTYA 4A3DH 1I94L 3ER0A 2JQOA 2V1CC 1Y1VG 5JEAJ 4DV3L 2ES2A 1VQOA 1HR0L 1VQEA 2KBNA 1L0WA 1V1QA 3KF6A 4P73A 3OTOQ 4B3MQ 2R92G 4IFDI 2D0PA 1K3RA 4R4QA 2E2JH 4JI2L 5LMUL 1OXXK 2HIXA 3CPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA0 A;  4GOP A;  4YWK A;  1XNR Q;  5IP7 G;  3UE1 A;  4DR2 L;  3PUZ A;  1YHQ A;  3HKZ E;  1NBW A;  1X55 A;  3ULL A;  4NB3 A;  1Q82 C;  1EIY B;  1C0A A;  3S2H H;  2VS1 A;  3GTQ H;  4P72 A;  2F4V L;  4IPD A;  1U5K A;  5C4X G;  5C3E H;  4JBJ A;  1L1O B;  4A93 G;  2E8G A;  4X65 L;  4KHP Q;  3CC4 A;  1Z9F A;  1VQH A;  3ULP A;  1IBM Q;  4LFA L;  3HOY G;  4JOI A;  5ELN A;  5C4J H;  2YU9 H;  5FJ8 G;  1KXL A;  4OON A;  2VQF L;  1VS0 A;  4MNO A;  1W2B A;  1Q8K A;  3A5Z B;  3S1R H;  4GKJ L;  4AH6 A;  3PO3 G;  3PV0 A;  2YYZ A;  1YJW A;  2OTL A;  4PG3 A;  1EOV A;  1PYS B;  1CKN B;  5AJ3 Q;  1I50 H;  2UUA L;  3FKI G;  1S40 A;  4LF6 Q;  4IJH A;  3HOZ H;  1WCM G;  2ZTC A;  2BH2 A;  4A3L H;  1LYL A;  1G51 A;  5IWA Q;  5HGQ A;  5C0X G;  1SRU A;  1U0L A;  1J5E Q;  1ASZ A;  4BXX H;  2H5X A;  1Y14 B;  2VY3 A;  4DK3 C;  5IP9 H;  4DV6 Q;  3RN2 A;  2NVX H;  1JJ2 A;  4LF4 L;  2JA8 G;  2Q2H A;  3ICE A;  1Z47 A;  5ELO A;  1YZ6 A;  2R93 G;  2M3Z A;  2PNH A;  4DV2 L;  2K52 A;  1JJC B;  1CUK A;  3UDI A;  1N36 Q;  1OXT A;  3ERS X;  4AIM A;  3GTG H;  4JG2 A;  1OXS C;  3PSI A;  3RR5 A;  3U58 A;  3GTK H;  4DV1 L;  3CME A;  4BY1 H;  2L15 A;  2R7F A;  2OCE A;  3CP0 A;  5FLM G;  3K7A H;  3F2B A;  4A3B H;  3S1Q H;  4OO1 I;  1QUQ B;  2EXD A;  5GAE C;  1KRS A;  1Q1B A;  1JT8 A;  3AQQ A;  1A6B B;  4IO9 A;  3TEH B;  2N8N A;  3BZK A;  2I5M X;  3RNU A;  1PHJ A;  3HOW H;  3K8A A;  4IFD J;  3KDF A;  2Z6K C;  4DV0 L;  4DR7 L;  3STB C;  2UUB Q;  1IZ6 A;  3K81 C;  1NMF A;  2VZA A;  4OWX B;  3HOX G;  3J80 i;  3HOV G;  2Q2I A;  4JI5 Q;  2GVB A;  2K5N A;  3E0E A;  4A3E H;  2NZO A;  3ZJY C;  2IHF A;  4IPC A;  3DLL A;  5LMN W;  3CC7 A;  3CXC A;  4FDB A;  2IX1 A;  4P71 A;  4X66 L;  4O2D A;  4DR5 L;  2E2H H;  4BBS H;  3TQY A;  4NXM L;  4POG A;  2NVY H;  2FXQ A;  2WP8 J;  1N8R C;  2AHO B;  5EAY A;  5M5W H;  1HNZ L;  5JJK A;  1IYJ B;  1MKH A;  4LWC A;  2MO1 A;  4X62 L;  4X64 Q;  2MQH A;  2VQE L;  4DUY L;  1Y1W H;  2UXD Q;  2YTV A;  3CCV A;  4GNX C;  1WWG A;  4A3C G;  1CSP A;  1X56 A;  1X54 A;  4QY7 A;  4NXN Q;  2A8V A;  3L2P A;  4A3J G;  1I5F A;  3J81 j;  3JAM c;  1OXU A;  2NVT H;  1Q46 A;  1NMG A;  3I7F A;  3PUX A;  5LMN Q;  4A3K G;  4B3R L;  1VQL A;  1VQI A;  3RN5 A;  2UUC Q;  1FJG L;  1HR0 W;  4LF9 L;  2K4K A;  4DV5 Q;  2UXC Q;  1X65 A;  3M9B A;  4B3S L;  5JEA G;  3KF6 B;  4YY3 Q;  1YIT A;  5HY6 A;  1VQA A;  2AWN A;  1TWH H;  3MXN B;  3NBH B;  1Q3Z A;  3GTL H;  5IP7 H;  3HOU H;  2N3S A;  1B8A A;  5BR8 L;  5K36 G;  1G6P A;  3CPW A;  5C44 G;  4JI0 Q;  1SMX A;  1UE1 A;  4A3M G;  3A5U A;  2WAQ E;  4A75 A;  1J6Q A;  4HJ7 A;  2UU9 Q;  3KF8 B;  4XIG S;  3J81 c;  1VQG A;  1WFQ A;  4A3F G;  1E1O A;  4JI4 L;  1AE2 A;  1BBU A;  2DGY A;  3I2Z A;  4LUV A;  3UDG A;  1KC8 C;  4A3G G;  4LFB Q;  2OTJ A;  1L1O C;  5M5Y H;  1EQR A;  3LGJ A;  4DV3 Q;  4DR1 Q;  4DK6 C;  3MEF A;  2BA1 A;  1HNX L;  3PIO A;  4YCU A;  3NEM A;  2R7D A;  3RZD H;  1WWE A;  4JI1 Q;  1YHA A;  1PH2 A;  4JI2 Q;  5IYB G;  4QJF A;  2E2I H;  1VQK A;  4IJL A;  3CF5 A;  5GAD C;  1PV4 A;  2VW9 A;  1GM5 A;  2IT1 A;  4LF7 Q;  1UE5 A;  1YVC A;  1EIF A;  4KI0 A;  4UP8 A;  4DR2 Q;  2ID0 A;  4R4T A;  4A4I A;  3OW2 A;  1R9T H;  3GTJ H;  4LFC Q;  1XMQ L;  3CCS A;  2JA6 H;  3TRZ A;  2QGQ A;  4YHH Q;  4JC0 A;  2K50 A;  3PO2 H;  1LTL A;  3CW2 C;  1GD7 A;  3L7Z C;  3M4Q A;  4P75 A;  1KQS A;  2JA7 H;  1HZC A;  2NZH A;  4HJ9 A;  2JEB I;  3GDE A;  2JA5 H;  3F2C A;  4TQU S;  1VQJ A;  2ZTD A;  2GVA A;  4RG1 A;  1WOC A;  2Y0S G;  1A62 A;  4ALP A;  1XJV A;  4JBM A;  1JMC A;  2CCZ A;  4DV4 Q;  4A3I G;  4UP9 A;  1WYD A;  1IXR A;  2PQA A;  2VQF Q;  3H0G G;  4MTN A;  1BKB A;  1JJG A;  2JZW A;  1QVF A;  4JV5 Q;  3BU2 A;  1YHB A;  1KAW A;  1TXY A;  3PUW A;  5FLM H;  4DUZ L;  1XPR A;  3NEL A;  1PH6 A;  1N9W A;  3U4Z A;  2K5V A;  3Q8D A;  1JB7 A;  4LUO A;  3CQZ H;  3W1B A;  5IYD H;  4DNI A;  2YV5 A;  1HNW L;  2UXB Q;  3GTP H;  4OXP A;  5M5X H;  3ULJ A;  3KDF B;  3OYY A;  4DR6 L;  1SLJ A;  2AMC B;  4LF8 Q;  4LF4 Q;  1K73 C;  3OTO L;  1VQC A;  5IT9 c;  2HHH Q;  4GKK Q;  3CCU A;  5JJL A;  3TS2 A;  2MO0 A;  1HZB A;  3GTO H;  3HKS A;  4B3T L;  4AQY L;  1RIP A;  3I4M H;  3KJO A;  4QIW E;  2E5L L;  2YSA A;  3PIP A;  3I4N H;  1TWC H;  1PH4 A;  3BZC A;  2Y0S E;  3UDX A;  2B63 H;  2AKW B;  1I3Q H;  5IE8 A;  2L4L A;  5M3M H;  1I6H H;  3J7Z C;  3CCM A;  4JI8 Q;  1IBL Q;  4A3D G;  4B3T Q;  2ATW A;  4WJ4 A;  3RZO H;  3L0O A;  1VQM A;  3VDY A;  1VQ4 A;  2ZJR A;  3UDF A;  3DM3 A;  1FL0 A;  1N32 Q;  1IBK L;  1IBM L;  1HZ9 A;  1C7Y A;  3H3V H;  2VL6 A;  2EQS A;  4GLA C;  4JI7 Q;  1WJJ A;  4R4O A;  4DR5 Q;  2ZJQ A;  4LNQ A;  3T1Y L;  5GQO A;  3AFP A;  1P8L A;  3RLF A;  4LF5 L;  3S1M H;  2C35 B;  2VQE Q;  3KYH C;  1N33 L;  1DGS A;  4DV7 Q;  3KFU A;  5AJ3 L;  4GOP C;  2R7Z H;  5GRO A;  1NTG A;  4HID A;  4DR4 Q;  2VUM H;  2XGT A;  3I56 A;  2WAQ G;  2KCM A;  2F52 A;  4JYA Q;  1F6U A;  3FP9 A;  5IWA L;  4UPA A;  3W5O A;  2A19 A;  4BBR H;  5C3E G;  2Q2T A;  1W3S A;  3KJP A;  1J5E L;  5IYC H;  2JK8 A;  1K9M C;  1EWI A;  2NN6 I;  1FJG Q;  1XNQ Q;  3S2D H;  1WWD A;  3H3V I;  5M3F H;  4B3S Q;  1N36 L;  1T9H A;  2LXK A;  3S24 A;  2HT1 A;  4L5R C;  4JI6 Q;  1CKN A;  1EYG A;  2LSS A;  1A1T A;  4PZ6 A;  1KIX A;  1PVO A;  1YJN A;  4JOI C;  1XPU A;  2CWA A;  2JA9 A;  3M85 A;  4DR3 Q;  1PH7 A;  1VQ9 A;  1PFS A;  