3TS2A

Mouse lin28a in complex with let-7g microrna pre-element
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
135
structure length
135
Chain Sequence
b'QLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSINHMVASCPLKAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein lin-28 homolog A
publication title Molecular Basis for Interaction of let-7 MicroRNAs with Lin28.
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein/rna
total genus 27
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00098 zf-CCHC Zinc knuckle
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3ts2A01
4.10.60.10 Few Secondary Structures Irregular HIV-1 Nucleocapsid Protein Zinc finger, CCHC-type 3ts2A02
1KD1C 3K80C 4PZ8A 4R4QA 5M3MG 4B3SQ 2KCTA 3FP9A 1SFOH 4LF8Q 1M90C 1KRSA 2JEAI 3GTPH 2IT1A 1D7QA 1KIXA 1R9TH 4MTNA 1FVIA 1N34L 2R7FA 1PYSB 4P72A 3K8AA 5GAGC 4HIMA 4GLXA 3U50C 3S1MH 4BBSG 4JI1Q 4JOIA 1XMOQ 5LMNL 4B3MQ 4BY1H 3GTMH 1XPRA 1K83H 3U4ZA 3OTOL 4X65L 2ZTEA 2IX0A 4YY3Q 4X64Q 3KJOA 5C3EG 2HQLA 2D0PA 2Z6KA 3HKSA 2UXBL 3PCOB 1VQAA 1AAFA 3M3YH 3A5ZB 2JA5H 2BH2A 3PGZA 1A8VA 4UPAA 4LF4Q 3UDIA 1KXLA 1MIUA 1G51A 4DV3Q 5IYBG 4A3KG 1LUZA 1UEBA 2YU9H 1I50H 4DK3C 3F2BA 4GN4B 4P73A 1WOCA 1GKHA 2N49A 1EFWA 1EIFA 4R4OA 1VQ8A 3S17H 4LF7Q 3CCUA 4LFAQ 1HNWQ 1I3QH 1TWHH 3L2PA 1PV4A 5M5XH 4PZ6A 1HNXL 5M5WH 1HNZL 2HHHL 1N33L 3U4VA 1GD7A 4DV7L 4IFDJ 1BJ6A 4X66L 1CUKA 1VCIA 2NZOA 1IBML 3S2DH 3PV0A 3H0GH 4LUVA 2WB1E 3DM3A 4X62L 1C9OA 4NPSA 1MKHA 3CCEA 2Q2TA 4QGUA 4DR6Q 1G6PA 1WWDA 2GVAA 2RHQB 3RLFA 1YJ9A 3KFUA 5EAYA 1EQQA 4JI0Q 4JI5L 4UP8A 3M4OH 4LUOA 4BY7G 1IYJB 1CKNB 2E2JH 2YSAA 1CKNA 1VQHA 3OYYA 4QL5A 3CPFA 1VQPA 1B70B 1UE7A 4IOCA 4DR5Q 3S15H 2QGQA 1E22A 2KHJA 4DAMA 2NVXH 1A0IA 4A3DG 1A63A 3K7UC 3CMAA 2E2IH 3AFPA 3M4QA 3B6YA 2R92H 4MZ9A 4A3IH 1Q3ZA 3MXNB 1TWFH 4JI3Q 3W1GA 5FLMH 2CWPA 3A5UA 2GVBA 4UY8C 3CF5A 4DUZQ 1C0AA 5IYCH 2A1AA 3DLLA 1SE8A 2XTIA 4O2DA 1X56A 4RMFA 1YEZA 2JJQA 2JA6H 4K0KL 1IBKQ 2NVYH 3TREA 1SRUA 3G6EA 1BKBA 2CCZA 4HJ8A 3CC2A 4Y7NH 2K5NA 2HIXA 3PIOA 4DV2L 3VDYA 1JMCA 4A3FG 3RN2A 1Q12A 1Q7YC 4OX9L 1FJGL 2EXFA 2Q2IA 5IYDH 4DV5Q 2MNAA 4GNXC 3T1YQ 1PH6A 3MEFA 1D8LA 3S1RH 4NXNL 3I55A 1QVFA 4JBMA 3I4MH 3J7ZC 5ELNA 4A76A 1N8RC 2JA9A 4KLKA 5FLXc 3G48A 4IFDI 1NMFA 1SLJA 2RF4A 1PFSA 5IP7G 3OW2A 4A3MH 1YBYA 4A3GG 2N8NA 1W3SA 3HOVH 3RNUA 2WAQE 3T1HQ 1O7IA 2JA7G 4C3HH 5M5YH 4HIOA 1EQRA 1MJCA 4LF5L 1N34Q 1Y1WH 1XTDA 4DR7L 1OTCA 3BU2A 1PH1A 2ZM6L 1Z9FA 3D0FA 1Z47A 1FL0A 2YV5A 3PF5A 3HOZG 5LMNQ 3ER0A 1I94L 3A0JA 2ZJQA 5JEAG 3ERSX 3OTOQ 4X65Q 1XMQL 1YZ6A 2JE6I 3A74A 1L2FA 3HOUH 2I5HA 4JI2L 2UXBQ 2AWNA 3J7A5 1CSQA 1PH3A 1S72A 3NEMA 4JG2A 1ASYA 4DR4L 1FGUA 2C35B 3KF6A 3H3VI 4WJ4A 2E8GA 1XPUA 1K8GA 3CD6A 3UE1A 3HOWG 3FHWA 2UUAL 4JI4L 1CKMA 3PUXA 4HIDA 2CKZB 4DV4L 4L5QA 3LGJA 1U5KA 4YWLA 3GO5A 1KQSA 2JZWA 2FXQA 2HHHQ 1RIPA 3RLNA 2OTLA 3J81i 4DV7Q 3GTLH 3AYHB 1L1OB 3J80i 4BA1I 4X66Q 4POFA 3RN5A 1PH2A 1IBMQ 2JA8H 4LFBL 5C4XG 1JJGA 1YVCA 2ZJRA 1EYGA 3NBHB 4X62Q 4QIWE 4IPDA 1KRTA 1PVOA 4IOAA 5M3FH 2BH8A 4BBRG 4JI5Q 1YNXA 4IPCA 4LNQA 4YWMA 2OQ0A 1Y14B 2EQSA 4KI0A 4YCVA 5H1SE 2F4VL 3ZJYC 4HJ7A 4YWKA 4KHPL 3GTOH 1Y1VG 2JK8A 3H0GG 3G71A 1TXYA 1QZGA 1K8AC 3RZOH 1M1KC 1K3RA 2UU9L 1N32Q 2WFWA 2R93H 4GLVB 3K7AH 1V1QA 5DLQE 5J3BA 4P75A 4OONA 1XPOA 1U6PA 2E5LQ 1F6UA 1Q1BA 1Q46A 3S24A 3HFZB 4JI6L 2A19A 4JV5L 4LWCA 1NY4A 4B3TL 1XNQL 3L0OA 2Y0SE 4XTCS 4LF9Q 4K0KQ 4QJFA 3CC7A 4HJAA 4DV0L 2WB1G 2R92G 2XGTA 4A3IG 4LF6L 4DV2Q 4JI8L 2ES2A 3E0EA 5FLMG 4DR1L 1PH4A 3Q8DA 2PI2A 4OX9Q 4L5TA 3CPWA 1FJGQ 2R7DA 5IYCG 1VQKA 1EWIA 4NXML 5JJIA 1WWFA 1SROA 3HOXH 3L7ZC 1IXRA 1HR0W 3S14H 4NXNQ 4MNOA 1JT8A 2UUCL 1YIJA 1B7YB 1SR3A 2IHFA 2AHOB 3W1BA 2JA6G 3CCRA 2RCNA 1WJJA 4DR3L 2Q2HA 2I5LX 3F2DA 1VQFA 4YHHL 4DR2L 1H95A 4IFDG 2RHSB 5IE8A 4LF5Q 3EN2A 4DR7Q 4A3CH 2HIVA 4DV6L 1K73C 2DGYA 2ZM6Q 2NN6I 2B29A 1BBUA 3AQQA 3M4PA 5IYDG 3CCQA 4GOPA 4GOPB 4A4IA 4DKAC 3GDEA 2QEXA 4A3JH 3F2CA 4JYAL 3I4NG 4A93G 1JJCB 5M3MH 1I94Q 2F52A 2N78A 3STBC 5JJKA 4P74A 1X3GA 2KCMA 1HR0L 1WCMH 4A3MG 3CXCA 2IHXA 1AE2A 4O0AA 4JI2Q 2AWOA 4IO9A 1IBLL 5E7NA 3K0XA 4DAYB 4A3EG 4DR4Q 2R7ZG 1IL2A 4BBSH 4LFCQ 1VQJA 1N9WA 1VQBA 3KDFB 3KDFA 2NVTH 2N3SA 1JE5A 4Y52H 1ASZA 1YJNA 2VQEL 4JI4Q 1V9PA 4B3SL 3J81c 4LF8L 2VL6A 3AFQA 3J80c 1IZ6A 3PF4A 2MO0A 1E1OA 1PYBA 1VQGA 2LXJA 4JC0A 1Q82C 3HOUG 2L4LA 3PUVA 2VQFL 3U58A 2CFMA 3ULPA 3KJPA 5IYBH 4GN5A 4A3KH 1NMGA 4OWXB 2YTYA 3HKZE 4LFBQ 2JQOA 1XMOL 1E24A 4YCUA 2K50A 2D0OA 4AIMA 3J81j 3CCSA 4JCVE 5JJLA 2OCEA 3E9HA 2AMCB 3EIVA 1TWCH 4DNIA 1PHJA 4ALPA 4LF4L 1XNRL 2F4VQ 2BA1A 3HOYG 3S1NH 1EUJA 1YITA 2UUBL 2OWOA 2JA8G 4KHPQ 2ZTCA 4GNXA 2VW9A 2PQAB 3I4OA 4IJHA 2PQAA 1YJWA 2M3ZA 2K5VA 3K81C 4BY7H 1OXVA 4HIKA 2UU9Q 4LF7L 2K14A 1YHBA 4HJ9A 3GTKH 2Z0SA 1AE3A 5M3FG 4A3BG 1K0RA 2GN5A 4TQUS 3PIPA 1VQ5A 4GKKL 5GQOA 3KOJA 5BR8L 4XIGS 2R6GA 1J5EL 1HZAA 1E7ZA 4EQ5A 4JI6Q 3FKIH 2L15A 5LMUL 3S16H 4JV5Q 3IRBA 2VUMH 3KF6B 1KAWA 1XJVA 4B3TQ 4DR6L 1NE3A 1TWGH 3SGIA 1Q8KA 5JEAJ 1P8LA 1YI2A 2NVQH 2QA4A 4OXPA 4DPGA 4DV0Q 4B3RL 4BY1G 1C7YA 4LF6Q 1LTLA 3M7NA 4JI8Q 1JB7A 1Q1EA 1KL9A 4DR1Q 1V43A 1YHAA 4BXXG 2B63H 2ID0A 1J6QA 1CSPA 1HNZQ 1HNXQ 4NXMQ 1TWAH 2JA5G 1NTGA 1N33Q 1UE6A 4DK6C 5IP9H 1L0WA 5ELOA 2UUCQ 5C44H 1MJEA 5C0XJ 1Q3YA 2MO1A 1VQDA 3BZKA 1VQ9A 1S40A 4JI3L 4A3FH 1A1TA 4DR3Q 3W5OA 1QUQA 2CWAA 4YHHQ 4DUZL 4DR2Q 1L1OC 2VZAA 1QZHA 3M85A 5IY0A 1PH8A 4JI7L 1WWEA 3PO3H 1WI5A 4DV6Q 2ALYB 3PO3G 2UXCQ 3JAMi 2UXDL 4JYAQ 3HOXG 1VQMA 1S3OA 1IBKL 4EX5A 2EXDA 1PH9A 4A3GH 2NN6G 2K4KA 1HR0Q 5FJ8H 4AYBE 1RL2A 3BZCA 4PMWA 2MFIA 3D31A 4LW1A 1IBLQ 4POGA 2A8VA 3CQZH 4GN3B 2H5XA 3CCJA 4A3CG 3S1QH 1QVGA 1UE1A 3KYHC 4JOIC 2CQFA 1WFQA 1VQEA 5HY6A 2ASBA 1CKOA 1ESKA 2E2HH 2VQEQ 3PSIA 2Z6KC 5AJ3L 1WCMG 4P71A 2PNHA 3T1HL 1EIYB 2WP8J 2VQFQ 4HJ5A 3I7FA 2NZHA 4OO1I 3CW2C 4UP7A 2CQOA 1HZ9A 2I0QA 4A3LH 4L5SA 5IT9c 2HT1A 1BVSA 3HOWH 1KHIA 2ZTDA 4NB3A 3UE0A 3GTQH 1VQ6A 1GO3E 1SMXA 3CAMA 3EBEA 3PUZA 4RG1A 3CCVA 3NELA 3CCMA 3H15A 3M9BA 5C4JH 4KHZA 2B3GA 1N36L 1XNRQ 4AH6A 5C4XH 5C0XI 1X55A 4GKJL 