1Y1V H;  4LW1 A;  4BA1 I;  1C9O A;  4C2M H;  2IX0 A;  4K0K Q;  2R92 H;  4A3L G;  2UUB L;  1VQP A;  1VQ8 A;  4L5T A;  4JI4 Q;  4BXX G;  1ESK A;  1V9P A;  5IP9 G;  4JI5 L;  1LUZ A;  2K5H A;  5GAH C;  1D8L A;  4OWT B;  4HJA A;  1VQF A;  4C3H H;  2F3I A;  3A74 A;  3E9I A;  1M90 C;  4GS3 A;  4PMW A;  3TRE A;  1WWF A;  3T1H L;  3S1N H;  4GOP B;  1AAF A;  4YCW A;  1D7Q A;  1SE8 A;  1BVS A;  2Z0S A;  1A0I A;  1S3O A;  1QUQ A;  1XMO Q;  2JEA I;  3F8T A;  4BY1 G;  1AH9 A;  4QL5 A;  2CQO A;  4HIM A;  4A3B G;  4JI3 Q;  1X3F A;  1I94 Q;  1Q12 A;  4R4C A;  5C4X H;  4GLX A;  2PQA B;  1HR0 Q;  1VQ6 A;  3HOW G;  3S17 H;  4A93 H;  1VQB A;  4IOA A;  1BJ6 A;  4NXN L;  3CCL A;  4KLK A;  1E7Z A;  2LI8 A;  3M3Y H;  3PF5 A;  4YWL A;  5LMU Q;  3HOY H;  4A3E G;  2A1A A;  5FJ8 H;  1HZA A;  4BY7 G;  2PMZ E;  3NYB B;  5LMN L;  3U50 C;  4AYB G;  2UUC L;  3PO3 H;  1PH1 A;  3AFQ A;  4DV5 L;  1GVP A;  2UXC L;  4NPS A;  2XTI A;  4BBS G;  3FKI H;  2K14 A;  4YY3 L;  3FHW A;  1WCM H;  3JAM i;  2F4V Q;  4J15 A;  4O0A A;  2OQ0 A;  3S15 H;  4UY8 C;  1Y1W G;  1E1T A;  1XTD A;  4DUZ Q;  3K80 C;  4X65 Q;  1SFO H;  5E7N A;  1P16 A;  2JA8 H;  3RLO A;  1B7Y B;  1N34 L;  4HJ8 A;  2UU9 L;  2CKZ B;  2R93 H;  2BH8 A;  3E9H A;  4LFA Q;  3CAM A;  3JC6 6;  1OTC A;  2Q2U A;  2ZM6 L;  4LFB L;  1HNW Q;  3F1Z A;  1MJC A;  1YJ9 A;  1MJE A;  4GN4 B;  3BJU A;  1YNX A;  4XTC S;  4DR1 L;  4DR6 Q;  4GKJ Q;  4LUZ A;  1UE6 A;  2Z6K A;  4ME3 A;  1U6P A;  3IRB A;  1QVG A;  4DAY B;  4C3I H;  2MNA A;  2UUA Q;  1YI2 A;  4YCV A;  5DLQ E;  4JI1 L;  1RL2 A;  3F2D A;  1VQ7 A;  3J81 i;  4AQY Q;  4OX9 L;  4DKA C;  3I4O A;  2QEX A;  2E5L Q;  4EQ5 A;  3PUV A;  2ASB A;  1A8V A;  4LF7 L;  3HOU G;  4IOC A;  2IY5 B;  4AYB E;  3HOX H;  2HIV A;  3K0X A;  4HIO A;  1PA6 A;  4B3M L;  3HOV H;  4IFD G;  2I5H A;  3CMA A;  1HH2 P;  5C0X I;  1PH5 A;  4LFC L;  2ZJP A;  1A63 A;  3I55 A;  1EFW A;  3CCQ A;  3SGI A;  5FLX c;  4DV2 Q;  4YHH L;  2EXF A;  1AE3 A;  1HJP A;  2IHE A;  3CCJ A;  2CWP A;  3A0J A;  3J80 c;  2NVQ H;  1XNR L;  4L5S A;  3W1G A;  2RF4 A;  4DV1 Q;  4GNX A;  1L2F A;  3PUY A;  4RMF A;  3CCR A;  1K83 H;  1PH8 A;  1IBK Q;  1ASY A;  4BA2 I;  1NJI C;  1K0R A;  4UP7 A;  1KHI A;  3GTM H;  3EBE A;  1YBY A;  4DV4 L;  1TWG H;  4DV0 Q;  4DR7 Q;  4A3C H;  1Q81 C;  3T1Y Q;  4A3J H;  1VQN A;  4R4I A;  2N78 A;  1X9N A;  3S14 H;  2WB1 G;  2DUD A;  1X3G A;  4APV A;  4LF5 Q;  1MIU A;  4JV5 L;  4Y52 H;  1JE5 A;  1N33 Q;  1SR3 A;  3UE0 A;  1X6O A;  2JA6 G;  2CFM A;  3KLW A;  4KHP L;  1H95 A;  4HJ5 A;  4A3K H;  5GAG C;  1CSQ A;  4PZ8 A;  3M7N A;  3AEV A;  4OWW B;  1VQD A;  3K7U C;  1TWA H;  2EIF A;  1M1K C;  2LXJ A;  4X66 Q;  3PO2 G;  4POF A;  2JA7 G;  2UXB L;  4NXM Q;  4JBW A;  2JA5 G;  1E3P A;  2PI2 E;  4LF8 L;  1HNZ Q;  2KEN A;  4KHZ A;  3RLN A;  2B29 A;  2RHQ B;  2HHH L;  4X62 Q;  4GKK L;  4DUY Q;  3GD7 A;  4LF6 L;  5C44 H;  4A3M H;  1L1O A;  2JE6 I;  3G48 A;  4A76 A;  1FVI A;  4A3F H;  3CC2 A;  2KHI A;  5IY0 A;  4DV6 L;  4JBK A;  4A3G H;  2OQK A;  2VNU D;  3GO5 A;  5JJI A;  1Q86 C;  4B3R Q;  3D0F A;  5IYD G;  1WI5 A;  3TS0 A;  1S72 A;  1QZH A;  4LF9 Q;  1MFS A;  4JI8 L;  1IBL L;  2KCT A;  4EX5 A;  4HIK A;  2WB1 E;  2QA4 A;  1NY4 A;  5IYB H;  1BBW A;  4OO1 G;  4Y7N H;  1K8G A;  1SN8 A;  4H02 A;  1Q3Y A;  3EN2 A;  2I5L X;  1PH3 A;  1B70 B;  1E24 A;  5BR8 Q;  4BY7 H;  3G4S A;  1N32 L;  2R6G A;  3PGZ A;  3T1H Q;  3HOZ G;  5C0X J;  4JI7 L;  1PYB A;  1EUJ A;  4MZ9 A;  1CKM A;  3I4M G;  4QQB X;  1PH9 A;  1QVC A;  3I4N G;  3HFZ B;  1IL2 A;  1FGU A;  2B63 G;  2D62 A;  4R1J A;  2AWO A;  4DV7 L;  1TWF H;  4DAM A;  2JJQ A;  5M3M G;  1O7I A;  1Q1E A;  1HNX Q;  2I0Q A;  4TVA B;  4DR4 L;  3U4V A;  4PZ7 A;  1SRO A;  2YTX A;  1LM0 A;  2N49 A;  1UWV A;  2HQL A;  2D0O A;  4GLV B;  4JYA L;  1XPO A;  1VCI A;  4IPH A;  4A3I H;  3NEN A;  3CCE A;  3WWV A;  4JCV E;  2NN6 G;  3H0G H;  2OWO A;  3G6E A;  2UXD L;  4X64 L;  1GKH A;  1Q7Y C;  1QZG A;  3PCO B;  1XNQ L;  1G29 1;  3B6Y A;  1E22 A;  4GN5 A;  1NE3 A;  3STB D;  4DPG A;  2PI2 A;  1VQ5 A;  1XMQ Q;  3AYH B;  2MFI A;  1KRT A;  4P74 A;  3S16 H;  4X6A H;  2K75 A;  4JI6 L;  3M4P A;  5J3B A;  1KL9 A;  1YEZ A;  4IPG A;  1CKO A;  1EQQ A;  2R7Z G;  4DR3 L;  1X3E A;  1V43 A;  2KHJ A;  2VUM G;  2ZTE A;  4C3J H;  2RHS B;  3HKZ G;  3CD6 A;  1UEB A;  2WFW A;  1N34 Q;  1KD1 C;  3M4O H;  3H15 A;  4K0K L;  3D31 A;  4WJ3 M;  4BBR G;  2GN5 A;  4GN3 B;  5IYC G;  2ZM6 Q;  2IHX A;  3G71 A;  2ALY B;  1YIJ A;  5H1S E;  1GO3 E;  1K8A C;  3PF4 A;  1UE7 A;  4JI0 L;  3EIV A;  5M3F G;  4YWM A;  4GNX B;  2EC7 A;  3J7A 5;  4QGU A;  3KOJ A;  4L5Q A;  1XMO L;  4OX9 Q;  2B3G A;  2CQF A;  2RCN A;  1OXV A;  4JI3 L;  2YTY A;  4A3D H;  1I94 L;  3ER0 A;  2JQO A;  2V1C C;  1Y1V G;  5JEA J;  4DV3 L;  2ES2 A;  1VQO A;  1HR0 L;  1VQE A;  2KBN A;  1L0W A;  1V1Q A;  3KF6 A;  4P73 A;  3OTO Q;  4B3M Q;  2R92 G;  4IFD I;  2D0P A;  1K3R A;  4R4Q A;  2E2J H;  4JI2 L;  5LMU L;  1OXX K;  2HIX A;  3CPF A; 
#chains in the Genus database with same CATH topology
 2KHS A;  3HS0 C;  1TS5 A;  3KF8 A;  3HKZ E;  2XRS D;  3E0J A;  3J80 L;  1EWH A;  3GTQ H;  1STG A;  3FMC A;  4K6L A;  1WTW A;  4UAI A;  1EIH A;  4S3S A;  1FGB D;  1E0B A;  1HA5 A;  2MHV A;  1VQH A;  1IBM Q;  2HUG A;  4ZRZ A;  3LWE A;  4LFA L;  3DHQ A;  3J7A V;  5LL6 X;  2VQF L;  3TBI B;  4GKJ L;  4AH6 A;  2E2H B;  3QOL A;  2B2U A;  3VYU A;  1PYS B;  1S40 A;  5EKK A;  3I91 A;  1LYL A;  1SMY C;  5HGT A;  2NBF A;  5HGQ A;  5IP9 H;  3K6O A;  4DV6 Q;  2NVX H;  1SNC A;  1HCZ A;  3I8Z A;  1Z47 A;  2R93 G;  1YNN C;  2M3Z A;  1ZXT A;  2A6H C;  2HDL A;  1N36 Q;  3ERS X;  4JG2 A;  1OXS C;  4F88 A;  3CME A;  1BR9 A;  4CJ2 C;  4OO1 I;  3S1Q H;  1STN A;  1TWH B;  3AQQ A;  3BZK A;  2RDF A;  1S5C D;  5KIX A;  4DV0 L;  2A68 D;  1QIL A;  3K81 C;  3NTI A;  4HAE A;  3QIA A;  3HOX G;  2EVB A;  4IUQ A;  1KTK A;  4M1U B;  2GVB A;  3E0E A;  2J7Z A;  3DLL A;  2IHF A;  1GUT A;  4P71 A;  2E2H H;  2WP8 J;  3RZD B;  1LTS D;  4XQJ A;  5M5W H;  1HNZ L;  2E2I B;  1IYJ B;  1DM0 B;  2VQE L;  2SEB D;  4L6T B;  4Z9C B;  3T13 A;  1C4Q A;  4A3C G;  4NXN Q;  1X54 A;  3E6Z X;  3GTJ B;  1B3A A;  4C1N I;  3C2P A;  2EYM A;  1NMG A;  5LMN Q;  3KUP A;  4IUT A;  4B3R L;  1VQL A;  2AUJ D;  3V05 A;  3RN5 A;  2JA7 B;  4KTA A;  2L12 A;  4DV5 Q;  2F0G A;  2JA5 B;  1O7Z A;  2B39 A;  5CR3 A;  1K28 A;  3KF6 B;  1EY7 A;  5HY6 A;  1JWS D;  1TWH H;  2XNA C;  2EXZ A;  2IW3 A;  1OO9 B;  1G6P A;  3HOU H;  4B9X A;  1D1K A;  2OEO A;  4O1N A;  1HFN A;  1O7Y A;  2CW0 D;  1J6Q A;  4HJ7 A;  4A75 A;  2UU9 Q;  3OMG A;  4DFA A;  1BDO A;  3MTS A;  4OIK A;  4ME5 A;  2XRQ D;  1AE2 A;  3ERQ A;  5ISR A;  5EGT A;  4KK7 A;  1L1O C;  4JPB W;  4DV3 Q;  5C4J B;  3MEF A;  4N8F A;  2KCN A;  1QJO A;  3RZD H;  1WWE A;  5IIF A;  4G57 A;  2E2I H;  5IGG A;  1VQK A;  1QNK A;  1LO5 D;  5IGD A;  2KEE A;  1H9R A;  1UE5 A;  1YVC A;  4LF7 Q;  2BCO A;  5KNC A;  1DYQ A;  4R4T A;  2RKS A;  4A4I A;  3OW2 A;  1R9T H;  5J22 A;  3GTJ H;  4LFC Q;  4PQX A;  1RF2 D;  4QB4 A;  2B63 B;  1FYC A;  3VR6 A;  5NUC A;  1GD7 A;  4C3H G;  2JA7 H;  1XWE A;  2NZH A;  1EYC A;  2JA5 H;  3GDE A;  1VQJ A;  3RZO B;  2ZTD A;  2GVA A;  2IJ0 A;  2OF1 A;  3SK6 A;  4UP9 A;  1WYD A;  1Q90 A;  3C1F A;  2VQF Q;  3H0G G;  4MTN A;  2JZW A;  5DEH A;  3ND9 A;  1A3T A;  3BU2 A;  2QKI C;  5FLM H;  3PUW A;  1PH6 A;  4KMU C;  1XPR A;  3X3N A;  3UI2 A;  1JB7 A;  2F0Q A;  3W1B A;  1STY A;  3TZD A;  5FK9 C;  5CV9 A;  2D5D A;  2AMC B;  3OTO L;  1VQC A;  4BBR B;  4GKK Q;  1FR3 A;  1ICF B;  2NTT A;  1KDB A;  1PTO C;  4B3T L;  4WJW A;  2XIW A;  1PH4 A;  3BZC A;  2Y0S E;  2B63 H;  1L0Y B;  5CBA E;  1HA6 A;  2NVT B;  4L63 B;  1I6H H;  1VDZ A;  3M4Y A;  5CGK A;  3RZO H;  2OT2 A;  3L0O A;  4DAY A;  1VQM A;  3VDY A;  3J7A F;  1K0S A;  4KKU A;  3K59 A;  3DM3 A;  1HZ9 A;  1C7Y A;  1ET9 A;  2D2C C;  4JI7 Q;  2ZJQ A;  2EYJ A;  3S1M H;  2VQE Q;  3KFU A;  1O7L A;  4GOP C;  2F0I A;  4HID A;  4HCS A;  4K2K A;  3I56 A;  2WAQ G;  2Z4H A;  1F2Y A;  1PTO B;  4BBR H;  1EY4 A;  1RDP D;  5FLX E;  3HRZ C;  1SYE A;  1NR4 A;  1M4V A;  1L0X B;  1Z6H A;  5CMD A;  4JOI C;  5CV5 A;  1TS2 A;  4BA1 I;  4C2M H;  4A3L G;  1ET6 A;  1VQP A;  2F0V A;  2WII B;  1V9P A;  4K8J A;  2R93 B;  2F0N A;  3J81 L;  5CV6 A;  2F3I A;  4ID6 A;  3ND8 A;  5EPL A;  3SVM A;  2A6H D;  4GOP B;  1AAF A;  5JVH 3;  2AQ3 B;  3GV3 A;  1GHK A;  4BY1 G;  1JC7 A;  3DWQ A;  4A3B G;  1X3F A;  3CQZ B;  4PMB A;  4MN3 A;  2PQA B;  1HR0 Q;  3T16 A;  1VQB A;  2FHT A;  1BJ6 A;  4X3S A;  3HOX B;  4KLK A;  1E7Z A;  1D5X C;  2QDL A;  3PF5 A;  4A3E G;  4BY7 G;  1SEB D;  2PMZ E;  4XDX A;  3GTO B;  3E5S A;  3D6C A;  4AYB G;  1EOT A;  1PH1 A;  1GVP A;  5E4W C;  1WTR A;  3VR3 A;  2K14 A;  1CHQ D;  4YY3 L;  4JW0 A;  3JAM i;  1SE2 A;  2F4V Q;  2TSS A;  2OQ0 A;  1HPC A;  1JWM D;  2KJX A;  4DN4 M;  4J6H A;  1PRT B;  2NYZ D;  1B7Y B;  4HJ8 A;  2R93 H;  1KDC A;  3JC6 6;  1EY0 A;  3F1Z A;  1MJC A;  1BCP B;  1SJE D;  2X6L A;  3BJU A;  4XTC S;  2EYL A;  4C3I H;  2FIN B;  2UUA Q;  5JOB A;  1RL2 A;  2R7Z B;  1TS3 A;  1A8V A;  5FLX L;  3HOX H;  4HIO A;  3HGB A;  2I5H A;  3CMA A;  1XTC D;  3MA2 B;  3SGI A;  4YHH L;  5KNB A;  2RVL A;  3J80 c;  2EYH A;  4L5S A;  1L2F A;  5A2Q L;  3CCR A;  1CK1 A;  1K83 H;  4DK0 A;  1ASY A;  3BDO A;  4DV4 L;  4A3C H;  2QDB A;  3QOJ A;  3U9S A;  1Q81 C;  4R4I A;  4RGT A;  5EBD A;  2WB1 G;  4Y52 H;  1SR3 A;  4QCL A;  1IKL A;  4KY6 A;  2J4X A;  4PZ8 A;  4XT3 B;  4C3H B;  4X66 Q;  4POF A;  3VA5 A;  4ZUJ A;  4DAV A;  4G7O C;  2EJF C;  2KOL A;  3RLN A;  4X62 Q;  1KAA A;  3H0G B;  4WFN 3;  1L1O A;  1Y8P B;  1CHP D;  1EY6 A;  2RA4 A;  3DWA A;  4RGN A;  3S16 B;  3DWP A;  1S4Z A;  1ZEQ X;  5IY0 A;  3Q0A A;  1WTX A;  2VNU D;  1GUN A;  1Q86 C;  3D0F A;  3GP7 A;  1V1P B;  1S72 A;  2DY7 A;  1DOK A;  1ENF A;  4HIK A;  1BBW A;  4OO1 G;  3SHL A;  1U4L A;  3M4O B;  4G7Z C;  2QF7 A;  5BR8 Q;  1N32 L;  3OWF A;  5C0X J;  3CRL C;  1EUJ A;  3C1E A;  1CKM A;  4QQB X;  1STH A;  2E76 C;  1QVC A;  1IL2 A;  2NUC A;  2F0K A;  2DNE A;  1PYW D;  4K14 A;  1HNX Q;  1NCV A;  4G7H C;  1M8A A;  1SRO A;  2HQL A;  2MGS A;  1A2U A;  2D0O A;  2KEC A;  3LNN A;  3H09 A;  2NN6 G;  1TY2 A;  3H0G H;  2UXD L;  1GKH A;  3O13 A;  1XNQ L;  3VA7 A;  1VQ5 A;  3D4D A;  3NBI A;  1KRT A;  3S16 H;  1LT4 D;  3E3X A;  2Q8R E;  1CKO A;  1EQQ A;  5IGF A;  2WAQ B;  3VYT A;  3HKZ G;  3I4L A;  3PQI A;  3CD6 A;  3M4O H;  4WJ3 M;  1YIJ A;  1IW7 C;  4ZAI A;  3AU7 A;  2YU9 B;  4JI0 L;  2P5Z X;  3J7A 5;  4B9W A;  4L5Q A;  3CKI B;  1MBY A;  2RCN A;  1OXV A;  3ER0 A;  2JQO A;  1SND A;  2V1C C;  5JEA J;  3WDN A;  3K5N A;  5JJK A;  1TY0 A;  1V1Q A;  2R92 G;  3JAM E;  1J8I A;  3MXN A;  4QMG A;  2D0P A;  3NQT A;  4QUF A;  4WOR A;  2M2L A;  5LMU L;  2HIX A;  2BA0 A;  4GOP A;  2KED A;  2MP1 A;  3GTG B;  1RTN A;  4DR2 L;  1FNV A;  3ULL A;  3KLR A;  4BY1 B;  1EIY B;  4A3B B;  2J0T D;  3KLS X;  4A3G B;  2FJ2 A;  1V1O A;  1LTT D;  4IPD A;  1U5K A;  5C4X G;  2CVR A;  2VB2 X;  4X65 L;  3ULP A;  2NB0 A;  4A3E B;  3H91 A;  4BY7 B;  4JOI A;  3T53 B;  2YU9 H;  1VS0 A;  5J39 A;  1E2V A;  5I2X A;  5T1G A;  3PV0 A;  1YJW A;  2G5D A;  2OTL A;  4PG3 A;  2XWJ B;  3BVM A;  1STA A;  