2UUBQ 4GS3A 1U0LA 5GAHC 1HJPA 1E3PA 2K52A 4LUZA 3JC66 3KLWA 3PO2H 1I6HH 4ME3A 4IJLA 2JEBI 4BBRH 3I4MG 1E1TA 1VQ4A 3UDGA 3UDFA 1Q86C 3STBD 4PZ7A 3I2ZA 4C3JH 5IWAL 1XMQQ 2ATWA 3S2HH 4GKKQ 5GADC 5BR8Q 4GOPC 3HOVG 2VNUD 1Y1VH 1J5EQ 1OXXK 5LMUQ 2F3IA 1Y1WG 2IY5B 2ZJPA 3CCLA 4APVA 4JBJA 4DV1L 3TS2A 4AQYL 4DUYL 3GTGH 1VQ7A 3HKZG 1GVPA 1JJ2A 5C3EH 1VQNA 2UUAQ 4B3RQ 4WJ3M 4R1JA 3G4SA 3F8TA 1OXSC 1WYDA 4DV4Q 1X3EA 1X6OA 3RLOA 3RR5A 1K9MC 4IPGA 2EIFA 4C2MH 4X6AH 1HZCA 3FKIG 1YHQA 5K36G 2WAQG 3PUWA 2VUMG 4JI1L 2OTJA 2IHEA 4B3ML 1N32L 3E9IA 4R4IA 2YYZA 4R4CA 1DGSA 1I5FA 2PI2E 4JBKA 4YY3L 3BJUA 4X64L 4L5RC 2VS1A 1LYLA 1VQCA 3NENA 4H02A 3JAMc 2E5LL 2EC7A 1VS0A 4C3IH 4JI7Q 1LM0A 3PUYA 1X65A 4R4TA 3NYBB 3TEHB 1PH5A 2B63G 1B8AA 1VQOA 2V1CC 2YTXA 1UWVA 2UXDQ 2Q2UA 4DV3L 3F1ZA 5IP9G 2D62A 4LF9L 5C44G 4GNXB 4BA2I 3ULJA 1KC8C 4IPHA 1A62A 1HNWL 3CMEA 1BBWA 3WWVA 4LFAL 3ULLA 1G291 4QQBX 4A75A 1AH9A 2PMZE 1T9HA 4OWWB 2AKWB 2LSSA 3I4NH 4A93H 4J15A 1GM5A 3TRZA 1P16A 4A3DH 1VQIA 1XNQQ 1A6BB 1SN8A 5GROA 5FJ8G 2YTVA 2OQKA 1HH2P 5AJ3Q 4A3EH 1NJIC 4JI0L 5HGQA 2R93G 2R7ZH 2LI8A 1W2BA 4FDBA 2K75A 1MFSA 2VY3A 4DR5L 4OO1G 3H3VH 3GD7A 1EOVA 1UE5A 4GLAC 1PA6A 2KHIA 4OWTB 4YCWA 1OXUA 1X54A 4QY7A 3UDXA 1Q81C 2KBNA 2MQHA 1PH7A 3CP0A 1N36Q 1QUQB 2KENA 3CC4A 2UXCL 4GKJQ 4AYBG 2K5HA 4LFCL 2DUDA 4A3LG 4BXXH 1OXTA 4JBWA 3TS0A 5C0XG 3AEVA 5GAEC 2LXKA 5IP7H 4TVAB 1HZBA 1NBWA 4PG3A 1X9NA 2BA0A 1X3FA 3RZDH 5IWAQ 3GTJH 3ICEA 4UP9A 3KF8B 3HOYH 2JA7H 2IX1A 1L1OA 3I56A 2Y0SG 3TQYA 5LMNW 1WWGA 1VQLA 4DV5L 3T1YL 2I5MX 1QVCA 3HOZH 4DV1Q 3PO2G 4A3JG 4AQYQ 4DUYQ 4A3BH
chains in the Genus database with same CATH superfamily
3UI2A 2SNMA 5KYIA 4LF8Q 1SFOH 1ILQA 1M90C 1R9TH 4MTNA 1FVIA 3CKIB 1N34L 1PYSB 4ODGA 3K8AA 5D14A 3U50C 5C3XA 4NW2A 4JI1Q 5LMNL 5G3LD 4BY1H 3U4ZA 4DAPA 4X65L 2ZTEA 2IX0A 4X64Q 1X3PA 2B2TC 5JPNC 5C3EG 5ELEA 2UXBL 1CT1D 1VQAA 1AAFA 3A5ZB 2JA5H 2BH2A 2EJFC 2K01A 3LNNA 4K5VA 3UDIA 1MIUA 2A69D 1G51A 1LO5D 3HS0C 4A3KG 1UEBA 4DK3C 1AZPA 3OIQA 4GN4B 4HSPA 4P73A 1WOCA 3K5NA 2KUMA 1EIFA 4R4OA 1NAPA 1F77A 5CORA 1HNXL 1IBML 3S2DH 3PV0A 3H0GH 2F0UA 2WB1E 1C9OA 1TWGB 1DOMA 1MKHA 4PMBA 2RHQB 3DXJC 5T1IA 1YJ9A 3KFUA 3QIAA 2A5HA 3QJYA 1EQQA 4JI0Q 1CKNA 1F2LA 3FPPA 2B63B 3QOJA 3DWPA 1VQPA 1B70B 4DR5Q 2NUCA 3SEBA 4DAMA 1JWUD 3AFPA 2R92H 2CH4A 3OWEB 2CWPA 3CF5A 5EKLA 3VR4A 3PO3B 5IYCH 2A1AA 2KHSA 1DYQA 3R2TA 3FRPB 3GQBA 3MXUA 1SE8A 2XTIA 1GOZA 2XRSD 1YEZA 4V190 1EEFD 3G6EA 2Q8RE 3CC2A 2KEDA 1JMCA 1Q12A 2IW3A 1FJGL 1F2ZA 1NCVA 4BXXG 3T1YQ 3BVGA 1G2TA 1K0SA 2F0PA 3D3RA 3J7ZC 2JA9A 4KLKA 3G48A 1ESRA 1MGSA 2PYKA 2RF4A 3I91A 5IP7G 3T16A 2N8NA 1EZ8A 3J80L 5M5YH 4AYBB 4B08A 1MJCA 5C3WA 1SNCA 1Z9FA 1Z47A 1TKWB 3I3CA 3HOWB 1FL0A 2YV5A 3PF5A 3HOZG 2EJMA 2PPBC 1YZ6A 1C4QA 1TY2A 3J7AV 2AWNA 1CSQA 1HA5A 1PH3A 1ET6A 4DR4L 2DJGC 3KF6A 1RCVD 1B44D 2G5DA 4HIDA 2CKZB 2Z4HA 4IUNA 4KKSA 3GO5A 2SDFA 3DEPA 2HHHQ 4KV6A 2OTLA 1Y1VB 3AYHB 5KIXA 4X66Q 2JA8H 2OEOA 4HMIA 4XT3B 4IPDA 3EFXD 3KUPA 3GTGB 3K59A 5C3EB 4WORA 4BBRG 1IL8A 1S5BD 4YWMA 4YCVA 1FNWA 1WTXA 4YWKA 1A3UA 3MAQA 3OOCA 2F0WA 3RZOH 2XN9C 4ILWA 1M1KC 4EQNA 1QNKA 2M00A 2UU9L 1XPOA 1QWYA 4OONA 4ZUJA 1F6UA 5FO9B 2A19A 2M9VA 3R8BA 4B3TL 5FO8B 3L0OA 4K0KQ 5JAVA 2OXPA 2WV6D 3DHQA 1PTOC 3E0EA 5FLMG 3GTKB 3I90A 4LAAA 1DZ1A 2PI2A 4ZAIA 3J7AF 2D9UA 4NXML 1EWIA 1HR0W 3RD4A 5C5MA 4NXNQ 1XWEA 2UUCL 1B7YB 2K1BA 2AHOB 1SAPA 3P1HA 3SK4A 4YHHL 4IFDG 2RHSB 2EY1A 3EN2A 1C48A 4CJ1B 2ZM6Q 1BBUA 3AQQA 4GOPA 4DKAC 3F2CA 3I4NG 1PTOF 2KCMA 2EYHA 4A3MG 1AE2A 1BBXC 3K0XA 1LTTD 3K57A 2PZUA 3NSWA 5DEHA 3SXHA 1YJNA 3J81c 3AFQA 2RVLA 3HOUG 3U58A 3FEWX 1EY4A 1PRTB 2CFMA 2F0KA 2XWBB 4HTHA 4A3KH 2B2UC 2YTYA 1ENAA 3SK6A 2LMCB 5D3IB 1G8ZD 1XMOL 3HOZB 4KN4C 4G7ZC 2AMCB 1TWCH 3GTPB 1B2TA 1IW7C 1PHJA 4ALPA 3MHBA 4LF4L 4FYDA 3KLRA 3T56B 5CV9A 1SXTA 1YITA 1TY0A 5JVH3 2A6HC 4GNXA 3I4OA 4DNRB 3K81C 3GTMB 1OXVA 4LF7L 1ZKOA 2FHTA 3GTKH 1AE3A 5M3FG 2EXZA 2KCCA 2OT2A 1A2UA 2GN5A 4TQUS 1VQ5A 2A73B 3M3YB 4E6IA 4CJ0B 1HZAA 5LMUL 2EJGC 4JV5Q 1RF2D 3IRBA 2VUMH 2BOSA 1Q8KA 3ERQA 2C9OA 1P8LA 1I6HB 3IKJA 4LF6Q 1LTLA 3NWTA 1Q1EA 1KL9A 2R3ZA 4DR1Q 1SNMA 5M5XB 1CHPD 1F9QA 1HNZQ 1NTGA 1N33Q 4DFAA 2FINB 4MIUA 5C44H 5C0XJ 1Q3YA 2MO1A 1WTOA 2F0NA 4CDEC 1S40A 1G2SA 3HP3A 2PQEA 1QUQA 4DR2Q 4JI7L 1PH8A 2CW0C 5IY0A 3VR5A 3M85A 2EYFA 4I65A 1K3BC 4JYAQ 1NR4A 1JB3A 2E74C 3NUCA 1KABA 2QF7A 5FJ8H 4AYBE 2E2IB 2O5IC 2FFKB 1BXTA 2MFIA 4POGA 2A8VA 4DAVA 4OIJA 1ZXTA 3KYHC 1EY8A 2VQEQ 1RDPD 3Q23A 3R2IA 1S5DD 5J22A 2B2TA 3C3LA 4A3LH 5CV6A 1BCPC 1CZWA 1V1OA 2L11A 1KHIA 3BVMA 3S1RB 5C0XH 3IAYA 1CK1A 5E1FA 3I4NB 3I4MB 3ITPA 4NB3A 3A56A 3UE0A 2PW7A 3PMFA 2RDHA 1VQ6A 1GO3E 3EBEA 3PUZA 3CCVA 4A3MB 4PQXA 3NPPA 1DCZA 4KHZA 2PW5A 1XNRQ 2B2WA 2K05A 1QOHA 4LUZA 1I6HH 1VF7A 4QF4A 4BBRH 4XT1B 3UDGA 1EY9A 3UDFA 1B1ZA 3K5LA 1ILPA 5IWAL 3HOUB 2WIIB 3I2ZA 1BCPF 3S2HH 4GKKQ 4DXFA 3E5SA 4O1NA 1WTWA 1Y1WG 1GJXA 3HKZG 2ZT9C 1GVPA 2UUAQ 3G4SA 1H9JA 3F8TA 2LKVA 4DV4Q 4FF4A 1X6OA 1S4ZA 1SBBB 1HZCA 3FKIG 5K36G 1ZEQX 4JBKA 2K03A 1DGSA 1I5FA 3FMCA 1BUVT 4H02A 5M3FB 3JAMc 2EC7A 2DNEA 3PUYA 2Z4IA 4EVOA 1B8AA 2VB2X 2YTXA 1KAAA 2Q2UA 4BA2I 3S1MB 4TSSA 3LWUA 4TRDA 1XX8A 4IPHA 1A62A 4TKOB 3WWVA 4LFAL 4A75A 1D6EC 1AH9A 1T9HA 2LSSA 3I4NH 3TRZA 1VMCA 1S5ED 2MGSA 1XNQQ 2K5DA 1NJIC 2R93G 5DM73 4FDBA 1FGBD 5M5WB 2RSOA 2VY3A 5FK9C 3GD7A 3A8KE 1UE5A 4DK1A 2KHIA 4HEDA 4O42A 4YCWA 2JYOA 4QY7A 3UDXA 1Q81C 4L63B 4Q5VA 1PH7A 3CP0A 2KENA 3CC4A 4GKJQ 4LFCL 2DUDA 3NWSA 4Q0FA 1A15A 1OXTA 3EVQA 2EDGA 2L1BA 4FXKC 3TS0A 1JQYD 2CHBD 5GAEC 2F0JA 1FR3A 1X9NA 3A7AB 2NVXB 1X3FA 3ICEA 3KF8A 2JA7H 1TWFB 1E2ZA 4DV5L 2I5MX 5LL6S 1AN8A 4DV1Q 3PO2G 1JC7A 4AQYQ 4A3JG 1TS5A 2Z1CA 4DU9A 4X3SA 2KCTA 1MHWC 2EYPA 3FP9A 4N9PA 1KRSA 4C3JG 3DMUA 3TN2A 1EY5A 2Z8LA 4J1MA 3S1MH 1QG7A 2I46A 4RHRA 4B3MQ 1K83H 1HXYD 4YY3Q 1SYFA 2D0PA 2Z6KA 2Q8IB 3PGZA 1A8VA 3S1NB 1Y1WB 4B9XA 5IYBG 4RGOS 2JP1A 3HKZB 5EGTA 1GKHA 3OMGA 1K8MA 1EFWA 1I3QH 3L2PA 1PV4A 4PZ6A 5M5WH 1D1KA 5G3LF 2HDLA 4DV7L 4RGMA 2NZOA 1VCIA 3FKIB 1Q8IA 3TZUA 1WWDA 1CHQD 2NVQB 2OTJA 1AP0A 1FYCA 4UP8A 