1CKN B;  3TSS A;  4IJH A;  3P75 A;  3HOZ H;  4U67 3;  1WCM G;  2ZTC A;  3BVZ A;  4A3L H;  3QG1 A;  2PQE A;  1II3 A;  4QIW B;  1SRU A;  1U0L A;  1ASZ A;  4IUV A;  2VY3 A;  3M7N A;  2JA8 G;  1JJ2 A;  3ICE A;  2PNH A;  2PW5 A;  2K52 A;  2JN4 A;  1CUK A;  1E2W A;  3GTG H;  3I73 A;  1B1Z A;  3U58 A;  1KLG D;  3GTK H;  1WVL A;  4BY1 H;  2L15 A;  2R7F A;  2OCE A;  3CP0 A;  4CKE A;  3K7A H;  5JPM C;  1SNQ A;  5FLM G;  4A3B H;  5GAE C;  1Q1B A;  1QCB D;  2CH4 A;  3NP8 A;  4IFD J;  3KDF A;  3STB C;  1IZ6 A;  3HOV G;  5KRU A;  4A3E H;  2A5H A;  3ZJY C;  4IPC A;  4NDX A;  3IFD A;  2XWB B;  4NXM L;  2FXQ A;  4DNR B;  5IT9 E;  5I4D A;  2UXD Q;  4LWC A;  2MO1 A;  2WKD A;  1CSP A;  2A8V A;  2WB1 B;  3Q6S A;  3L2P A;  1PZK D;  2B8G A;  3J81 j;  3V2T A;  3I7F A;  4XQQ A;  1FJG L;  3P7J A;  1HR0 W;  2K4K A;  4LF9 L;  3CRK C;  4B3S L;  1QE6 A;  3EJI A;  4WRD A;  4I7Z C;  1QNU A;  1VQA A;  2AWN A;  1Q3Z A;  4PMC A;  3GTL H;  4CDE C;  1Q3L A;  4JI0 Q;  1SMX A;  5F2D A;  3J81 c;  1VQG A;  4A3F G;  4IZ8 A;  1BBU A;  1V1P A;  2DGY A;  3I2Z A;  4LUV A;  3UDG A;  2OTJ A;  1B4O A;  4DR1 Q;  3OIQ A;  4DK6 C;  1VF7 A;  3GTP B;  1JIC A;  4YCU A;  2R7D A;  1XX8 A;  4JI1 Q;  1YHA A;  1JQY D;  4EQN A;  3CF5 A;  2GA4 B;  5GAD C;  1D5Z C;  1W6K A;  1GM5 A;  1EIF A;  4DR2 Q;  5FO9 B;  5I2Y A;  3FPP A;  5DM6 3;  2D9U A;  3CCS A;  3TRZ A;  2NVX B;  5IOD A;  1RHP A;  1NAP A;  2K50 A;  4ZKC B;  4RHR A;  3LWU A;  1LTL A;  2O5I C;  2Z4I A;  3CW2 C;  1KQS A;  2JEB I;  3F2C A;  4TQU S;  2Y0S G;  1A62 A;  1S5B D;  1D2B A;  4JBM A;  3S1Q B;  4A3I G;  3R3O A;  1WTO A;  2I46 A;  3NEL A;  3A7L A;  3Q8D A;  4LUO A;  2R61 A;  1EL0 A;  1EEF D;  2UXB Q;  1EQT A;  3GTP H;  3ULJ A;  1ICW A;  4DR6 L;  4OO1 H;  3Q22 A;  4LF8 Q;  4C3J G;  4RA8 A;  3CCU A;  4H13 C;  4IAL A;  5M5W B;  1RIP A;  4RKL A;  3S2D B;  1CFM A;  2QEJ C;  1U4P A;  1D1I A;  3NK9 A;  2L4L A;  1TU2 B;  2JSO A;  4RCN A;  2H4O A;  1IBL Q;  4A3D G;  4DF7 A;  2XN9 C;  4WJ4 A;  2R92 B;  1UNS A;  3D8G A;  1VQ4 A;  2ZJR A;  1W6J A;  3BDC A;  2NN6 H;  1AEX A;  4C3I G;  1IBK L;  1EFI D;  3HOU B;  3VYS A;  3S1N B;  1F2Z A;  1STB A;  2SOB A;  1P8L A;  3RLF A;  2RSN A;  2C35 B;  1R4P B;  4K5W A;  1N33 L;  4HN7 A;  4IUN A;  4DV7 Q;  5AJ3 L;  1UUP A;  5GRO A;  1B44 D;  1NTG A;  2PYK A;  1U9R A;  2RBM A;  4DR4 Q;  3KK7 A;  2XGT A;  1CQF A;  3OMC A;  3S17 B;  5C4X B;  1LLR D;  3FP9 A;  5IWA L;  4UPA A;  1Z7T A;  1W3S A;  2DNC A;  1SYC A;  1J5E L;  4N8X 1;  2F0S A;  1K9M C;  4LK1 C;  1WTH A;  2NN6 I;  1JR0 D;  1FJG Q;  3S2D H;  1WWD A;  5CYU A;  4ZUI A;  4B3S Q;  5CBE E;  2LXK A;  3S24 A;  2HT1 A;  4L5R C;  1CKN A;  1R9T B;  5EBC A;  1EYG A;  1A1T A;  2CWA A;  3RMH A;  1B9M A;  1HUM A;  2PZW A;  1WCM B;  4FXK C;  3MAQ A;  2R92 H;  4LJZ C;  2UUB L;  1VQ8 A;  4L5T A;  2JA8 B;  4BXX G;  2K04 A;  1ESK A;  5AFW A;  4HED A;  4JI5 L;  1LUZ A;  2F0H A;  3A74 A;  3E9I A;  1PFN A;  3S1N H;  4YCW A;  1D7Q A;  1SE8 A;  2ZXO A;  1A0I A;  4KV6 A;  1AH9 A;  1CTM A;  4QL5 A;  1EYD A;  2SNM A;  2EZV A;  3IKJ A;  2PZT A;  5C4X H;  4GLX A;  3HOW G;  3S17 H;  1SYB A;  2L1B A;  4YWL A;  2BDN A;  2A1A A;  1HZA A;  3NYB B;  1DCZ A;  2UUC L;  3AFQ A;  2UXC L;  2H1E A;  4BBS G;  4Q0F A;  5FOB B;  3EA6 A;  1WCM H;  2BOS A;  2O4X A;  4O0A A;  1I4Q A;  1I6H B;  4UHV A;  1Y1W G;  4XYO A;  3WOF A;  2KQ3 A;  1P16 A;  2JA8 H;  3EVQ A;  1N34 L;  4LFA Q;  3CAM A;  4LFB L;  1MJE A;  4DR6 Q;  4GKJ Q;  4V0B A;  1U6P A;  3TP5 A;  1YI2 A;  5DNF A;  3S1M B;  3NPP A;  1SE4 A;  4BWG B;  4F87 A;  4OX9 L;  4DKA C;  4RFB A;  2QEX A;  2K7V A;  3PUV A;  3J7Y W;  1SYF A;  2HIV A;  3K0X A;  3HOV H;  4I7A A;  4A3F B;  1A63 A;  1F9R A;  5ELB A;  1EY8 A;  2HD3 A;  1HJP A;  3CCJ A;  3R2I A;  4C1N K;  2PNR C;  1XNR L;  5D65 A;  3PUY A;  5BN3 A;  2DN8 A;  1SNM A;  1IBK Q;  4Y7N B;  2L11 A;  4BA2 I;  2QCP X;  1NJI C;  1KHI A;  2A73 B;  3EBE A;  4DV0 Q;  4FNF A;  4KJO A;  2N78 A;  4C2M B;  1G2S A;  2DUD A;  4U68 A;  2F0O A;  4JV5 L;  2BDO A;  1JE5 A;  1N33 Q;  4EQP A;  2CH4 W;  2F0E A;  1X6O A;  3UE0 A;  2JA6 G;  1H9S A;  2F3V A;  4KN7 C;  3CU7 A;  1WD1 A;  1IYV A;  5GAG C;  1TWF B;  3PO2 G;  2LXJ A;  5E3F A;  3Q24 A;  4JBW A;  1E3P A;  1HNZ Q;  2HHH L;  4CBV A;  5LHY 1;  3QO2 A;  3GV6 A;  4J8Q A;  2G9H D;  1VMC A;  2JE6 I;  3G48 A;  4A3F H;  1CZW A;  2OQK A;  4B3R Q;  5IYD G;  1WI5 A;  3K5O A;  5I6W A;  1QZH A;  1LT5 D;  1JOQ A;  4JI8 L;  4C3J B;  2QA4 A;  3D3R A;  4Y7N H;  4H02 A;  1Q3Y A;  3EN2 A;  2I5L X;  1K8O A;  1B70 B;  3HOZ G;  1SMY D;  1C48 A;  4DA2 A;  4MZ9 A;  4CDC C;  3I4N G;  3HFZ B;  4ILW A;  1PMR A;  1FGU A;  4CGY B;  1YNN D;  4R1J A;  3OWE B;  1TWF H;  3MEH A;  4DAM A;  4FF1 A;  2JJQ A;  1PRT C;  4A3D B;  1H9M A;  2RSO A;  3I90 A;  4TVA B;  3KBG A;  5T1I A;  1HRJ A;  3U4V A;  2EXF A;  4JYA L;  1UWV A;  3R93 A;  4GLV B;  1XPO A;  4C3I B;  4H0L C;  1BCP C;  1I4H A;  3U9O A;  4A3I H;  4ZYS A;  2E2J B;  2OWO A;  4ZKB B;  4X64 L;  2F1M A;  2B2Y C;  4DPG A;  4GN5 A;  1NE3 A;  2PI2 A;  2WKC A;  1D6E C;  2K75 A;  4JI6 L;  3M4P A;  4ZQ3 A;  1KL9 A;  3S2H B;  4IPG A;  4RWS C;  4DR3 L;  1X3E A;  1A6X A;  2K5D A;  2VUM G;  3FDT A;  4C3J H;  2RHS B;  4K0K L;  1N34 Q;  1RTO A;  1B9N A;  3D31 A;  2F3W A;  1K83 B;  3SE0 A;  4MTK A;  5EKL A;  5IYC G;  4GN3 B;  3A7A B;  5EPK A;  3IAY A;  3C46 A;  1K8A C;  1SAP A;  5M3F G;  4KY7 A;  1PLF A;  2RDH A;  3S1R B;  4GNX B;  4PNY A;  3KOJ A;  1XMO L;  4OX9 Q;  2B3G A;  1I50 B;  2CQF A;  1A15 A;  2PMZ B;  4JI3 L;  4A3D H;  1I94 L;  4UDU C;  4YIJ A;  1EEI D;  2KBN A;  3KF6 A;  2Q8T A;  3OTO Q;  2LS0 1;  2E2J H;  4B3T Q;  1XNR Q;  3VYR A;  1YHQ A;  1X55 A;  1JE4 A;  3MXP A;  1SDF A;  4NB3 A;  2O5J C;  3S2H H;  3Q23 A;  4P72 A;  3HOW B;  3FVQ A;  2EY1 A;  1J9O A;  4JBJ A;  3A54 A;  1Q8I A;  1O80 A;  1ILQ A;  1GUG A;  3X3M A;  1KXL A;  4OON A;  3N52 A;  3MXU A;  1Q8K A;  3S1R H;  1X3P A;  1AN8 A;  3BS1 A;  3RUZ A;  1EOV A;  2NVY B;  2VXW A;  1I50 H;  4N9P A;  5ELF A;  3FKI G;  1LAB A;  2NZ1 D;  4FO2 A;  2M9V A;  1G51 A;  5C0X G;  4BXX H;  1MD2 D;  2H5X A;  1Y14 B;  3RN2 A;  2Q2H A;  1O78 A;  2RCF A;  5ELO A;  4DV2 L;  3HG9 A;  2HQE A;  4M8A A;  3UDI A;  4ODG A;  3PSI A;  5JVG 3;  5I9O A;  4DV1 L;  3ZYY X;  1EZ8 A;  2EXD A;  1KRS A;  3NXW A;  1PHJ A;  2N8N A;  3HOW H;  2I5M X;  4DR7 L;  3A8I E;  4KJN A;  2VZA A;  4OWX B;  3J80 i;  1K8M A;  1AZP A;  1CM9 A;  2BE5 C;  1FD7 D;  2C9O A;  5C5L A;  1PFB A;  4TRD A;  4R8N A;  2NZO A;  3SK5 A;  3CC7 A;  5LMN W;  1PTO D;  3CXC A;  3G7L A;  4FDB A;  3T51 B;  5KYL A;  4GZY C;  4O2D A;  3TP6 A;  2CHB D;  4BBS H;  3TQY A;  3ITP A;  2NVY H;  1LTA D;  1QG7 A;  2IWH A;  1MKH A;  3QJY A;  4X64 Q;  1CQV A;  4DUY L;  1Y1W H;  1ESF A;  4J1M A;  1WWG A;  1X56 A;  2NWG A;  2JA6 B;  3PUX A;  4A3K G;  2AUK A;  3PO2 B;  2SDF A;  2E2D C;  1BNZ A;  1A2T A;  3M9B A;  5JEA G;  4YY3 Q;  1DJR D;  5IP7 H;  1BF4 A;  2N3S A;  1B8A A;  5K36 G;  2L4N A;  1UE1 A;  3G6J B;  4A3M G;  2MPM A;  2WAQ E;  3A5U A;  5EJW A;  3KF8 B;  4XIG S;  2F0D A;  5D3D A;  2ENB A;  5M5Y H;  2HCC A;  4CKC A;  3PIO A;  4N9T A;  1PH2 A;  5IYB G;  5CC4 A;  2AQ1 B;  1DXM A;  1DON A;  1PV4 A;  4OGQ C;  3HOZ B;  1S5F D;  2KA7 A;  3V96 A;  3NTK A;  2ZXR A;  1XMQ L;  2JA6 H;  4YHH Q;  3NHH A;  4JC0 A;  2L0C A;  1I3Q B;  3PO2 H;  1DOL A;  4P75 A;  1PRT D;  2LMC B;  1HZC A;  2EYP A;  4NKL A;  4OIJ A;  4G4K A;  3GTK B;  1WOC A;  2K1B A;  3K5M A;  3MFG A;  4ALP A;  3K7A B;  1BCP D;  3MC0 B;  1MI2 A;  4DV4 Q;  4RAU C;  2PQA A;  1JJG A;  1YHB A;  1KAW A;  1TXY A;  3T56 B;  1N9W A;  3U4Z A;  1CA5 A;  2LKV A;  5IYD H;  4DNI A;  1G6Z A;  1AW7 A;  1HNW L;  2VUM B;  4OXP A;  4AYB B;  3F2U A;  3OYY A;  2XSC A;  3TDQ A;  5JJL A;  4V19 0;  3TS2 A;  2MO0 A;  1HZB A;  4OHJ A;  4AQY L;  4DXF A;  2LY7 A;  2IX3 A;  3KJO A;  4QIW E;  2R3Z A;  2E5L L;  3I4N H;  2EOT A;  3I3C A;  5M9O A;  3UDX A;  1HQM C;  1I3Q H;  1JWU D;  2IL8 A;  2Z6B A;  5C4Z A;  3CCM A;  3VR4 A;  4EQO A;  2O2L D;  3WOE A;  2K5W A;  3UDF A;  1N32 Q;  3OHX C;  1IBM L;  3H3V H;  2VL6 A;  3GTL B;  4GLA C;  1WJJ A;  4R4O A;  1Y8O B;  2F0M A;  4LNQ A;  1G91 A;  3KLS A;  3DXJ C;  5GQO A;  2EY5 A;  2B2V C;  1DGS A;  4X3T A;  1HHV A;  4OL7 A;  2VUM H;  4RH6 A;  2KVM A;  1CT1 D;  2K03 A;  2CW0 C;  1IKM A;  3W5O A;  5C3E G;  2Q2T A;  3A8K E;  1JT8 A;  5IYC H;  2JK8 A;  5IGC A;  3JAM L;  1EWI A;  1XNQ Q;  3J80 E;  2X69 A;  3H3V I;  5M3F H;  1N36 L;  5L37 A;  3PIO 3;  2X6G A;  3KBX A;  1IHZ A;  1QOH A;  1SYG A;  1PVO A;  3MWY W;  3M85 A;  1PH7 A;  1PFS A;  3OPO A;  1GUS A;  2DJG C;  4F7X A;  1D8L A;  1VQF A;  5EKI A;  1M90 C;  4GS3 A;  3TRE A;  1WTQ A;  1BVS A;  2F0T A;  1S3O A;  3F8T A;  2CQO A;  4HIM A;  3GQB A;  2AQ2 B;  3AB9 A;  3BG3 A;  4CJ0 B;  1VQ6 A;  4IOA A;  1I4P A;  4NXN L;  2A69 C;  3P1H A;  2LI8 A;  5EQ0 A;  2BE5 D;  5LMU Q;  5C5M A;  5LMN L;  3U50 C;  3VR5 A;  1XYI A;  3DEO A;  4DV5 L;  4O42 A;  4RHS A;  3QB3 A;  5DM7 3;  3FKI H;  5DAU A;  3FHW A;  4H7B A;  5IGE A;  1IL8 A;  4J15 A;  3S15 H;  3GTM B;  1LTR D;  2K05 A;  2PZU A;  5E1F A;  1E1T A;  5C0X H;  4X65 Q;  1SFO H;  5E7N A;  1G2T A;  3RLO A;  4IQZ A;  2UU9 L;  2CKZ B;  1MHW C;  4XYQ A;  4A3K B;  3IFT A;  2ZM6 L;  1DOM A;  1HNW Q;  3BVG A;  4CHT B;  3SXH A;  1UE6 A;  1ESR A;  1QVG A;  4DAY B;  1PTO F;  2MNA A;  3NSW A;  4YCV A;  4DK1 A;  5DLQ E;  3R8B A;  3F2D A;  1VQ7 A;  3J81 i;  4AQY Q;  5IT9 L;  4KD3 A;  2E5L Q;  2ASB A;  4LF7 L;  4A3M B;  3HKZ B;  1QWY A;  1PA6 A;  1EIG A;  1F77 A;  2MJ8 A;  2F0F A;  5C0X I;  4LFC L;  1PH5 A;  3ONA B;  3I55 A;  3ERO A;  1T5E A;  5FLX c;  3CCQ A;  1AE3 A;  1IW7 D;  2CWP A;  3A0J A;  1ZYR C;  2PCF B;  1PXU A;  2IPK D;  4R9W A;  4RMF A;  1PH8 A;  1K0R A;  4UP7 A;  1MSH A;  3GTM H;  1VQN A;  4X3U A;  1ROD A;  1F2M A;  2F4I A;  3OIP A;  1MIU A;  1X32 A;  3TP7 A;  2E75 C;  4KHP L;  1H95 A;  2CFM A;  2K5Q A;  4A3K H;  1LV9 A;  1CSQ A;  1TR5 A;  3K7U C;  2EIF A;  4L8J A;  1Y69 U;  5I9P A;  2M00 A;  4NXM Q;  4OEL B;  5JEA H;  3K5L A;  5FKA C;  2PI2 E;  3OOC A;  5C4H A;  1SBB B;  2B29 A;  2RHQ B;  4GKK L;  5K36 H;  3GD7 A;  4LF6 L;  1F9S A;  1HQR D;  3BDL A;  2Z1C A;  4F8M A;  4FF2 A;  4P2C B;  4A3M H;  3W2D A;  1FNU A;  1FVI A;  5D14 A;  3CC2 A;  1TII D;  3EFX D;  4JBK A;  5JJI A;  3GO5 A;  2LFN A;  4HSV A;  3TS0 A;  4LF9 Q;  1MFS A;  1BUV T;  2KCT A;  1NY4 A;  5IYB H;  2A6E C;  1BOS A;  2RDG A;  4KD4 A;  1NR2 A;  1PRT F;  1SN8 A;  1GXD C;  4JI7 L;  1PYB A;  1BCP F;  2ICI A;  1ML0 D;  5FO7 B;  1I4G A;  3I4M G;  4BS9 A;  1TVX A;  3L3O C;  4X3K A;  3VR2 A;  4IUP A;  5M3M G;  2K28 A;  1Q1E A;  2I0Q A;  4K2L A;  3D4R A;  1KLU D;  4EVO A;  1LM0 A;  2YTX A;  3A8J E;  1VCI A;  4IPH A;  3NEN A;  5CV4 A;  3WWV A;  2WAC A;  4JCV E;  1HUN A;  2B8F A;  1Q7Y C;  4K6D A;  4LAA A;  3PCO B;  1G29 1;  3B6Y A;  3OSO A;  3K0Y A;  3STB D;  4LMQ D;  5COY A;  3AYH B;  3HOV B;  1DZ1 A;  5J3B A;  1CI3 M;  5COR A;  2R7Z G;  2KHJ A;  4IFD H;  2ZTE A;  3NTH A;  3IL8 A;  5C3E B;  1KD1 C;  5KEE A;  1GUW A;  2CQA A;  2GN5 A;  2ZM6 Q;  5H1S E;  1GO3 E;  2EY2 A;  3PF4 A;  4EGV A;  5C3X A;  5JPN C;  3EIV A;  1EU4 A;  2EC7 A;  1TQO A;  4QGU A;  5ELC A;  4PV1 C;  3RD4 A;  