2PNRC 3M4OH 2E2JH 4K8IA 1HFGA 1B9NA 2K5QA 1BF4A 4K14A 2F0TA 1IKLA 4A3DG 2NVXH 1A0IA 4KD4A 3CMAA 3M4QA 4A3IH 3LWEA 1TWFH 1LTID 3W1GA 4DUZQ 1SYEA 1C0AA 3DLLA 1A6XA 1K28A 4DGZA 1AW7A 4O2DA 2KA7A 2K04A 1STEA 1CA6A 2JA6H 1CM9A 1WTHA 1HTLD 4LJZC 3TREA 4UAIA 2CCZA 2A68C 2R93B 2EYOA 3VDYA 4A3FG 1QCBD 4OX9L 2WINB 4FXGC 4RWSC 5IYDH 2MNAA 2VB3X 4GNXC 4ZKBB 1PH6A 1QVFA 3PO3G 3I55A 4JBMA 4A76A 4IFDI 3WDNA 1PFSA 3OW2A 1YBYA 5KGUA 5E3FA 4KD3A 3M4YA 2X6LA 4LF5L 1N34Q 1Y1WH 3VYRA 4DR7L 1OTCA 3BU2A 3D4WA 2IL8A 2VXWA 3D0FA 4DF7A 1YNND 5LMNQ 1I94L 1LTGD 2ZJQA 3ERSX 3GTQB 3EQLC 4X65Q 3SR1A 1XMQL 2JE6I 2UXBQ 1L2FA 2I5HA 3J7A5 1MSGA 3NEMA 5CYUA 2HCIA 1ASYA 1D5ZC 1FGUA 1TQOA 4WJ4A 1XPUA 5TSSA 3PO2B 4A3JB 5IGGA 2GA4B 3HOWG 1EQVA 4JI4L 1CKMA 3PUXA 5KNDA 4L5QA 4C3JB 1KQSA 2JZWA 4QUCA 3AMUA 3U9SA 3KLSA 1EFID 4KTAA 3J80i 3I73A 4BA1I 1IBMQ 4POFA 3RN5A 4LFBL 5C4XG 2LY7A 3WOFA 1EYGA 3NBHA 1SYDA 4OHJA 2BH8A 2RA4A 2F4VL 1VF5C 1Y1VG 1QZGA 1TXYA 3FVQA 1N32Q 2R93H 3IFDA 4P75A 5I6YA 1Q1BA 1Q46A 2X6GA 1IYUA 3NQTA 3S24A 4FO2A 4LWCA 1NY4A 2MJ8A 4XQNA 4KJNA 4CGYB 1E2VA 2B2WC 3Q8DA 1FJGQ 2R7DA 1B4OA 1SROA 1IXRA 4RA8A 2O5JC 3BDOA 1SR3A 4A3DB 3VA5A 5FLXE 2XNAC 3CCRA 4HN7A 2I5LX 3F2DA 1VQFA 1ICWA 1H95A 1EY0A 5IE8A 3HGBA 4A3CH 1K73C 4L5SA 5C6AA 2B29A 3M4PA 4A3JH 1U6PA 3OIPA 5FOBB 4A93G 3MFYA 2F52A 2N78A 3MXPA 4P74A 5F2DA 1HR0L 1WCMH 1DXMA 4O0AA 2AWOA 2X69A 1IBLL 3Q0AA 4A3FB 4DAYB 4DR4Q 2R7ZG 1IL2A 4CBVA 3BYYB 2FMCA 3KDFA 1BR9A 3NTHA 3QB3A 2NVTH 4Y52H 1ASZA 3Q6SA 4HMJA 4IUVA 1IHZA 4LF8L 3PF4A 1IZ6A 2L4LA 1E1OA 1Q82C 3X3MA 1JWMD 2A68D 3ULPA 2SNSA 5IYBH 4OWXB 3HKZE 1O78A 3OSOA 2MUYA 3CCSA 1RKNA 5JJLA 3E9HA 2OCEA 1JE4A 1HRJA 2K28A 4DNIA 5JJZA 1EUJA 2UUBL 1BNZA 1G91A 2NYZD 2PQAB 2M3ZA 2K5VA 1SNQA 4K5WA 5KYLA 2UU9Q 1AEXA 4A3BG 1PZKD 3PIPA 1LABA 5GQOA 3A54A 1RODA 5C4XB 1E7ZA 4FF1A 4X3KA 2DN8A 2F4IA 2EPBA 1NE3A 1TWGH 4B3TQ 4IALA 2BCOA 3PIP3 3S17B 1JB7A 3QG1A 1STNA 3H94A 1YHAA 2B63H 2L4NA 1J6QA 1CSPA 4NXMQ 3QO2A 1UE6A 1L0WA 4XYQA 2UUCQ 3TSSA 1MJEA 1I4PA 1LTSD 4C1NI 4A3FH 1A1TA 4YHHQ 1LLRD 3H6MA 2HQEA 3PO3H 2ALYB 2UXDL 3HOXG 5LHY1 3D4RA 1XTCD 1VQMA 1EY7A 1KTKA 1PXUA 3BZCA 4PMWA 3D31A 2QCPX 2NBFA 1RTOA 2NTSA 1FD7D 2H5XA 1WTQA 1M8AA 2CQFA 5HY6A 5LL6X 2ASBA 1CKOA 4RFBA 2SEBD 2NVYB 2Z6KC 4F8MA 5AJ3L 4FXDA 1H9SB 4Y7NB 3F2UA 5NUCA 2NZHA 3CW2C 1U4PA 3K5OA 4UP7A 5IT9c 1BVSA 4PV1C 3HOWH 5JVG3 4A93B 1PLFA 4IURA 1MI2A 3D4DA 3JAME 4RG1A 3NELA 4CKEA 3HOVB 3CCMA 2HCCA 1PTOB 2B3GA 3BDCA 1N36L 5C4XH 2NZ1D 2R7ZB 1SYGA 1X3QA 2KQ3A 5GAHC 1E3PA 4I7AA 4R8IA 5CBEE 3W3AA 3I4MG 1VQ4A 3EROA 2ATWA 1Y1VH 4F7XA 1OXXK 5LMUQ 5E4WC 2IY5B 2F1MA 2ZJPA 4JBJA 4DUYL 3GTGH 5ELCA 1D2BA 1VQ7A 4YIJA 1VQNA 5C3EH 4R1JA 3I4LA 5KRUA 1HQMC 2HDMA 3RZDB 1X3EA 3GTJB 5CBAE 1Y8PB 2F0MA 4OGQC 1K9MC 2EZVA 5A2QE 3T51B 5C4HA 1VMPA 2IHEA 3E9IA 2YYZA 2UXCL 2RSNA 1GUGA 2VS1A 1LYLA 1VQCA 4A3BB 1PRTC 4EQPA 4JI7Q 3NYBB 3TEHB 1II3A 2IPKD 1VQOA 3GTOB 4DV3L 2EE1A 5IP9G 2D62A 1JCKB 2SOBA 2EOTA 3HEJA 4MHEA 4OL7A 1QJOA 5KEEA 3VYSA 5CR3A 3WOEA 1HNWL 5EBDA 3CMEA 3K7AB 1G291 1W6JA 2DY7A 4ZCKA 4K6LA 1Y8OB 2AKWB 2ZXOA 4A93H 3G7LA 1P16A 1H9MA 4BWGB 1CQFA 4IZ8A 4C56C 3FDTA 1WD0A 2YU9B 2OQKA 2R7ZH 2LI8A 1AFPA 2EVBA 2K6AA 2Z6BA 4IUQA 3R93A 1K8OA 1MFSA 4HCSA 3HOXB 3S14B 3SE0A 1CI3M 3H3VH 4NP5A 5ISRA 1OXUA 1X54A 5FO7B 5EKIA 1PFBA 2F3WA 5I6WA 2K5HA 2F0QA 4BXXH 2K32A 2BE5C 5HGTA 1A3VA 3N52A 2P5ZX 5I2YA 5IP7H 4TVAB 1HZBA 3RZDH 5IWAQ 3GTJH 5I9PA 4UP9A 3U9OA 2IX1A 3I56A 1WWGA 1VQLA 1QVCA 3MEHA 3HOZH 4K6DA 4QB4A 4A3BH 4N9TA 1KD1C 3K80C 4PZ8A 4B3SQ 2B8GA 3C1FA 1WTVA 3GTPH 2JEAI 4EQOA 2IT1A 1TIID 1KIXA 4XYOA 3AU7A 5GAGC 4HIMA 1TS4A 4R8NA 5ELFA 1SEBD 3A55A 2CQAA 3GTMH 1XPRA 3OTOL 1DOKA 1Z7TA 4HAEA 2J0TD 3Q22A 3M3YH 2H4OA 2YU9H 3ZYYX 1F2MA 3F2BA 2N49A 1VQ8A 4LFAQ 4ZKCB 5M5XH 1I4HA 1HNZL 1ONLA 4IFDJ 1N33L 3U4VA 1BJ6A 3DM3A 4X62L 5T1GA 2Q2TA 4QGUA 4DR6Q 2GVAA 4FF3A 4JI5L 4BY7G 4LUOA 2YSAA 1IYJB 1CKNB 1VQHA 4NMZA 5A35A 1PYWD 3GTLB 4IOCA 2LS01 2KHJA 1Q90A 1A63A 2L0CA 3K7UC 1EIGA 4XDXA 2E2IH 3B6YA 3MXNB 1ENFA 4DAYA 5FLMH 3A5UA 1O7ZA 4JI3Q 2B2VA 2GVBA 4UY8C 4HCEA 1PRTD 5C5LA 1B50A 2QDLA 4X3UA 4DK0A 4RMFA 2JJQA 4KHVA 3RMHA 3P20A 2JN4A 1IBKQ 1SRUA 1BKBA 4HJ8A 3NTIA 4IFDH 2K5NA 2AUJD 2HIXA 3PIOA 4DV2L 3CQZB 4IUPA 1Q7YC 4DV5Q 3MEFA 1D8LA 1SNOA 3S1RH 3I4MH 4K8JA 1BOSA 1EWCA 1HA6A 1SLJA 4A3MH 3D8GA 5CC4A 3PIO3 1W3SA 2WAQE 4C1NK 3T1HQ 1O7IA 1GHKA 1XTDA 1LT6D 2CVRA 1T5XD 1YNNC 3ER0A 3A0JA 2DJFC 3DWQA 5JEAG 4KY5A 3A74A 4J6HA 4K5XA 3HOUH 1EOTA 2PCFB 4JI2L 3NHHA 4DN4M 1S72A 1YNJC 5FLXL 5C4JB 2C35B 3H3VI 5I4DA 2HD3A 1I4QA 2BE5D 2UUAL 2TMPA 4DV4L 2N88A 4YWLA 1LT3D 5IGBA 2FXQA 3GTLH 3RLNA 4DV7Q 2DNCA 1L1OB 1JJGA 4KJOA 1SMYD 1YVCA 2C5CA 4QIWE 1J8IA 1KRTA 5M3FH 3GV3A 2RKSA 4LNQA 2OQ0A 1Y14B 4KI0A 3DM1A 3V05A 5H1SE 1E2WA 3I8ZA 1I4XA 4KHPL 3H0GG 3G71A 1K8AC 3MWYW 5EKKA 1K3RA 5COYA 1ZYRC 4GLVB 5J3BA 5DLQE 4CKBA 2E5LQ 3TP8A 4KKUA 4UHVA 4JI6L 1STGA 2CH4W 3ND8A 1XNQL 2F0FA 2Y0SE 4XTCS 4LF9Q 3A8IE 1DM0B 3NP8A 4HJAA 4DV0L 2R92G 4BY7B 2XGTA 2ES2A 4JI8L 4XXEA 1PH4A 3I70A 2PO4A 4OX9Q 4L5TA 3CPWA 1FNUA 3VA7A 1H9RA 5IYCG 1VQKA 2EY5A 4PNYA 3SK5A 3S9WA 1WWFA 4MNOA 4H44C 4OELB 3S16B 2IHFA 5IGFA 4ZLTF 2RCNA 5IIFA 3BG3A 4DR3L 2Q2HA 4G7OC 1CFMA 4LF5Q 1EY6A 4DR7Q 2HIVA 4DV6L 2DGYA 4GOPB 1TU2B 3GDEA 2PMZB 1I94Q 2EY2A 1QE6A 4HR7B 2IHXA 2EYLA 4IO9A 1F9PA 3VR2A 4A3EG 1A3TA 3C46A 1UEAB 1VQJA 1N9WA 1VQBA 2I07B 4ABNA 5I9OA 1JE5A 1L0XB 2E75C 2J4XA 4JI4Q 1V9PA 3DWAA 4JK1C 4GZYC 2VL6A 3J80c 1XXGA 4JC0A 1SNPA 1HHVA 2R61A 2VQFL 3AB9A 3KJPA 2J7ZA 1NMGA 4LFBQ 2F0LA 1E24A 1UUPA 2A6EC 2FJ2A 1DD2A 4KY7A 2D0OA 1WTRA 3J81j 1EWHA 2G9DA 3TMEA 2RCFA 1BO0A 3DUZA 3EIVA 3KLSX 3TP6A 2E2HB 3LX0A 3BZDB 1BQQT 2RQXA 2IWHA 4R9WA 1U4LA 2BA1A 2F4VQ 4DNTB 3HOYG 5DAUA 3OWFA 3S1NH 2OWOA 4H13C 2JA8G 3OMCA 1S5CD 1UNSA 4L6TB 4BY7H 3HZXA 2K14A 1YHBA 2XRQD 4HJ9A 2B2YA 4N8FA 2Z9HA 4G57A 2JA5B 5BR8L 3JAML 1J9OA 4Z9CB 2R6GA 3K0YA 3EJIA 3TP7A 1D5XC 1YNJD 1J5EL 3FKIH 2L15A 3S16H 5K36H 1KAWA 4J8QA 5JEAJ 4CKCA 1YI2A 2NVQH 1M4VA 1STHA 5HURA 4DPGA 3BS1A 2QA4A 4B3RL 1B3AA 3P75A 1V43A 5IT9E 2ID0A 1KNAA 