2YTY A;  2XVS A;  4OEM B;  1Y1V G;  2ES2 A;  1VQO A;  1HR0 L;  1L0W A;  4IFD I;  1K3R A;  1KAB A;  2FMM A;  1EY9 A;  4R4Q A;  1H9J A;  4JI2 L;  2FMC A;  2PW7 A;  2B2V A;  1A3V A;  2ZT9 C;  4YWK A;  4NW2 A;  5IP7 G;  4ZCK A;  3UE1 A;  3PUZ A;  1NBW A;  2EJG C;  5JAV A;  1Q82 C;  1C0A A;  1F2L A;  1YNJ C;  2VS1 A;  3W3A A;  2Z9H A;  1JB3 A;  2DY8 A;  2F4V L;  2B2W C;  5J1Z A;  1BXT A;  5C3E H;  1L1O B;  4A93 G;  2E8G A;  2A69 D;  3J81 E;  4KHP Q;  3CC4 A;  1Z9F A;  1TT2 A;  2F0W A;  2MUY A;  3HOY G;  5ELN A;  5C4J H;  5FJ8 G;  4MNO A;  1W2B A;  3A5Z B;  3TZU A;  1ENA A;  3PO3 G;  2YYZ A;  5AJ3 Q;  2UUA L;  4LF6 Q;  1EU3 A;  2SNS A;  2BH2 A;  5CV8 A;  2K01 A;  5IWA Q;  4ABN A;  4ZK9 B;  1J5E Q;  2Y0S B;  4DK3 C;  4LF4 L;  4A3I B;  1YZ6 A;  4DAP A;  3TP8 A;  3FRP B;  1JJC B;  1D5M C;  1E2Z A;  1OXT A;  4AIM A;  1KNA A;  3RR5 A;  4FXD A;  1TKW B;  3F2B A;  1QUQ B;  1RJT A;  2NTS A;  1A6B B;  4RGO S;  4IO9 A;  3TEH B;  3RNU A;  3K8A A;  1GJX A;  2Z6K C;  4MIU A;  2UUB Q;  1A3U A;  1NMF A;  1EWC A;  2Q2I A;  1LT3 D;  2K5N A;  4JI5 Q;  3NUC A;  5A35 A;  2V4D A;  1EZ6 A;  1ZYR D;  2IX1 A;  4X66 L;  4DR5 L;  4POG A;  2EE1 A;  1N8R C;  1Y8N B;  2AHO B;  5EAY A;  2F03 A;  4X62 L;  1SYD A;  2MQH A;  2YTV A;  3CCV A;  4GNX C;  4FP5 D;  3A56 A;  4FVM A;  4QY7 A;  4A3J G;  1I5F A;  2N88 A;  2VB3 X;  3JAM c;  1OXU A;  2NVT H;  1Q46 A;  4FXG C;  1LTI D;  5A2Q E;  1VQI A;  2UUC Q;  1JOR A;  2UXC Q;  4FF4 A;  1X65 A;  3LX0 A;  5BN4 A;  5G3L D;  1YIT A;  3MXN B;  1I6V C;  3HEJ A;  3NBH B;  4QUC A;  3DMU A;  5BR8 L;  4CKB A;  5C44 G;  3CPW A;  1PFM A;  5FO8 B;  1U4M A;  3S9W A;  2QW7 A;  1WFQ A;  1RKN A;  1NSN S;  1E1O A;  4C56 C;  4JI4 L;  1KC8 C;  4LFB Q;  4A3G G;  4HMJ A;  1EQR A;  3LGJ A;  2BA1 A;  3QWN A;  1HNX L;  3MHB A;  1PTO H;  5M5X B;  3NEM A;  2B2T C;  1PZI D;  2A6E D;  4CDD C;  2RQX A;  4JI2 Q;  4QJF A;  4IJL A;  4TSS A;  2VW9 A;  2IT1 A;  4UP8 A;  4KI0 A;  2ID0 A;  3N6R A;  3I4M B;  1B2T A;  1HXY D;  2Z8L A;  1TWC B;  2QGQ A;  2F0J A;  5M3M B;  3L7Z C;  3BYT B;  3M4Q A;  5C3W A;  1WTV A;  4HJ9 A;  1SSO A;  3EQL C;  1F9Q A;  4RG1 A;  1XJV A;  1JMC A;  5D3I B;  2CCZ A;  1IXR A;  3BYY B;  1BKB A;  5LL6 S;  2WIN B;  1QVF A;  4JV5 Q;  4DUZ L;  1EQV A;  2K5V A;  3CQZ H;  3I72 A;  4HTH A;  5EPJ A;  2YV5 A;  1VF5 C;  1HTL D;  4IUU A;  5M5X H;  3KDF B;  4DNT B;  1SLJ A;  2Q8I B;  1V8Q A;  1R4Q B;  1K73 C;  4LF4 Q;  4KY5 A;  4BBS B;  5IT9 c;  2HHH Q;  4ULL A;  5IOC A;  2K6A A;  1B53 A;  4K5X A;  4HCE A;  3CHB D;  3GTO H;  3HKS A;  5BN5 A;  1Y1W B;  3I4M H;  1U4R A;  3QR8 A;  2YSA A;  2E74 C;  3DM1 A;  3PIP A;  1TWC H;  1LTG D;  2AKW B;  1JCK B;  5IE8 A;  5M3M H;  4CDF C;  3J7Z C;  1ILP A;  4JI8 Q;  1Y1V B;  2EPB A;  2ATW A;  4E6I A;  2F0U A;  1VMP A;  2L55 A;  1FL0 A;  4RGM A;  2EQS A;  5ELD A;  1MGS A;  2HDM A;  4DR5 Q;  5E4X A;  4MHE A;  3T1Y L;  1UAP A;  1BO0 A;  3AFP A;  3C3L A;  4LF5 L;  4DU9 A;  2DJF C;  3KYH C;  1YNJ D;  3MVV A;  2R7Z H;  3NE5 B;  3FEW X;  1SE3 A;  2F0L A;  5M5Y B;  2EY6 A;  1F6U A;  1EYA A;  2F52 A;  2KCM A;  4JYA Q;  4A93 B;  1XXG A;  2A19 A;  3KJP A;  3M3Y B;  2FFK B;  4Q5V A;  3HOY B;  4K5V A;  4TKO B;  5C6A A;  1T9H A;  3PO3 B;  4JI6 Q;  2LSS A;  4PZ6 A;  2I07 B;  3TME A;  4XQN A;  1KIX A;  1YJN A;  1GOZ A;  1XPU A;  2JA9 A;  4DR3 Q;  1VQ9 A;  2ICE C;  1Y1V H;  1SNP A;  4LW1 A;  1C9O A;  3PMF A;  2IX0 A;  4K0K Q;  2B2U C;  1H9K A;  4JI4 Q;  3URY A;  2L9H A;  5IP9 G;  5GAH C;  2K5H A;  4OWT B;  4HJA A;  4IUR A;  4C3H H;  4PMW A;  3P20 A;  5IGB A;  1WWF A;  3T1H L;  2B2W A;  2Z0S A;  1AFP A;  1QUQ A;  1XMO Q;  2JEA I;  3H3V C;  1ENC A;  4JI3 Q;  3NQI A;  1I94 Q;  1Q12 A;  4R4C A;  1JOK A;  5ELE A;  4A93 H;  1NUC A;  2WV6 D;  3CCL A;  3M3Y H;  1WD0 A;  1BQQ T;  1PZJ D;  2ZXP A;  3HOY H;  5FJ8 H;  4K8I A;  3HP3 A;  2NVQ B;  3PO3 H;  3I4N B;  3A55 A;  2XTI A;  4NPS A;  1AP0 A;  3I70 A;  2JXM B;  5KND A;  3DUZ A;  4UY8 C;  1TWG B;  4XXE A;  4DUZ Q;  1XTD A;  4A3J B;  3S14 B;  3K80 C;  4HSP A;  3PIP 3;  1LTB D;  1AZQ A;  2BH8 A;  3E9H A;  1OTC A;  3NWS A;  2Q2U A;  1YJ9 A;  1TWA B;  4GN4 B;  1YNX A;  1QB5 D;  4DR1 L;  1RCV D;  4LUZ A;  1NNX A;  2Z6K A;  4ME3 A;  3IRB A;  1S5D D;  2K32 A;  2L5T A;  2TMP A;  3NBH A;  4JI1 L;  3M7G A;  3OW7 A;  3K58 A;  3I4O A;  5C44 B;  1GUO A;  4EQ5 A;  3HOU G;  1SXT A;  2IY5 B;  4IOC A;  2EYF A;  2A68 C;  3DEP A;  4QF4 A;  4AYB E;  2KCC A;  4IFD G;  4B3M L;  1HH2 P;  2ZJP A;  4R8I A;  1EFW A;  4DV2 Q;  2A74 C;  5K5P A;  2IHE A;  4RKB A;  2NVQ H;  3W1G A;  2RF4 A;  4DXG A;  4DV1 Q;  4GNX A;  3L9A X;  5M3F B;  4HR7 B;  3SEB A;  1SJH D;  1HTP A;  3AMU A;  4DGZ A;  5G3L F;  1YBY A;  1TWG H;  4DR7 Q;  1ONL A;  3MXG A;  1DD2 A;  4ZLT F;  3T1Y Q;  4A3J H;  1X9N A;  3S14 H;  4KKT A;  5KGU A;  2B2Y A;  5I6Y A;  1X3G A;  4APV A;  4LF5 Q;  1CA6 A;  1MSG A;  3KLW A;  5CV7 A;  4HJ5 A;  1STE A;  1LT6 D;  3AEV A;  4OWW B;  1VQD A;  1TWA H;  1BBX C;  1M1K C;  2JA7 G;  2UXB L;  2EJM A;  2EDG A;  2JA5 G;  4LF8 L;  2KEN A;  4KHZ A;  1B3Q A;  4DUY Q;  4CJ1 B;  5C44 H;  3SR1 A;  1I4R A;  1ZKO A;  1PDQ A;  4A76 A;  1F9P A;  1WTP A;  2G9D A;  4NMZ A;  2KHI A;  2B2T A;  4DV6 L;  4A3G H;  3H94 A;  3TN2 A;  3FPU B;  1IBL L;  4EX5 A;  2EYO A;  2WB1 E;  1KNE A;  1K8G A;  3MFY A;  1PH3 A;  3SDZ A;  3FKI B;  4KN4 C;  1FNW A;  1E24 A;  4XT1 B;  2N55 A;  4RCO A;  3G4S A;  4BY7 H;  4NP5 A;  1T5X D;  2R6G A;  3PGZ A;  3T4A C;  3T1H Q;  3S15 B;  2PPB C;  1PH9 A;  1SFO B;  1LAC A;  2KUM A;  2JP1 A;  5JJZ A;  2B63 G;  1X3Q A;  2D62 A;  2AWO A;  3HZX A;  4DV7 L;  5TSS A;  4IN3 A;  1O7I A;  4DR4 L;  3K57 A;  1GHJ A;  3R2T A;  4KHV A;  4PZ7 A;  5HUR A;  2N49 A;  1JOO A;  2K33 A;  1C8C A;  3CCE A;  1G8Z D;  4JVZ A;  3G6E A;  1S5E D;  1QZG A;  1E22 A;  1EY5 A;  4H44 C;  1XMQ Q;  2MFI A;  4P74 A;  3MZ5 A;  4X6A H;  1SNO A;  1YEZ A;  3GTQ B;  4FYD A;  1HFG A;  1V43 A;  3H6M A;  1CZG A;  1KDA A;  1UEB A;  2WFW A;  3H15 A;  4I65 A;  1B50 A;  4BBR G;  1IYU A;  2PO4 A;  4JK1 C;  2IHX A;  3D4W A;  3G71 A;  1RD9 D;  2ALY B;  2OXP A;  3NWT A;  1UE7 A;  2F0P A;  2QIL A;  4YWM A;  1K3B C;  3BZD B;  4FF3 A;  2HCI A;  3D6W A;  3SK8 A;  4HMI A;  1I4X A;  1UEA B;  4KKS A;  1TS4 A;  4DV3 L;  4B3M Q;  1VQE A;  4P73 A;  5KYI A;  4B08 A;  2C5C A;  3SK4 A;  2JYO A;  1H9S B;  1OXX K;  3CPF A; 
#chains in the Genus database with same CATH homology
 2BA0 A;  4GOP A;  4YWK A;  1XNR Q;  5IP7 G;  3UE1 A;  4DR2 L;  3PUZ A;  1YHQ A;  3HKZ E;  1NBW A;  1X55 A;  3ULL A;  4NB3 A;  1Q82 C;  1EIY B;  1C0A A;  3S2H H;  2VS1 A;  3GTQ H;  4P72 A;  2F4V L;  4IPD A;  1U5K A;  5C4X G;  5C3E H;  4JBJ A;  1L1O B;  4A93 G;  2E8G A;  4X65 L;  4KHP Q;  3CC4 A;  1Z9F A;  1VQH A;  3ULP A;  1IBM Q;  4LFA L;  3HOY G;  4JOI A;  5ELN A;  5C4J H;  2YU9 H;  5FJ8 G;  1KXL A;  4OON A;  2VQF L;  1VS0 A;  4MNO A;  1W2B A;  1Q8K A;  3A5Z B;  3S1R H;  4GKJ L;  4AH6 A;  3PO3 G;  3PV0 A;  2YYZ A;  1YJW A;  2OTL A;  4PG3 A;  1EOV A;  1PYS B;  1CKN B;  5AJ3 Q;  1I50 H;  2UUA L;  3FKI G;  1S40 A;  4LF6 Q;  4IJH A;  3HOZ H;  1WCM G;  2ZTC A;  2BH2 A;  4A3L H;  1LYL A;  1G51 A;  5IWA Q;  5HGQ A;  5C0X G;  1SRU A;  1U0L A;  1J5E Q;  1ASZ A;  4BXX H;  2H5X A;  1Y14 B;  2VY3 A;  4DK3 C;  5IP9 H;  4DV6 Q;  3RN2 A;  2NVX H;  1JJ2 A;  4LF4 L;  2JA8 G;  2Q2H A;  3ICE A;  1Z47 A;  5ELO A;  1YZ6 A;  2R93 G;  2M3Z A;  2PNH A;  4DV2 L;  2K52 A;  1JJC B;  1CUK A;  3UDI A;  1N36 Q;  1OXT A;  3ERS X;  4AIM A;  3GTG H;  4JG2 A;  1OXS C;  3PSI A;  3RR5 A;  3U58 A;  3GTK H;  4DV1 L;  3CME A;  4BY1 H;  2L15 A;  2R7F A;  2OCE A;  3CP0 A;  5FLM G;  3K7A H;  3F2B A;  4A3B H;  3S1Q H;  4OO1 I;  1QUQ B;  2EXD A;  5GAE C;  1KRS A;  1Q1B A;  1JT8 A;  3AQQ A;  1A6B B;  4IO9 A;  3TEH B;  2N8N A;  3BZK A;  2I5M X;  3RNU A;  1PHJ A;  3HOW H;  3K8A A;  4IFD J;  3KDF A;  2Z6K C;  4DV0 L;  4DR7 L;  3STB C;  2UUB Q;  1IZ6 A;  3K81 C;  1NMF A;  2VZA A;  4OWX B;  3HOX G;  3J80 i;  3HOV G;  2Q2I A;  4JI5 Q;  2GVB A;  2K5N A;  3E0E A;  4A3E H;  2NZO A;  3ZJY C;  2IHF A;  4IPC A;  3DLL A;  5LMN W;  3CC7 A;  3CXC A;  4FDB A;  2IX1 A;  4P71 A;  4X66 L;  4O2D A;  4DR5 L;  2E2H H;  4BBS H;  3TQY A;  4NXM L;  4POG A;  2NVY H;  2FXQ A;  2WP8 J;  1N8R C;  2AHO B;  5EAY A;  5M5W H;  1HNZ L;  5JJK A;  1IYJ B;  1MKH A;  4LWC A;  2MO1 A;  4X62 L;  4X64 Q;  2MQH A;  2VQE L;  4DUY L;  1Y1W H;  2UXD Q;  2YTV A;  3CCV A;  4GNX C;  1WWG A;  4A3C G;  1CSP A;  1X56 A;  1X54 A;  4QY7 A;  4NXN Q;  2A8V A;  3L2P A;  4A3J G;  1I5F A;  3J81 j;  3JAM c;  1OXU A;  2NVT H;  1Q46 A;  1NMG A;  3I7F A;  3PUX A;  5LMN Q;  4A3K G;  4B3R L;  1VQL A;  1VQI A;  3RN5 A;  2UUC Q;  1FJG L;  1HR0 W;  4LF9 L;  2K4K A;  4DV5 Q;  2UXC Q;  1X65 A;  3M9B A;  4B3S L;  5JEA G;  3KF6 B;  4YY3 Q;  1YIT A;  5HY6 A;  1VQA A;  2AWN A;  1TWH H;  3MXN B;  3NBH B;  1Q3Z A;  3GTL H;  5IP7 H;  3HOU H;  2N3S A;  1B8A A;  5BR8 L;  5K36 G;  1G6P A;  3CPW A;  5C44 G;  4JI0 Q;  1SMX A;  1UE1 A;  4A3M G;  3A5U A;  2WAQ E;  4A75 A;  1J6Q A;  4HJ7 A;  2UU9 Q;  3KF8 B;  4XIG S;  3J81 c;  1VQG A;  1WFQ A;  4A3F G;  1E1O A;  4JI4 L;  1AE2 A;  1BBU A;  2DGY A;  3I2Z A;  4LUV A;  3UDG A;  1KC8 C;  4A3G G;  4LFB Q;  2OTJ A;  1L1O C;  5M5Y H;  1EQR A;  3LGJ A;  4DV3 Q;  4DR1 Q;  4DK6 C;  3MEF A;  2BA1 A;  1HNX L;  3PIO A;  4YCU A;  3NEM A;  2R7D A;  3RZD H;  1WWE A;  4JI1 Q;  1YHA A;  1PH2 A;  4JI2 Q;  5IYB G;  4QJF A;  2E2I H;  1VQK A;  4IJL A;  3CF5 A;  5GAD C;  1PV4 A;  2VW9 A;  1GM5 A;  2IT1 A;  4LF7 Q;  1UE5 A;  1YVC A;  1EIF A;  4KI0 A;  4UP8 A;  4DR2 Q;  2ID0 A;  4R4T A;  4A4I A;  3OW2 A;  1R9T H;  3GTJ H;  4LFC Q;  1XMQ L;  3CCS A;  2JA6 H;  3TRZ A;  2QGQ A;  4YHH Q;  4JC0 A;  2K50 A;  3PO2 H;  1LTL A;  3CW2 C;  1GD7 A;  3L7Z C;  3M4Q A;  4P75 A;  1KQS A;  2JA7 H;  1HZC A;  2NZH A;  4HJ9 A;  2JEB I;  3GDE A;  2JA5 H;  3F2C A;  4TQU S;  1VQJ A;  2ZTD A;  2GVA A;  4RG1 A;  1WOC A;  2Y0S G;  1A62 A;  4ALP A;  1XJV A;  4JBM A;  1JMC A;  2CCZ A;  4DV4 Q;  4A3I G;  4UP9 A;  1WYD A;  1IXR A;  2PQA A;  2VQF Q;  3H0G G;  4MTN A;  1BKB A;  1JJG A;  2JZW A;  1QVF A;  4JV5 Q;  3BU2 A;  1YHB A;  1KAW A;  1TXY A;  3PUW A;  5FLM H;  4DUZ L;  1XPR A;  3NEL A;  1PH6 A;  1N9W A;  3U4Z A;  2K5V A;  3Q8D A;  1JB7 A;  4LUO A;  3CQZ H;  3W1B A;  5IYD H;  4DNI A;  2YV5 A;  1HNW L;  2UXB Q;  3GTP H;  4OXP A;  5M5X H;  3ULJ A;  3KDF B;  3OYY A;  4DR6 L;  1SLJ A;  2AMC B;  4LF8 Q;  4LF4 Q;  1K73 C;  3OTO L;  1VQC A;  5IT9 c;  2HHH Q;  4GKK Q;  3CCU A;  5JJL A;  3TS2 A;  2MO0 A;  1HZB A;  3GTO H;  3HKS A;  4B3T L;  4AQY L;  1RIP A;  3I4M H;  3KJO A;  4QIW E;  2E5L L;  2YSA A;  3PIP A;  3I4N H;  1TWC H;  1PH4 A;  3BZC A;  2Y0S E;  3UDX A;  2B63 H;  2AKW B;  1I3Q H;  5IE8 A;  2L4L A;  5M3M H;  1I6H H;  3J7Z C;  3CCM A;  4JI8 Q;  1IBL Q;  4A3D G;  4B3T Q;  2ATW A;  4WJ4 A;  3RZO H;  3L0O A;  1VQM A;  3VDY A;  1VQ4 A;  2ZJR A;  3UDF A;  3DM3 A;  1FL0 A;  1N32 Q;  1IBK L;  1IBM L;  1HZ9 A;  1C7Y A;  3H3V H;  2VL6 A;  2EQS A;  4GLA C;  4JI7 Q;  1WJJ A;  4R4O A;  4DR5 Q;  2ZJQ A;  4LNQ A;  3T1Y L;  5GQO A;  3AFP A;  1P8L A;  3RLF A;  4LF5 L;  3S1M H;  2C35 B;  2VQE Q;  3KYH C;  1N33 L;  1DGS A;  4DV7 Q;  3KFU A;  5AJ3 L;  4GOP C;  