1HNXQ 3S2DB 2KCNA 4DK6C 4V0BA 3H0GB 5ELOA 1SE2A 3TP5A 1VQDA 3BZKA 2BDNA 1KLGD 2F0SA 4DUZL 1QZHA 1EQTA 1SE4A 2VZAA 2F0DA 1WWEA 1WI5A 1HPCA 3SVMA 4C2MB 1S3OA 4H7BA 1JOKA 4EX5A 2EXDA 4IQZA 1H9KA 2NN6G 4ID6A 5A2QL 1HR0Q 2R92B 5CV8A 4LW1A 1L0YB 1IBLQ 1EL0A 1ZYRD 3RUZA 1CQVA 1R4QB 1QVGA 1UE1A 5JEAH 1ESKA 2E2HH 1RD9D 1STAA 3PSIA 2PZWA 3J81E 1D1IA 4P71A 3C1EA 1O7YA 1V1PB 4UDUC 1SJHD 2WP8J 1EIYB 2FMMA 2CQOA 1HZ9A 1F9RA 1PDQA 1HCZA 1V8QA 3BDLA 3VYTA 1SNDA 2ZTDA 3HRZC 3GTQH 1SMXA 1O80A 4S3SA 5ELBA 4A3EB 4AH6A 3I72A 5M5YB 2E2DC 2UUBQ 4MTKA 1U0LA 4IUTA 1HJPA 3JC66 2D2CC 3BYTB 3PO2H 4ME3A 2K7VA 2JEBI 4IJLA 1IYVA 4KK7A 3K5MA 1E0BA 2F0VA 5KNCA 4PZ7A 3SK8A 4C3JH 1GHJA 1I6VC 3HOVG 2VNUD 2XVSA 1MBYA 4C3HG 3CCLA 2M2LA 5M9OA 1GUNA 1HFNA 3IL8A 1JJ2A 4U68A 2B2VC 1OXSC 3DEOA 5EPLA 3RLOA 3RR5A 3OW7A 4DXGA 3HOYB 2EYMA 4IPGA 2JA8B 4C2MH 2F0GA 1YHQA 2WAQG 2VUMG 3NE5B 4JI1L 4OIKA 1N32L 5DM63 1C8CA 2A6ED 3GP7A 1JWSD 2PI2E 4X64L 3MXNA 3BJUA 1EU3A 2B8FA 4L5RC 1Y8NB 1VS0A 1LM0A 1PH5A 4ZUIA 1MSHA 2V1CC 1UWVA 2UXDQ 1ICFB 5C44G 3RZOB 1IKMA 1STBA 4JVZA 1BBWA 4CJ2C 2PMZE 1PZJD 2BDOA 3P7JA 4MN3A 4J15A 2K33A 1GM5A 4ZQ3A 2G9HD 1SYBA 5EPKA 4A3DH 1SN8A 5FJ8G 1I50B 5AJ3Q 1NNXA 4A3EH 4JI0L 5HGQA 3K6OA 1W2BA 1TWHB 2K75A 2QDBA 3MTSA 4DR5L 2D5DA 4OO1G 4L8JA 5IGEA 4OWTB 1F2YA 4KMUC 1TT2A 5CV4A 3R3OA 1N36Q 1UAPA 4N8X1 2ICIA 4KY6A 4A3LG 4JBWA 2PZTA 1Q3LA 5C0XG 3AEVA 3D6CA 1TVXA 2LXKA 3S15B 1CA5A 4PG3A 4QUFA 3A7LA 1I4RA 2BA0A 3T53B 4G4KA 3HOYH 3KF8B 1ENCA 1DJRD 1L1OA 1GUOA 1LT5D 5CGKA 2Y0SG 5LMNW 5J39A 3URYA 5J1ZA 3T1YL 1R4PB 1S5FD 1LV9A 4DUYQ 1KLUD 5IOCA 2ICEC 4R4QA 5M3MG 1DOLA 2WKDA 2JXMB 1D7QA 2AUKA 2RDGA 3KK7A 4X3TA 2R7FA 4P72A 4GLXA 4A3KB 1WVLA 4HSVA 4BBSG 4JOIA 1XMOQ 5FKAC 2UXCQ 3KJOA 5DNFA 2HQLA 3HKSA 1TWCB 3PCOB 4UPAA 4NDXA 1QILA 4LF4Q 3V2TA 1KXLA 4C3HB 4DV3Q 1SDFA 1LUZA 4NKLA 1I50H 1HNWQ 3S17H 4LF7Q 3CCUA 1MD2D 3VR3A 1TWHH 2HHHL 3E0JA 1GD7A 4K2LA 4X66L 1CUKA 4LUVA 2NN6H 2WAQB 2VUMB 4FVMA 3H3VC 3M7GA 4NPSA 2AQ2B 3CCEA 1G6PA 3RLFA 4RKLA 5EAYA 1B3QA 3OYYA 4QL5A 4RCNA 3CPFA 2KJXA 3HG9A 3VYUA 1UE7A 1TR5A 3ONAB 3S15H 2QGQA 1E22A 5C44B 1EIHA 1FNVA 2KECA 4MZ9A 1Q3ZA 2E76C 5BN5A 5D3DA 3FPUB 4M8AA 1X56A 1W6KA 4K0KL 2NVYH 3E3XA 3V96A 4M1UB 1VDZA 4Y7NH 2L5TA 4QIWB 3K58A 1QNUA 3RN2A 3L9AX 2EXFA 2Q2IA 3NK9A 4NXNL 5BN3A 2TSSA 5ELNA 1N8RC 2F0IA 5FLXc 5CV7A 1NMFA 1SE3A 1PRTF 2B2YC 4A3GG 1TS3A 3HOVH 3RNUA 3CHBD 1PTOH 2JA7G 4C3HH 4HIOA 1EQRA 1PH1A 2ZM6L 2OF1A 3CRKC 4RGNA 4XQJA 1I4GA 3T4AC 3OTOQ 3QOLA 1JORA 3O13A 5E4XA 3W2DA 4JG2A 2Y0SB 2K5WA 2E8GA 1K8GA 2HUGA 4ZYSA 3CD6A 1GXDC 3UE1A 3FHWA 4CHTB 4BBRB 2L12A 5M3MB 1B9MA 2ZXRA 3LGJA 1U5KA 3S2HB 1CTMA 1RIPA 4FNFA 3J81i 1PH2A 1SMYC 3OPOA 2ZJRA 3NBHB 2RBMA 4BBSB 4X62Q 3OHXC 5D65A 2F0OA 1PVOA 4IOAA 5AFWA 1HQRD 1LTBD 4JI5Q 1YNXA 2A74C 4IPCA 1EZ6A 1RHPA 2EQSA 1X32A 3ZJYC 4HJ7A 5JOBA 2WACA 2IX3A 3GTOH 3IFTA 2JK8A 3Q24A 3MXGA 1PMRA 2WFWA 5IGCA 1EYDA 2V4DA 3K7AH 1V1QA 2NTTA 3QWNA 4PMCA 4OO1H 3HFZB 4WRDA 5L37A 4JV5L 1BCPB 2IJ0A 1G6ZA 3J80E 4QJFA 1V1PA 3CC7A 2WB1G 4A3IG 4LF6L 4DV2Q 2MPMA 4DR1L 1PTOD 4FF2A 4C3IG 5JJIA 5EPJA 2Q8TA 3HOXH 3S14H 3L7ZC 1HUMA 1STYA 1JT8A 1YIJA 1PFMA 3W1BA 2JA6G 4I7ZC 5IODA 1WJJA 4DR2L 2DY8A 4DA2A 2NN6I 1HTPA 5IYDG 3CCQA 4JYAL 4A4IA 2QEXA 1TWAB 5IT9L 1JJCB 5M3MH 4RCOA 5CV5A 3STBC 5JJKA 3C2PA 1X3GA 3N6RA 3CXCA 2EY6A 4JI2Q 5E7NA 4BBSH 3TZDA 4LFCQ 3NXWA 3KDFB 3EA6A 4BS9A 2N3SA 3BVZA 4RH6A 2VQEL 4B3SL 3TBIB 4A3GB 2MO0A 2LXJA 1PYBA 1VQGA 3GV6A 3PUVA 2JA7B 1B53A 3QR8A 3KBXA 4RHSA 4GN5A 2JQOA 4G7HC 4YCUA 3S1QB 2F0EA 2K50A 2ZXPA 4AIMA 4JCVE 1EYAA 1ML0D 4U673 1XNRL 1IW7D 3J81L 2QILA 3H09A 4XQQA 4KHPQ 2ZTCA 4RKBA 2A6HD 2AQ1B 4IJHA 2VW9A 2PQAA 1YJWA 4ULLA 1WD1A 1GUTA 2B39A 2L55A 1K83B 4HIKA 1KNEA 2KEEA 2Z0SA 1K0RA 1KDAA 4FP5D 4GKKL 2L9HA 3KOJA 4XIGS 4JI6Q 4EQ5A 1ET9A 3KF6B 1XJVA 3PQIA 4DR6L 4RAUC 3SGIA 1HUNA 3NBIA 5JPMC 4WFN3 3J7YW 1EYCA 1TS2A 4OXPA 4DV0Q 1RJTA 2KVMA 4BY1G 1C7YA 3M7NA 4RGTA 4JI8Q 1I3QB 4ZRZA 1SJED 4CDFC 1TWAH 2JA5G 1A2TA 2EYJA 5IP9H 3L3OC 2QKIC 1U9RA 1GUSA 1LACA 1U4RA 1VQ9A 2RDFA 4JI3L 4DR3Q 3CU7A 3W5OA 2CWAA 3M4OB 2E2JB 1L1OC 2CW0D 4DV6Q 2QW7A 5ELDA 5K5PA 3JAMi 1QB5D 2MP1A 1NUCA 2ENBA 1IBKL 1PH9A 4A3GH 2K4KA 1RL2A 2WB1B 4A3IB 5KNBA 3CQZH 4C3IB 4GN3B 3CCJA 4A3CG 4ME5A 3S1QH 4QMGA 4JOIC 1WFQA 1VQEA 1LTAD 2JA6B 2XIWA 1JOQA 4H0LC 1F9SA 1WCMG 3T1HL 2PNHA 3NQIA 1H9SA 1O7LA 2VQFQ 4HJ5A 3I7FA 4OO1I 2JSOA 2I0QA 2H1EA 2HT1A 1BCPD 5EJWA 4CDDC 1NSNS 3CAMA 1EEID 2NWGA 3MC0B 4LK1C 3H15A 3M9BA 5C4JH 3NTKA 2A69C 5C0XI 4GKJL 1X55A 1KDCA 3CRLC 1RTNA 3E6ZX 4GS3A 3D6WA 4QCLA 2K52A 2F3VA 3KLWA 1E1TA 2QEJC 1Q86C 3STBD 1XMQQ 3KBGA 5GADC 5BR8Q 4GOPC 3H91A 1J5EQ 1DONA 2F3IA 4ZK9B 4APVA 2F0HA 4DV1L 3ND9A 3TS2A 4AQYL 4WJ3M 4B3RQ 4F88A 1JOOA 1WYDA 1SSOA 3SHLA 2EIFA 3SDZA 4X6AH 3PUWA 1GUWA 4B3ML 4R4IA 4R4CA 3MZ5A 4YY3L 3NENA 2E5LL 5BN4A 4C3IH 1PZID 5IGDA 4OEMB 1X65A 4R4TA 1LT4D 1SFOB 2B63G 1R9TB 2WKCA 2B2UA 3VR6A 1U4MA 3F1ZA 3T13A 3A8JE 4LF9L 4GNXB 3TDQA 3ULJA 1KC8C 4CDCC 4IUUA 2N55A 2O4XA 4BY1B 4JPBW 3ULLA 4QQBX 3MVVA 1BDOA 3MFGA 4OWWB 1OO9B 3X3NA 1JICA 5CMDA 2NB0A 1VQIA 1A6BB 5GROA 2YTVA 1HH2P 1KDBA 4WJWA 4P2CB 4JW0A 1EOVA 3G6JB 4GLAC 1PA6A 5EQ0A 5C4ZA 4EGVA 1JR0D 2KBNA 2MQHA 4B9WA 1QUQB 5I2XA 1T5EA 1D5MC 4AYBG 1ESFA 2MHVA 4LMQD 5EBCA 1NR2A 2O2LD 4IN3A 1CZGA 2XSCA 1AZQA 1SYCA 1NBWA 1WCMB 4KN7C 1WTPA 4KKTA 1PFNA 2KOLA 2LFNA 1Y69U 2AQ3B 2XWJB 3MA2B 3TQYA 1EU4A 1LTRD 4F87A 4K2KA 2NVTB 2F03A 1Z6HA 1XYIA
chains in the Genus database with same CATH topology
1KD1C 3K80C 4PZ8A 4R4QA 5M3MG 4B3SQ 2KCTA 3FP9A 1SFOH 4LF8Q 1M90C 1KRSA 2JEAI 3GTPH 2IT1A 1D7QA 1KIXA 1R9TH 4MTNA 1FVIA 1N34L 2R7FA 1PYSB 4P72A 3K8AA 5GAGC 4HIMA 4GLXA 3U50C 3S1MH 4BBSG 4JI1Q 4JOIA 1XMOQ 5LMNL 4B3MQ 4BY1H 3GTMH 1XPRA 1K83H 3U4ZA 3OTOL 4X65L 2ZTEA 2IX0A 4YY3Q 4X64Q 3KJOA 5C3EG 2HQLA 2D0PA 2Z6KA 3HKSA 2UXBL 3PCOB 1VQAA 1AAFA 3M3YH 3A5ZB 2JA5H 2BH2A 3PGZA 1A8VA 4UPAA 4LF4Q 3UDIA 1KXLA 1MIUA 1G51A 4DV3Q 5IYBG 4A3KG 1LUZA 1UEBA 2YU9H 1I50H 4DK3C 3F2BA 4GN4B 4P73A 1WOCA 1GKHA 2N49A 1EFWA 1EIFA 4R4OA 1VQ8A 3S17H 4LF7Q 3CCUA 4LFAQ 1HNWQ 1I3QH 1TWHH 3L2PA 1PV4A 5M5XH 4PZ6A 1HNXL 5M5WH 1HNZL 2HHHL 1N33L 3U4VA 1GD7A 4DV7L 4IFDJ 1BJ6A 4X66L 1CUKA 1VCIA 2NZOA 1IBML 3S2DH 3PV0A 3H0GH 4LUVA 2WB1E 3DM3A 4X62L 1C9OA 4NPSA 1MKHA 3CCEA 2Q2TA 4QGUA 4DR6Q 1G6PA 1WWDA 2GVAA 2RHQB 3RLFA 1YJ9A 3KFUA 5EAYA 1EQQA 4JI0Q 4JI5L 4UP8A 3M4OH 4LUOA 4BY7G 1IYJB 1CKNB 2E2JH 2YSAA 1CKNA 1VQHA 3OYYA 4QL5A 3CPFA 1VQPA 1B70B 1UE7A 4IOCA 4DR5Q 3S15H 2QGQA 1E22A 2KHJA 4DAMA 2NVXH 1A0IA 4A3DG 1A63A 3K7UC 3CMAA 2E2IH 3AFPA 3M4QA 3B6YA 2R92H 4MZ9A 4A3IH 1Q3ZA 3MXNB 1TWFH 4JI3Q 3W1GA 5FLMH 2CWPA 3A5UA 2GVBA 4UY8C 3CF5A 4DUZQ 1C0AA 5IYCH 2A1AA 3DLLA 1SE8A 2XTIA 4O2DA 1X56A 4RMFA 1YEZA 2JJQA 2JA6H 4K0KL 1IBKQ 2NVYH 3TREA 1SRUA 3G6EA 1BKBA 2CCZA 4HJ8A 3CC2A 4Y7NH 2K5NA 2HIXA 3PIOA 4DV2L 3VDYA 1JMCA 4A3FG 3RN2A 1Q12A 1Q7YC 4OX9L 1FJGL 2EXFA 2Q2IA 5IYDH 4DV5Q 2MNAA 4GNXC 3T1YQ 1PH6A 3MEFA 1D8LA 3S1RH 4NXNL 3I55A 1QVFA 4JBMA 3I4MH 3J7ZC 5ELNA 4A76A 1N8RC 2JA9A 4KLKA 5FLXc 3G48A 4IFDI 1NMFA 1SLJA 2RF4A 1PFSA 5IP7G 3OW2A 4A3MH 1YBYA 4A3GG 2N8NA 1W3SA 3HOVH 3RNUA 2WAQE 3T1HQ 1O7IA 2JA7G 4C3HH 5M5YH 4HIOA 1EQRA 1MJCA 4LF5L 1N34Q 1Y1WH 1XTDA 4DR7L 1OTCA 3BU2A 1PH1A 2ZM6L 1Z9FA 3D0FA 1Z47A 1FL0A 2YV5A 3PF5A 3HOZG 5LMNQ 3ER0A 1I94L 3A0JA 2ZJQA 5JEAG 3ERSX 3OTOQ 4X65Q 1XMQL 1YZ6A 2JE6I 3A74A 1L2FA 3HOUH 2I5HA 4JI2L 2UXBQ 2AWNA 3J7A5 1CSQA 1PH3A 1S72A 3NEMA 4JG2A 1ASYA 4DR4L 1FGUA 2C35B 3KF6A 3H3VI 4WJ4A 2E8GA 1XPUA 1K8GA 3CD6A 3UE1A 3HOWG 3FHWA 2UUAL 4JI4L 1CKMA 3PUXA 4HIDA 2CKZB 4DV4L 4L5QA 3LGJA 1U5KA 4YWLA 3GO5A 1KQSA 2JZWA 2FXQA 2HHHQ 1RIPA 3RLNA 2OTLA 3J81i 4DV7Q 3GTLH 3AYHB 1L1OB 3J80i 4BA1I 4X66Q 4POFA 3RN5A 1PH2A 1IBMQ 2JA8H 4LFBL 5C4XG 1JJGA 1YVCA 2ZJRA 1EYGA 3NBHB 4X62Q 4QIWE 4IPDA 1KRTA 1PVOA 4IOAA 5M3FH 2BH8A 4BBRG 4JI5Q 1YNXA 4IPCA 4LNQA 4YWMA 2OQ0A 1Y14B 2EQSA 4KI0A 4YCVA 5H1SE 2F4VL 3ZJYC 4HJ7A 4YWKA 4KHPL 3GTOH 1Y1VG 2JK8A 3H0GG 3G71A 1TXYA 1QZGA 1K8AC 3RZOH 1M1KC 1K3RA 2UU9L 1N32Q 2WFWA 2R93H 4GLVB 3K7AH 1V1QA 5DLQE 5J3BA 4P75A 4OONA 1XPOA 1U6PA 2E5LQ 1F6UA 1Q1BA 1Q46A 3S24A 3HFZB 4JI6L 2A19A 4JV5L 4LWCA 1NY4A 4B3TL 1XNQL 3L0OA 2Y0SE 4XTCS 4LF9Q 4K0KQ 4QJFA 3CC7A 4HJAA 4DV0L 2WB1G 2R92G 2XGTA 4A3IG 4LF6L 4DV2Q 4JI8L 2ES2A 3E0EA 5FLMG 4DR1L 1PH4A 3Q8DA 2PI2A 4OX9Q 4L5TA 3CPWA 1FJGQ 2R7DA 5IYCG 1VQKA 1EWIA 4NXML 5JJIA 1WWFA 1SROA 3HOXH 3L7ZC 1IXRA 1HR0W 3S14H 4NXNQ 4MNOA 1JT8A 2UUCL 1YIJA 1B7YB 1SR3A 2IHFA 2AHOB 3W1BA 2JA6G 3CCRA 2RCNA 1WJJA 4DR3L 2Q2HA 2I5LX 3F2DA 1VQFA 4YHHL 4DR2L 1H95A 4IFDG 2RHSB 5IE8A 4LF5Q 3EN2A 4DR7Q 4A3CH 2HIVA 4DV6L 1K73C 2DGYA 2ZM6Q 2NN6I 2B29A 1BBUA 3AQQA 3M4PA 5IYDG 3CCQA 4GOPA 4GOPB 4A4IA 4DKAC 3GDEA 2QEXA 4A3JH 3F2CA 4JYAL 3I4NG 4A93G 1JJCB 5M3MH 1I94Q 2F52A 2N78A 3STBC 5JJKA 4P74A 1X3GA 2KCMA 1HR0L 1WCMH 4A3MG 3CXCA 2IHXA 1AE2A 4O0AA 4JI2Q 2AWOA 4IO9A 1IBLL 5E7NA 3K0XA 4DAYB 4A3EG 4DR4Q 2R7ZG 1IL2A 4BBSH 4LFCQ 1VQJA 1N9WA 1VQBA 3KDFB 3KDFA 2NVTH 2N3SA 1JE5A 4Y52H 1ASZA 1YJNA 2VQEL 4JI4Q 1V9PA 4B3SL 3J81c 4LF8L 2VL6A 3AFQA 3J80c 1IZ6A 3PF4A 2MO0A 1E1OA 1PYBA 1VQGA 2LXJA 4JC0A 1Q82C 3HOUG 2L4LA 3PUVA 2VQFL 3U58A 2CFMA 3ULPA 3KJPA 5IYBH 4GN5A 4A3KH 1NMGA 4OWXB 2YTYA 3HKZE 4LFBQ 2JQOA 1XMOL 1E24A 4YCUA 2K50A 2D0OA 4AIMA 3J81j 3CCSA 4JCVE 5JJLA 2OCEA 3E9HA 2AMCB 3EIVA 1TWCH 4DNIA 1PHJA 4ALPA 4LF4L 1XNRL 2F4VQ 2BA1A 3HOYG 3S1NH 1EUJA 1YITA 2UUBL 2OWOA 2JA8G 4KHPQ 2ZTCA 4GNXA 2VW9A 2PQAB 3I4OA 4IJHA 2PQAA 1YJWA 2M3ZA 2K5VA 3K81C 4BY7H 1OXVA 4HIKA 2UU9Q 4LF7L 2K14A 1YHBA 4HJ9A 3GTKH 2Z0SA 1AE3A 5M3FG 4A3BG 1K0RA 2GN5A 4TQUS 3PIPA 1VQ5A 4GKKL 5GQOA 3KOJA 5BR8L 4XIGS 2R6GA 1J5EL 1HZAA 1E7ZA 4EQ5A 4JI6Q 3FKIH 2L15A 5LMUL 3S16H 4JV5Q 3IRBA 2VUMH 3KF6B 1KAWA 1XJVA 4B3TQ 4DR6L 1NE3A 1TWGH 3SGIA 1Q8KA 5JEAJ 1P8LA 1YI2A 2NVQH 2QA4A 4OXPA 4DPGA 4DV0Q 4B3RL 4BY1G 1C7YA 4LF6Q 1LTLA 3M7NA 4JI8Q 1JB7A 1Q1EA 1KL9A 4DR1Q 1V43A 1YHAA 4BXXG 2B63H 2ID0A 1J6QA 1CSPA 1HNZQ 1HNXQ 4NXMQ 1TWAH 2JA5G 1NTGA 1N33Q 1UE6A 4DK6C 5IP9H 1L0WA 5ELOA 2UUCQ 5C44H 1MJEA 5C0XJ 1Q3YA 2MO1A 1VQDA 3BZKA 1VQ9A 1S40A 4JI3L 4A3FH 1A1TA 4DR3Q 3W5OA 1QUQA 2CWAA 4YHHQ 4DUZL 4DR2Q 1L1OC 2VZAA 1QZHA 3M85A 5IY0A 1PH8A 4JI7L 1WWEA 3PO3H 1WI5A 4DV6Q 2ALYB 3PO3G 2UXCQ 3JAMi 2UXDL 4JYAQ 3HOXG 1VQMA 1S3OA 1IBKL 4EX5A 2EXDA 1PH9A 4A3GH 2NN6G 2K4KA 1HR0Q 5FJ8H 4AYBE 1RL2A 3BZCA 4PMWA 2MFIA 3D31A 4LW1A 1IBLQ 4POGA 2A8VA 3CQZH 4GN3B 2H5XA 3CCJA 4A3CG 3S1QH 1QVGA 1UE1A 3KYHC 4JOIC 2CQFA 1WFQA 1VQEA 5HY6A 2ASBA 1CKOA 1ESKA 2E2HH 2VQEQ 3PSIA 2Z6KC 5AJ3L 1WCMG 4P71A 2PNHA 3T1HL 1EIYB 2WP8J 2VQFQ 4HJ5A 3I7FA 2NZHA 4OO1I 3CW2C 4UP7A 2CQOA 1HZ9A 2I0QA 4A3LH 4L5SA 5IT9c 2HT1A 1BVSA 3HOWH 1KHIA 2ZTDA 4NB3A 3UE0A 3GTQH 1VQ6A 1GO3E 1SMXA 3CAMA 3EBEA 3PUZA 4RG1A 3CCVA 3NELA 3CCMA 3H15A 3M9BA 5C4JH 4KHZA 2B3GA 1N36L 1XNRQ 4AH6A 5C4XH 5C0XI 1X55A 4GKJL 2UUBQ 4GS3A 1U0LA 5GAHC 1HJPA 1E3PA 2K52A 4LUZA 3JC66 3KLWA 3PO2H 1I6HH 4ME3A 4IJLA 2JEBI 4BBRH 3I4MG 1E1TA 1VQ4A 3UDGA 3UDFA 1Q86C 3STBD 4PZ7A 3I2ZA 4C3JH 5IWAL 1XMQQ 2ATWA 3S2HH 4GKKQ 5GADC 5BR8Q 4GOPC 3HOVG 2VNUD 1Y1VH 1J5EQ 1OXXK 5LMUQ 2F3IA 1Y1WG 2IY5B 2ZJPA 3CCLA 4APVA 4JBJA 4DV1L 3TS2A 4AQYL 4DUYL 3GTGH 1VQ7A 3HKZG 1GVPA 1JJ2A 5C3EH 1VQNA 2UUAQ 4B3RQ 4WJ3M 4R1JA 3G4SA 3F8TA 1OXSC 1WYDA 4DV4Q 1X3EA 1X6OA 3RLOA 3RR5A 1K9MC 4IPGA 2EIFA 4C2MH 4X6AH 1HZCA 3FKIG 1YHQA 5K36G 2WAQG 3PUWA 2VUMG 4JI1L 2OTJA 2IHEA 4B3ML 1N32L 3E9IA 4R4IA 2YYZA 4R4CA 1DGSA 1I5FA 2PI2E 4JBKA 4YY3L 3BJUA 4X64L 4L5RC 2VS1A 1LYLA 1VQCA 3NENA 4H02A 3JAMc 2E5LL 2EC7A 1VS0A 4C3IH 4JI7Q 1LM0A 3PUYA 1X65A 4R4TA 3NYBB 3TEHB 1PH5A 2B63G 1B8AA 1VQOA 2V1CC 2YTXA 1UWVA 2UXDQ 2Q2UA 4DV3L 3F1ZA 5IP9G 2D62A 4LF9L 5C44G 4GNXB 4BA2I 3ULJA 1KC8C 4IPHA 1A62A 1HNWL 3CMEA 1BBWA 3WWVA 4LFAL 3ULLA 1G291 4QQBX 4A75A 1AH9A 2PMZE 1T9HA 4OWWB 2AKWB 2LSSA 3I4NH 4A93H 4J15A 1GM5A 3TRZA 1P16A 4A3DH 1VQIA 1XNQQ 1A6BB 1SN8A 5GROA 5FJ8G 2YTVA 2OQKA 1HH2P 5AJ3Q 4A3EH 1NJIC 4JI0L 5HGQA 2R93G 2R7ZH 2LI8A 1W2BA 4FDBA 2K75A 1MFSA 2VY3A 4DR5L 4OO1G 3H3VH 3GD7A 1EOVA 1UE5A 4GLAC 1PA6A 2KHIA 4OWTB 4YCWA 1OXUA 1X54A 4QY7A 3UDXA 1Q81C 2KBNA 2MQHA 1PH7A 3CP0A 1N36Q 1QUQB 2KENA 3CC4A 2UXCL 4GKJQ 4AYBG 2K5HA 