2R7Z H;  5GRO A;  1NTG A;  4HID A;  4DR4 Q;  2VUM H;  2XGT A;  3I56 A;  2WAQ G;  2KCM A;  2F52 A;  4JYA Q;  1F6U A;  3FP9 A;  5IWA L;  4UPA A;  3W5O A;  2A19 A;  4BBR H;  5C3E G;  2Q2T A;  1W3S A;  3KJP A;  1J5E L;  5IYC H;  2JK8 A;  1K9M C;  1EWI A;  2NN6 I;  1FJG Q;  1XNQ Q;  3S2D H;  1WWD A;  3H3V I;  5M3F H;  4B3S Q;  1N36 L;  1T9H A;  2LXK A;  3S24 A;  2HT1 A;  4L5R C;  4JI6 Q;  1CKN A;  1EYG A;  2LSS A;  1A1T A;  4PZ6 A;  1KIX A;  1PVO A;  1YJN A;  4JOI C;  1XPU A;  2CWA A;  2JA9 A;  3M85 A;  4DR3 Q;  1PH7 A;  1VQ9 A;  1PFS A;  1Y1V H;  4LW1 A;  4BA1 I;  1C9O A;  4C2M H;  2IX0 A;  4K0K Q;  2R92 H;  4A3L G;  2UUB L;  1VQP A;  1VQ8 A;  4L5T A;  4JI4 Q;  4BXX G;  1ESK A;  1V9P A;  5IP9 G;  4JI5 L;  1LUZ A;  2K5H A;  5GAH C;  1D8L A;  4OWT B;  4HJA A;  1VQF A;  4C3H H;  2F3I A;  3A74 A;  3E9I A;  1M90 C;  4GS3 A;  4PMW A;  3TRE A;  1WWF A;  3T1H L;  3S1N H;  4GOP B;  1AAF A;  4YCW A;  1D7Q A;  1SE8 A;  1BVS A;  2Z0S A;  1A0I A;  1S3O A;  1QUQ A;  1XMO Q;  2JEA I;  3F8T A;  4BY1 G;  1AH9 A;  4QL5 A;  2CQO A;  4HIM A;  4A3B G;  4JI3 Q;  1X3F A;  1I94 Q;  1Q12 A;  4R4C A;  5C4X H;  4GLX A;  2PQA B;  1HR0 Q;  1VQ6 A;  3HOW G;  3S17 H;  4A93 H;  1VQB A;  4IOA A;  1BJ6 A;  4NXN L;  3CCL A;  4KLK A;  1E7Z A;  2LI8 A;  3M3Y H;  3PF5 A;  4YWL A;  5LMU Q;  3HOY H;  4A3E G;  2A1A A;  5FJ8 H;  1HZA A;  4BY7 G;  2PMZ E;  3NYB B;  5LMN L;  3U50 C;  4AYB G;  2UUC L;  3PO3 H;  1PH1 A;  3AFQ A;  4DV5 L;  1GVP A;  2UXC L;  4NPS A;  2XTI A;  4BBS G;  3FKI H;  2K14 A;  4YY3 L;  3FHW A;  1WCM H;  3JAM i;  2F4V Q;  4J15 A;  4O0A A;  2OQ0 A;  3S15 H;  4UY8 C;  1Y1W G;  1E1T A;  1XTD A;  4DUZ Q;  3K80 C;  4X65 Q;  1SFO H;  5E7N A;  1P16 A;  2JA8 H;  3RLO A;  1B7Y B;  1N34 L;  4HJ8 A;  2UU9 L;  2CKZ B;  2R93 H;  2BH8 A;  3E9H A;  4LFA Q;  3CAM A;  3JC6 6;  1OTC A;  2Q2U A;  2ZM6 L;  4LFB L;  1HNW Q;  3F1Z A;  1MJC A;  1YJ9 A;  1MJE A;  4GN4 B;  3BJU A;  1YNX A;  4XTC S;  4DR1 L;  4DR6 Q;  4GKJ Q;  4LUZ A;  1UE6 A;  2Z6K A;  4ME3 A;  1U6P A;  3IRB A;  1QVG A;  4DAY B;  4C3I H;  2MNA A;  2UUA Q;  1YI2 A;  4YCV A;  5DLQ E;  4JI1 L;  1RL2 A;  3F2D A;  1VQ7 A;  3J81 i;  4AQY Q;  4OX9 L;  4DKA C;  3I4O A;  2QEX A;  2E5L Q;  4EQ5 A;  3PUV A;  2ASB A;  1A8V A;  4LF7 L;  3HOU G;  4IOC A;  2IY5 B;  4AYB E;  3HOX H;  2HIV A;  3K0X A;  4HIO A;  1PA6 A;  4B3M L;  3HOV H;  4IFD G;  2I5H A;  3CMA A;  1HH2 P;  5C0X I;  1PH5 A;  4LFC L;  2ZJP A;  1A63 A;  3I55 A;  1EFW A;  3CCQ A;  3SGI A;  5FLX c;  4DV2 Q;  4YHH L;  2EXF A;  1AE3 A;  1HJP A;  2IHE A;  3CCJ A;  2CWP A;  3A0J A;  3J80 c;  2NVQ H;  1XNR L;  4L5S A;  3W1G A;  2RF4 A;  4DV1 Q;  4GNX A;  1L2F A;  3PUY A;  4RMF A;  3CCR A;  1K83 H;  1PH8 A;  1IBK Q;  1ASY A;  4BA2 I;  1NJI C;  1K0R A;  4UP7 A;  1KHI A;  3GTM H;  3EBE A;  1YBY A;  4DV4 L;  1TWG H;  4DV0 Q;  4DR7 Q;  4A3C H;  1Q81 C;  3T1Y Q;  4A3J H;  1VQN A;  4R4I A;  2N78 A;  1X9N A;  3S14 H;  2WB1 G;  2DUD A;  1X3G A;  4APV A;  4LF5 Q;  1MIU A;  4JV5 L;  4Y52 H;  1JE5 A;  1N33 Q;  1SR3 A;  3UE0 A;  1X6O A;  2JA6 G;  2CFM A;  3KLW A;  4KHP L;  1H95 A;  4HJ5 A;  4A3K H;  5GAG C;  1CSQ A;  4PZ8 A;  3M7N A;  3AEV A;  4OWW B;  1VQD A;  3K7U C;  1TWA H;  2EIF A;  1M1K C;  2LXJ A;  4X66 Q;  3PO2 G;  4POF A;  2JA7 G;  2UXB L;  4NXM Q;  4JBW A;  2JA5 G;  1E3P A;  2PI2 E;  4LF8 L;  1HNZ Q;  2KEN A;  4KHZ A;  3RLN A;  2B29 A;  2RHQ B;  2HHH L;  4X62 Q;  4GKK L;  4DUY Q;  3GD7 A;  4LF6 L;  5C44 H;  4A3M H;  1L1O A;  2JE6 I;  3G48 A;  4A76 A;  1FVI A;  4A3F H;  3CC2 A;  2KHI A;  5IY0 A;  4DV6 L;  4JBK A;  4A3G H;  2OQK A;  2VNU D;  3GO5 A;  5JJI A;  1Q86 C;  4B3R Q;  3D0F A;  5IYD G;  1WI5 A;  3TS0 A;  1S72 A;  1QZH A;  4LF9 Q;  1MFS A;  4JI8 L;  1IBL L;  2KCT A;  4EX5 A;  4HIK A;  2WB1 E;  2QA4 A;  1NY4 A;  5IYB H;  1BBW A;  4OO1 G;  4Y7N H;  1K8G A;  1SN8 A;  4H02 A;  1Q3Y A;  3EN2 A;  2I5L X;  1PH3 A;  1B70 B;  1E24 A;  5BR8 Q;  4BY7 H;  3G4S A;  1N32 L;  2R6G A;  3PGZ A;  3T1H Q;  3HOZ G;  5C0X J;  4JI7 L;  1PYB A;  1EUJ A;  4MZ9 A;  1CKM A;  3I4M G;  4QQB X;  1PH9 A;  1QVC A;  3I4N G;  3HFZ B;  1IL2 A;  1FGU A;  2B63 G;  2D62 A;  4R1J A;  2AWO A;  4DV7 L;  1TWF H;  4DAM A;  2JJQ A;  5M3M G;  1O7I A;  1Q1E A;  1HNX Q;  2I0Q A;  4TVA B;  4DR4 L;  3U4V A;  4PZ7 A;  1SRO A;  2YTX A;  1LM0 A;  2N49 A;  1UWV A;  2HQL A;  2D0O A;  4GLV B;  4JYA L;  1XPO A;  1VCI A;  4IPH A;  4A3I H;  3NEN A;  3CCE A;  3WWV A;  4JCV E;  2NN6 G;  3H0G H;  2OWO A;  3G6E A;  2UXD L;  4X64 L;  1GKH A;  1Q7Y C;  1QZG A;  3PCO B;  1XNQ L;  1G29 1;  3B6Y A;  1E22 A;  4GN5 A;  1NE3 A;  3STB D;  4DPG A;  2PI2 A;  1VQ5 A;  1XMQ Q;  3AYH B;  2MFI A;  1KRT A;  4P74 A;  3S16 H;  4X6A H;  2K75 A;  4JI6 L;  3M4P A;  5J3B A;  1KL9 A;  1YEZ A;  4IPG A;  1CKO A;  1EQQ A;  2R7Z G;  4DR3 L;  1X3E A;  1V43 A;  2KHJ A;  2VUM G;  2ZTE A;  4C3J H;  2RHS B;  3HKZ G;  3CD6 A;  1UEB A;  2WFW A;  1N34 Q;  1KD1 C;  3M4O H;  3H15 A;  4K0K L;  3D31 A;  4WJ3 M;  4BBR G;  2GN5 A;  4GN3 B;  5IYC G;  2ZM6 Q;  2IHX A;  3G71 A;  2ALY B;  1YIJ A;  5H1S E;  1GO3 E;  1K8A C;  3PF4 A;  1UE7 A;  4JI0 L;  3EIV A;  5M3F G;  4YWM A;  4GNX B;  2EC7 A;  3J7A 5;  4QGU A;  3KOJ A;  4L5Q A;  1XMO L;  4OX9 Q;  2B3G A;  2CQF A;  2RCN A;  1OXV A;  4JI3 L;  2YTY A;  4A3D H;  1I94 L;  3ER0 A;  2JQO A;  2V1C C;  1Y1V G;  5JEA J;  4DV3 L;  2ES2 A;  1VQO A;  1HR0 L;  1VQE A;  2KBN A;  1L0W A;  1V1Q A;  3KF6 A;  4P73 A;  3OTO Q;  4B3M Q;  2R92 G;  4IFD I;  2D0P A;  1K3R A;  4R4Q A;  2E2J H;  4JI2 L;  5LMU L;  1OXX K;  2HIX A;  3CPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...