4LFCL 2DUDA 4A3LG 4BXXH 1OXTA 4JBWA 3TS0A 5C0XG 3AEVA 5GAEC 2LXKA 5IP7H 4TVAB 1HZBA 1NBWA 4PG3A 1X9NA 2BA0A 1X3FA 3RZDH 5IWAQ 3GTJH 3ICEA 4UP9A 3KF8B 3HOYH 2JA7H 2IX1A 1L1OA 3I56A 2Y0SG 3TQYA 5LMNW 1WWGA 1VQLA 4DV5L 3T1YL 2I5MX 1QVCA 3HOZH 4DV1Q 3PO2G 4A3JG 4AQYQ 4DUYQ 4A3BH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 C;  3K80 C;  4PZ8 A;  4R4Q A;  5M3M G;  4B3S Q;  2KCT A;  3FP9 A;  1SFO H;  4LF8 Q;  1M90 C;  1KRS A;  2JEA I;  3GTP H;  2IT1 A;  1D7Q A;  1KIX A;  1R9T H;  4MTN A;  1FVI A;  1N34 L;  2R7F A;  1PYS B;  4P72 A;  3K8A A;  5GAG C;  4HIM A;  4GLX A;  3U50 C;  3S1M H;  4BBS G;  4JI1 Q;  4JOI A;  1XMO Q;  5LMN L;  4B3M Q;  4BY1 H;  3GTM H;  1XPR A;  1K83 H;  3U4Z A;  3OTO L;  4X65 L;  2ZTE A;  2IX0 A;  4YY3 Q;  4X64 Q;  3KJO A;  5C3E G;  2HQL A;  2D0P A;  2Z6K A;  3HKS A;  2UXB L;  3PCO B;  1VQA A;  1AAF A;  3M3Y H;  3A5Z B;  2JA5 H;  2BH2 A;  3PGZ A;  1A8V A;  4UPA A;  4LF4 Q;  3UDI A;  1KXL A;  1MIU A;  1G51 A;  4DV3 Q;  5IYB G;  4A3K G;  1LUZ A;  1UEB A;  2YU9 H;  1I50 H;  4DK3 C;  3F2B A;  4GN4 B;  4P73 A;  1WOC A;  1GKH A;  2N49 A;  1EFW A;  1EIF A;  4R4O A;  1VQ8 A;  3S17 H;  4LF7 Q;  3CCU A;  4LFA Q;  1HNW Q;  1I3Q H;  1TWH H;  3L2P A;  1PV4 A;  5M5X H;  4PZ6 A;  1HNX L;  5M5W H;  1HNZ L;  2HHH L;  1N33 L;  3U4V A;  1GD7 A;  4DV7 L;  4IFD J;  1BJ6 A;  4X66 L;  1CUK A;  1VCI A;  2NZO A;  1IBM L;  3S2D H;  3PV0 A;  3H0G H;  4LUV A;  2WB1 E;  3DM3 A;  4X62 L;  1C9O A;  4NPS A;  1MKH A;  3CCE A;  2Q2T A;  4QGU A;  4DR6 Q;  1G6P A;  1WWD A;  2GVA A;  2RHQ B;  3RLF A;  1YJ9 A;  3KFU A;  5EAY A;  1EQQ A;  4JI0 Q;  4JI5 L;  4UP8 A;  3M4O H;  4LUO A;  4BY7 G;  1IYJ B;  1CKN B;  2E2J H;  2YSA A;  1CKN A;  1VQH A;  3OYY A;  4QL5 A;  3CPF A;  1VQP A;  1B70 B;  1UE7 A;  4IOC A;  4DR5 Q;  3S15 H;  2QGQ A;  1E22 A;  2KHJ A;  4DAM A;  2NVX H;  1A0I A;  4A3D G;  1A63 A;  3K7U C;  3CMA A;  2E2I H;  3AFP A;  3M4Q A;  3B6Y A;  2R92 H;  4MZ9 A;  4A3I H;  1Q3Z A;  3MXN B;  1TWF H;  4JI3 Q;  3W1G A;  5FLM H;  2CWP A;  3A5U A;  2GVB A;  4UY8 C;  3CF5 A;  4DUZ Q;  1C0A A;  5IYC H;  2A1A A;  3DLL A;  1SE8 A;  2XTI A;  4O2D A;  1X56 A;  4RMF A;  1YEZ A;  2JJQ A;  2JA6 H;  4K0K L;  1IBK Q;  2NVY H;  3TRE A;  1SRU A;  3G6E A;  1BKB A;  2CCZ A;  4HJ8 A;  3CC2 A;  4Y7N H;  2K5N A;  2HIX A;  3PIO A;  4DV2 L;  3VDY A;  1JMC A;  4A3F G;  3RN2 A;  1Q12 A;  1Q7Y C;  4OX9 L;  1FJG L;  2EXF A;  2Q2I A;  5IYD H;  4DV5 Q;  2MNA A;  4GNX C;  3T1Y Q;  1PH6 A;  3MEF A;  1D8L A;  3S1R H;  4NXN L;  3I55 A;  1QVF A;  4JBM A;  3I4M H;  3J7Z C;  5ELN A;  4A76 A;  1N8R C;  2JA9 A;  4KLK A;  5FLX c;  3G48 A;  4IFD I;  1NMF A;  1SLJ A;  2RF4 A;  1PFS A;  5IP7 G;  3OW2 A;  4A3M H;  1YBY A;  4A3G G;  2N8N A;  1W3S A;  3HOV H;  3RNU A;  2WAQ E;  3T1H Q;  1O7I A;  2JA7 G;  4C3H H;  5M5Y H;  4HIO A;  1EQR A;  1MJC A;  4LF5 L;  1N34 Q;  1Y1W H;  1XTD A;  4DR7 L;  1OTC A;  3BU2 A;  1PH1 A;  2ZM6 L;  1Z9F A;  3D0F A;  1Z47 A;  1FL0 A;  2YV5 A;  3PF5 A;  3HOZ G;  5LMN Q;  3ER0 A;  1I94 L;  3A0J A;  2ZJQ A;  5JEA G;  3ERS X;  3OTO Q;  4X65 Q;  1XMQ L;  1YZ6 A;  2JE6 I;  3A74 A;  1L2F A;  3HOU H;  2I5H A;  4JI2 L;  2UXB Q;  2AWN A;  3J7A 5;  1CSQ A;  1PH3 A;  1S72 A;  3NEM A;  4JG2 A;  1ASY A;  4DR4 L;  1FGU A;  2C35 B;  3KF6 A;  3H3V I;  4WJ4 A;  2E8G A;  1XPU A;  1K8G A;  3CD6 A;  3UE1 A;  3HOW G;  3FHW A;  2UUA L;  4JI4 L;  1CKM A;  3PUX A;  4HID A;  2CKZ B;  4DV4 L;  4L5Q A;  3LGJ A;  1U5K A;  4YWL A;  3GO5 A;  1KQS A;  2JZW A;  2FXQ A;  2HHH Q;  1RIP A;  3RLN A;  2OTL A;  3J81 i;  4DV7 Q;  3GTL H;  3AYH B;  1L1O B;  3J80 i;  4BA1 I;  4X66 Q;  4POF A;  3RN5 A;  1PH2 A;  1IBM Q;  2JA8 H;  4LFB L;  5C4X G;  1JJG A;  1YVC A;  2ZJR A;  1EYG A;  3NBH B;  4X62 Q;  4QIW E;  4IPD A;  1KRT A;  1PVO A;  4IOA A;  5M3F H;  2BH8 A;  4BBR G;  4JI5 Q;  1YNX A;  4IPC A;  4LNQ A;  4YWM A;  2OQ0 A;  1Y14 B;  2EQS A;  4KI0 A;  4YCV A;  5H1S E;  2F4V L;  3ZJY C;  4HJ7 A;  4YWK A;  4KHP L;  3GTO H;  1Y1V G;  2JK8 A;  3H0G G;  3G71 A;  1TXY A;  1QZG A;  1K8A C;  3RZO H;  1M1K C;  1K3R A;  2UU9 L;  1N32 Q;  2WFW A;  2R93 H;  4GLV B;  3K7A H;  1V1Q A;  5DLQ E;  5J3B A;  4P75 A;  4OON A;  1XPO A;  1U6P A;  2E5L Q;  1F6U A;  1Q1B A;  1Q46 A;  3S24 A;  3HFZ B;  4JI6 L;  2A19 A;  4JV5 L;  4LWC A;  1NY4 A;  4B3T L;  1XNQ L;  3L0O A;  2Y0S E;  4XTC S;  4LF9 Q;  4K0K Q;  4QJF A;  3CC7 A;  4HJA A;  4DV0 L;  2WB1 G;  2R92 G;  2XGT A;  4A3I G;  4LF6 L;  4DV2 Q;  4JI8 L;  2ES2 A;  3E0E A;  5FLM G;  4DR1 L;  1PH4 A;  3Q8D A;  2PI2 A;  4OX9 Q;  4L5T A;  3CPW A;  1FJG Q;  2R7D A;  5IYC G;  1VQK A;  1EWI A;  4NXM L;  5JJI A;  1WWF A;  1SRO A;  3HOX H;  3L7Z C;  1IXR A;  1HR0 W;  3S14 H;  4NXN Q;  4MNO A;  1JT8 A;  2UUC L;  1YIJ A;  1B7Y B;  1SR3 A;  2IHF A;  2AHO B;  3W1B A;  2JA6 G;  3CCR A;  2RCN A;  1WJJ A;  4DR3 L;  2Q2H A;  2I5L X;  3F2D A;  1VQF A;  4YHH L;  4DR2 L;  1H95 A;  4IFD G;  2RHS B;  5IE8 A;  4LF5 Q;  3EN2 A;  4DR7 Q;  4A3C H;  2HIV A;  4DV6 L;  1K73 C;  2DGY A;  2ZM6 Q;  2NN6 I;  2B29 A;  1BBU A;  3AQQ A;  3M4P A;  5IYD G;  3CCQ A;  4GOP A;  4GOP B;  4A4I A;  4DKA C;  3GDE A;  2QEX A;  4A3J H;  3F2C A;  4JYA L;  3I4N G;  4A93 G;  1JJC B;  5M3M H;  1I94 Q;  2F52 A;  2N78 A;  3STB C;  5JJK A;  4P74 A;  1X3G A;  2KCM A;  1HR0 L;  1WCM H;  4A3M G;  3CXC A;  2IHX A;  1AE2 A;  4O0A A;  4JI2 Q;  2AWO A;  4IO9 A;  1IBL L;  5E7N A;  3K0X A;  4DAY B;  4A3E G;  4DR4 Q;  2R7Z G;  1IL2 A;  4BBS H;  4LFC Q;  1VQJ A;  1N9W A;  1VQB A;  3KDF B;  3KDF A;  2NVT H;  2N3S A;  1JE5 A;  4Y52 H;  1ASZ A;  1YJN A;  2VQE L;  4JI4 Q;  1V9P A;  4B3S L;  3J81 c;  4LF8 L;  2VL6 A;  3AFQ A;  3J80 c;  1IZ6 A;  3PF4 A;  2MO0 A;  1E1O A;  1PYB A;  1VQG A;  2LXJ A;  4JC0 A;  1Q82 C;  3HOU G;  2L4L A;  3PUV A;  2VQF L;  3U58 A;  2CFM A;  3ULP A;  3KJP A;  5IYB H;  4GN5 A;  4A3K H;  1NMG A;  4OWX B;  2YTY A;  3HKZ E;  4LFB Q;  2JQO A;  1XMO L;  1E24 A;  4YCU A;  2K50 A;  2D0O A;  4AIM A;  3J81 j;  3CCS A;  4JCV E;  5JJL A;  2OCE A;  3E9H A;  2AMC B;  3EIV A;  1TWC H;  4DNI A;  1PHJ A;  4ALP A;  4LF4 L;  1XNR L;  2F4V Q;  2BA1 A;  3HOY G;  3S1N H;  1EUJ A;  1YIT A;  2UUB L;  2OWO A;  2JA8 G;  4KHP Q;  2ZTC A;  4GNX A;  2VW9 A;  2PQA B;  3I4O A;  4IJH A;  2PQA A;  1YJW A;  2M3Z A;  2K5V A;  3K81 C;  4BY7 H;  1OXV A;  4HIK A;  2UU9 Q;  4LF7 L;  2K14 A;  1YHB A;  4HJ9 A;  3GTK H;  2Z0S A;  1AE3 A;  5M3F G;  4A3B G;  1K0R A;  2GN5 A;  4TQU S;  3PIP A;  1VQ5 A;  4GKK L;  5GQO A;  3KOJ A;  5BR8 L;  4XIG S;  2R6G A;  1J5E L;  1HZA A;  1E7Z A;  4EQ5 A;  4JI6 Q;  3FKI H;  2L15 A;  5LMU L;  3S16 H;  4JV5 Q;  3IRB A;  2VUM H;  3KF6 B;  1KAW A;  1XJV A;  4B3T Q;  4DR6 L;  1NE3 A;  1TWG H;  3SGI A;  1Q8K A;  5JEA J;  1P8L A;  1YI2 A;  2NVQ H;  2QA4 A;  4OXP A;  4DPG A;  4DV0 Q;  4B3R L;  4BY1 G;  1C7Y A;  4LF6 Q;  1LTL A;  3M7N A;  4JI8 Q;  1JB7 A;  1Q1E A;  1KL9 A;  4DR1 Q;  1V43 A;  1YHA A;  4BXX G;  2B63 H;  2ID0 A;  1J6Q A;  1CSP A;  1HNZ Q;  1HNX Q;  4NXM Q;  1TWA H;  2JA5 G;  1NTG A;  1N33 Q;  1UE6 A;  4DK6 C;  5IP9 H;  1L0W A;  5ELO A;  2UUC Q;  5C44 H;  1MJE A;  5C0X J;  1Q3Y A;  2MO1 A;  1VQD A;  3BZK A;  1VQ9 A;  1S40 A;  4JI3 L;  4A3F H;  1A1T A;  4DR3 Q;  3W5O A;  1QUQ A;  2CWA A;  4YHH Q;  4DUZ L;  4DR2 Q;  1L1O C;  2VZA A;  1QZH A;  3M85 A;  5IY0 A;  1PH8 A;  4JI7 L;  1WWE A;  3PO3 H;  1WI5 A;  4DV6 Q;  2ALY B;  3PO3 G;  2UXC Q;  3JAM i;  2UXD L;  4JYA Q;  3HOX G;  1VQM A;  1S3O A;  1IBK L;  4EX5 A;  2EXD A;  1PH9 A;  4A3G H;  2NN6 G;  2K4K A;  1HR0 Q;  5FJ8 H;  4AYB E;  1RL2 A;  3BZC A;  4PMW A;  2MFI A;  3D31 A;  4LW1 A;  1IBL Q;  4POG A;  2A8V A;  3CQZ H;  4GN3 B;  2H5X A;  3CCJ A;  4A3C G;  3S1Q H;  1QVG A;  1UE1 A;  3KYH C;  4JOI C;  2CQF A;  1WFQ A;  1VQE A;  5HY6 A;  2ASB A;  1CKO A;  1ESK A;  2E2H H;  2VQE Q;  3PSI A;  2Z6K C;  5AJ3 L;  1WCM G;  4P71 A;  2PNH A;  3T1H L;  1EIY B;  2WP8 J;  2VQF Q;  4HJ5 A;  3I7F A;  2NZH A;  4OO1 I;  3CW2 C;  4UP7 A;  2CQO A;  1HZ9 A;  2I0Q A;  4A3L H;  4L5S A;  5IT9 c;  2HT1 A;  1BVS A;  3HOW H;  1KHI A;  2ZTD A;  4NB3 A;  3UE0 A;  3GTQ H;  1VQ6 A;  1GO3 E;  1SMX A;  3CAM A;  3EBE A;  3PUZ A;  4RG1 A;  3CCV A;  3NEL A;  3CCM A;  3H15 A;  3M9B A;  5C4J H;  4KHZ A;  2B3G A;  1N36 L;  1XNR Q;  4AH6 A;  5C4X H;  5C0X I;  1X55 A;  4GKJ L;  2UUB Q;  4GS3 A;  1U0L A;  5GAH C;  1HJP A;  1E3P A;  2K52 A;  4LUZ A;  3JC6 6;  3KLW A;  3PO2 H;  1I6H H;  4ME3 A;  4IJL A;  2JEB I;  4BBR H;  3I4M G;  1E1T A;  1VQ4 A;  3UDG A;  3UDF A;  1Q86 C;  3STB D;  4PZ7 A;  3I2Z A;  4C3J H;  5IWA L;  1XMQ Q;  2ATW A;  3S2H H;  4GKK Q;  5GAD C;  5BR8 Q;  4GOP C;  3HOV G;  2VNU D;  1Y1V H;  1J5E Q;  1OXX K;  5LMU Q;  2F3I A;  1Y1W G;  2IY5 B;  2ZJP A;  3CCL A;  4APV A;  4JBJ A;  4DV1 L;  3TS2 A;  4AQY L;  4DUY L;  3GTG H;  1VQ7 A;  3HKZ G;  1GVP A;  1JJ2 A;  5C3E H;  1VQN A;  2UUA Q;  4B3R Q;  4WJ3 M;  4R1J A;  3G4S A;  3F8T A;  1OXS C;  1WYD A;  4DV4 Q;  1X3E A;  1X6O A;  3RLO A;  3RR5 A;  1K9M C;  4IPG A;  2EIF A;  4C2M H;  4X6A H;  1HZC A;  3FKI G;  1YHQ A;  5K36 G;  2WAQ G;  3PUW A;  2VUM G;  4JI1 L;  2OTJ A;  2IHE A;  4B3M L;  1N32 L;  3E9I A;  4R4I A;  2YYZ A;  4R4C A;  1DGS A;  1I5F A;  2PI2 E;  4JBK A;  4YY3 L;  3BJU A;  4X64 L;  4L5R C;  2VS1 A;  1LYL A;  1VQC A;  3NEN A;  4H02 A;  3JAM c;  2E5L L;  2EC7 A;  1VS0 A;  4C3I H;  4JI7 Q;  1LM0 A;  3PUY A;  1X65 A;  4R4T A;  3NYB B;  3TEH B;  1PH5 A;  2B63 G;  1B8A A;  1VQO A;  2V1C C;  2YTX A;  1UWV A;  2UXD Q;  2Q2U A;  4DV3 L;  3F1Z A;  5IP9 G;  2D62 A;  4LF9 L;  5C44 G;  4GNX B;  4BA2 I;  3ULJ A;  1KC8 C;  4IPH A;  1A62 A;  1HNW L;  3CME A;  1BBW A;  3WWV A;  4LFA L;  3ULL A;  1G29 1;  4QQB X;  4A75 A;  1AH9 A;  2PMZ E;  1T9H A;  4OWW B;  2AKW B;  2LSS A;  3I4N H;  4A93 H;  4J15 A;  1GM5 A;  3TRZ A;  1P16 A;  4A3D H;  1VQI A;  1XNQ Q;  1A6B B;  1SN8 A;  5GRO A;  5FJ8 G;  2YTV A;  2OQK A;  1HH2 P;  5AJ3 Q;  4A3E H;  1NJI C;  4JI0 L;  5HGQ A;  2R93 G;  2R7Z H;  2LI8 A;  1W2B A;  4FDB A;  2K75 A;  1MFS A;  2VY3 A;  4DR5 L;  4OO1 G;  3H3V H;  3GD7 A;  1EOV A;  1UE5 A;  4GLA C;  1PA6 A;  2KHI A;  4OWT B;  4YCW A;  1OXU A;  1X54 A;  4QY7 A;  3UDX A;  1Q81 C;  2KBN A;  2MQH A;  1PH7 A;  3CP0 A;  1N36 Q;  1QUQ B;  2KEN A;  3CC4 A;  2UXC L;  4GKJ Q;  4AYB G;  2K5H A;  4LFC L;  2DUD A;  4A3L G;  4BXX H;  1OXT A;  4JBW A;  3TS0 A;  5C0X G;  3AEV A;  5GAE C;  2LXK A;  5IP7 H;  4TVA B;  1HZB A;  1NBW A;  4PG3 A;  1X9N A;  2BA0 A;  1X3F A;  3RZD H;  5IWA Q;  3GTJ H;  3ICE A;  4UP9 A;  3KF8 B;  3HOY H;  2JA7 H;  2IX1 A;  1L1O A;  3I56 A;  2Y0S G;  3TQY A;  5LMN W;  1WWG A;  1VQL A;  4DV5 L;  3T1Y L;  2I5M X;  1QVC A;  3HOZ H;  4DV1 Q;  3PO2 G;  4A3J G;  4AQY Q;  4DUY Q;  4A3B H; 
#chains in the Genus database with same CATH topology
 3UI2 A;  2SNM A;  5KYI A;  4LF8 Q;  1SFO H;  1ILQ A;  1M90 C;  1R9T H;  4MTN A;  1FVI A;  3CKI B;  1N34 L;  1PYS B;  4ODG A;  3K8A A;  5D14 A;  3U50 C;  5C3X A;  4NW2 A;  4JI1 Q;  5LMN L;  5G3L D;  4BY1 H;  3U4Z A;  4DAP A;  4X65 L;  2ZTE A;  2IX0 A;  4X64 Q;  1X3P A;  2B2T C;  5JPN C;  5C3E G;  5ELE A;  2UXB L;  1CT1 D;  1VQA A;  1AAF A;  3A5Z B;  2JA5 H;  2BH2 A;  2EJF C;  2K01 A;  3LNN A;  4K5V A;  3UDI A;  1MIU A;  2A69 D;  1G51 A;  1LO5 D;  3HS0 C;  4A3K G;  1UEB A;  4DK3 C;  1AZP A;  3OIQ A;  4GN4 B;  4HSP A;  4P73 A;  1WOC A;  3K5N A;  2KUM A;  1EIF A;  4R4O A;  1NAP A;  1F77 A;  5COR A;  1HNX L;  1IBM L;  3S2D H;  3PV0 A;  3H0G H;  2F0U A;  2WB1 E;  1C9O A;  1TWG B;  1DOM A;  1MKH A;  4PMB A;  2RHQ B;  3DXJ C;  5T1I A;  1YJ9 A;  3KFU A;  3QIA A;  2A5H A;  3QJY A;  1EQQ A;  4JI0 Q;  1CKN A;  1F2L A;  3FPP A;  2B63 B;  3QOJ A;  3DWP A;  1VQP A;  1B70 B;  4DR5 Q;  2NUC A;  3SEB A;  4DAM A;  1JWU D;  3AFP A;  2R92 H;  2CH4 A;  3OWE B;  2CWP A;  3CF5 A;  5EKL A;  3VR4 A;  3PO3 B;  5IYC H;  2A1A A;  2KHS A;  1DYQ A;  3R2T A;  3FRP B;  3GQB A;  3MXU A;  1SE8 A;  2XTI A;  1GOZ A;  2XRS D;  1YEZ A;  4V19 0;  1EEF D;  3G6E A;  2Q8R E;  3CC2 A;  2KED A;  1JMC A;  1Q12 A;  2IW3 A;  1FJG L;  1F2Z A;  1NCV A;  4BXX G;  3T1Y Q;  3BVG A;  1G2T A;  1K0S A;  2F0P A;  3D3R A;  3J7Z C;  2JA9 A;  4KLK A;  3G48 A;  1ESR A;  1MGS A;  2PYK A;  2RF4 A;  3I91 A;  5IP7 G;  3T16 A;  2N8N A;  1EZ8 A;  3J80 L;  5M5Y H;  4AYB B;  4B08 A;  1MJC A;  5C3W A;  1SNC A;  1Z9F A;  1Z47 A;  1TKW B;  3I3C A;  3HOW B;  1FL0 A;  2YV5 A;  3PF5 A;  3HOZ G;  2EJM A;  2PPB C;  1YZ6 A;  1C4Q A;  1TY2 A;  3J7A V;  2AWN A;  1CSQ A;  1HA5 A;  1PH3 A;  1ET6 A;  4DR4 L;  2DJG C;  3KF6 A;  1RCV D;  1B44 D;  2G5D A;  4HID A;  2CKZ B;  2Z4H A;  4IUN A;  4KKS A;  3GO5 A;  2SDF A;  3DEP A;  2HHH Q;  4KV6 A;  2OTL A;  1Y1V B;  3AYH B;  5KIX A;  4X66 Q;  2JA8 H;  2OEO A;  4HMI A;  4XT3 B;  4IPD A;  3EFX D;  3KUP A;  3GTG B;  3K59 A;  5C3E B;  4WOR A;  4BBR G;  1IL8 A;  1S5B D;  4YWM A;  4YCV A;  1FNW A;  1WTX A;  4YWK A;  1A3U A;  3MAQ A;  3OOC A;  2F0W A;  3RZO H;  2XN9 C;  4ILW A;  1M1K C;  4EQN A;  1QNK A;  2M00 A;  2UU9 L;  1XPO A;  1QWY A;  4OON A;  4ZUJ A;  1F6U A;  5FO9 B;  2A19 A;  2M9V A;  3R8B A;  4B3T L;  5FO8 B;  3L0O A;  4K0K Q;  5JAV A;  2OXP A;  2WV6 D;  3DHQ A;  1PTO C;  3E0E A;  5FLM G;  3GTK B;  3I90 A;  4LAA A;  1DZ1 A;  2PI2 A;  4ZAI A;  3J7A F;  2D9U A;  4NXM L;  1EWI A;  1HR0 W;  3RD4 A;  5C5M A;  4NXN Q;  1XWE A;  2UUC L;  1B7Y B;  2K1B A;  2AHO B;  1SAP A;  3P1H A;  3SK4 A;  4YHH L;  4IFD G;  2RHS B;  2EY1 A;  3EN2 A;  1C48 A;  4CJ1 B;  2ZM6 Q;  1BBU A;  3AQQ A;  4GOP A;  4DKA C;  3F2C A;  3I4N G;  1PTO F;  2KCM A;  2EYH A;  4A3M G;  1AE2 A;  1BBX C;  3K0X A;  1LTT D;  3K57 A;  2PZU A;  3NSW A;  5DEH A;  3SXH A;  1YJN A;  3J81 c;  3AFQ A;  2RVL A;  3HOU G;  3U58 A;  3FEW X;  1EY4 A;  1PRT B;  2CFM A;  2F0K A;  2XWB B;  4HTH A;  4A3K H;  2B2U C;  2YTY A;  1ENA A;  3SK6 A;  2LMC B;  5D3I B;  1G8Z D;  1XMO L;  3HOZ B;  4KN4 C;  4G7Z C;  2AMC B;  1TWC H;  3GTP B;  1B2T A;  1IW7 C;  1PHJ A;  4ALP A;  3MHB A;  4LF4 L;  4FYD A;  3KLR A;  3T56 B;  5CV9 A;  1SXT A;  1YIT A;  1TY0 A;  5JVH 3;  2A6H C;  4GNX A;  3I4O A;  4DNR B;  3K81 C;  3GTM B;  1OXV A;  4LF7 L;  1ZKO A;  2FHT A;  3GTK H;  1AE3 A;  5M3F G;  2EXZ A;  2KCC A;  2OT2 A;  1A2U A;  2GN5 A;  4TQU S;  1VQ5 A;  2A73 B;  3M3Y B;  4E6I A;  4CJ0 B;  1HZA A;  5LMU L;  2EJG C;  4JV5 Q;  1RF2 D;  3IRB A;  2VUM H;  2BOS A;  1Q8K A;  3ERQ A;  2C9O A;  1P8L A;  1I6H B;  3IKJ A;  4LF6 Q;  1LTL A;  3NWT A;  1Q1E A;  1KL9 A;  2R3Z A;  4DR1 Q;  1SNM A;  5M5X B;  1CHP D;  1F9Q A;  1HNZ Q;  1NTG A;  1N33 Q;  4DFA A;  2FIN B;  4MIU A;  5C44 H;  5C0X J;  1Q3Y A;  2MO1 A;  1WTO A;  2F0N A;  4CDE C;  1S40 A;  1G2S A;  3HP3 A;  2PQE A;  1QUQ A;  4DR2 Q;  4JI7 L;  1PH8 A;  2CW0 C;  5IY0 A;  3VR5 A;  3M85 A;  2EYF A;  4I65 A;  1K3B C;  4JYA Q;  1NR4 A;  1JB3 A;  2E74 C;  3NUC A;  1KAB A;  2QF7 A;  5FJ8 H;  4AYB E;  2E2I B;  2O5I C;  2FFK B;  1BXT A;  2MFI A;  4POG A;  2A8V A;  4DAV A;  4OIJ A;  1ZXT A;  3KYH C;  1EY8 A;  2VQE Q;  1RDP D;  3Q23 A;  3R2I A;  1S5D D;  5J22 A;  2B2T A;  3C3L A;  4A3L H;  5CV6 A;  1BCP C;  1CZW A;  1V1O A;  2L11 A;  1KHI A;  3BVM A;  3S1R B;  5C0X H;  3IAY A;  1CK1 A;  5E1F A;  3I4N B;  3I4M B;  3ITP A;  4NB3 A;  3A56 A;  3UE0 A;  2PW7 A;  3PMF A;  2RDH A;  1VQ6 A;  1GO3 E;  3EBE A;  3PUZ A;  3CCV A;  4A3M B;  4PQX A;  3NPP A;  1DCZ A;  4KHZ A;  2PW5 A;  1XNR Q;  2B2W A;  2K05 A;  1QOH A;  4LUZ A;  1I6H H;  1VF7 A;  4QF4 A;  4BBR H;  4XT1 B;  3UDG A;  1EY9 A;  3UDF A;  1B1Z A;  3K5L A;  1ILP A;  5IWA L;  3HOU B;  2WII B;  3I2Z A;  1BCP F;  3S2H H;  4GKK Q;  4DXF A;  3E5S A;  4O1N A;  1WTW A;  1Y1W G;  1GJX A;  3HKZ G;  2ZT9 C;  1GVP A;  2UUA Q;  3G4S A;  1H9J A;  3F8T A;  2LKV A;  4DV4 Q;  4FF4 A;  1X6O A;  1S4Z A;  1SBB B;  1HZC A;  3FKI G;  5K36 G;  1ZEQ X;  4JBK A;  2K03 A;  1DGS A;  1I5F A;  3FMC A;  1BUV T;  4H02 A;  5M3F B;  3JAM c;  2EC7 A;  2DNE A;  3PUY A;  2Z4I A;  4EVO A;  1B8A A;  2VB2 X;  2YTX A;  1KAA A;  2Q2U A;  4BA2 I;  3S1M B;  4TSS A;  3LWU A;  4TRD A;  1XX8 A;  4IPH A;  1A62 A;  4TKO B;  3WWV A;  4LFA L;  4A75 A;  1D6E C;  1AH9 A;  1T9H A;  2LSS A;  3I4N H;  3TRZ A;  1VMC A;  1S5E D;  2MGS A;  1XNQ Q;  2K5D A;  1NJI C;  2R93 G;  5DM7 3;  4FDB A;  1FGB D;  5M5W B;  2RSO A;  2VY3 A;  5FK9 C;  3GD7 A;  3A8K E;  1UE5 A;  4DK1 A;  2KHI A;  4HED A;  4O42 A;  4YCW A;  2JYO A;  4QY7 A;  3UDX A;  1Q81 C;  4L63 B;  4Q5V A;  1PH7 A;  3CP0 A;  2KEN A;  3CC4 A;  4GKJ Q;  4LFC L;  2DUD A;  3NWS A;  4Q0F A;  1A15 A;  1OXT A;  3EVQ A;  2EDG A;  2L1B A;  4FXK C;  3TS0 A;  1JQY D;  2CHB D;  5GAE C;  2F0J A;  1FR3 A;  1X9N A;  3A7A B;  2NVX B;  1X3F A;  3ICE A;  3KF8 A;  2JA7 H;  1TWF B;  1E2Z A;  4DV5 L;  2I5M X;  5LL6 S;  1AN8 A;  4DV1 Q;  3PO2 G;  1JC7 A;  4AQY Q;  4A3J G;  1TS5 A;  2Z1C A;  4DU9 A;  4X3S A;  2KCT A;  1MHW C;  2EYP A;  3FP9 A;  4N9P A;  1KRS A;  4C3J G;  3DMU A;  3TN2 A;  1EY5 A;  2Z8L A;  4J1M A;  3S1M H;  1QG7 A;  2I46 A;  4RHR A;  4B3M Q;  1K83 H;  1HXY D;  4YY3 Q;  1SYF A;  2D0P A;  2Z6K A;  2Q8I B;  3PGZ A;  1A8V A;  3S1N B;  1Y1W B;  4B9X A;  5IYB G;  4RGO S;  2JP1 A;  3HKZ B;  5EGT A;  1GKH A;  3OMG A;  1K8M A;  1EFW A;  1I3Q H;  3L2P A;  1PV4 A;  4PZ6 A;  5M5W H;  1D1K A;  5G3L F;  2HDL A;  4DV7 L;  4RGM A;  2NZO A;  1VCI A;  3FKI B;  1Q8I A;  3TZU A;  1WWD A;  1CHQ D;  2NVQ B;  2OTJ A;  1AP0 A;  1FYC A;  4UP8 A;  2PNR C;  3M4O H;  2E2J H;  4K8I A;  1HFG A;  1B9N A;  2K5Q A;  1BF4 A;  4K14 A;  2F0T A;  1IKL A;  4A3D G;  2NVX H;  1A0I A;  4KD4 A;  3CMA A;  3M4Q A;  4A3I H;  3LWE A;  1TWF H;  1LTI D;  3W1G A;  4DUZ Q;  1SYE A;  1C0A A;  3DLL A;  1A6X A;  1K28 A;  4DGZ A;  1AW7 A;  4O2D A;  2KA7 A;  2K04 A;  1STE A;  1CA6 A;  2JA6 H;  1CM9 A;  1WTH A;  1HTL D;  4LJZ C;  3TRE A;  4UAI A;  2CCZ A;  2A68 C;  2R93 B;  2EYO A;  3VDY A;  4A3F G;  1QCB D;  4OX9 L;  2WIN B;  4FXG C;  4RWS C;  5IYD H;  2MNA A;  2VB3 X;  4GNX C;  4ZKB B;  1PH6 A;  1QVF A;  3PO3 G;  3I55 A;  4JBM A;  4A76 A;  4IFD I;  3WDN A;  1PFS A;  3OW2 A;  1YBY A;  5KGU A;  5E3F A;  4KD3 A;  3M4Y A;  2X6L A;  4LF5 L;  1N34 Q;  1Y1W H;  3VYR A;  4DR7 L;  1OTC A;  3BU2 A;  3D4W A;  2IL8 A;  2VXW A;  3D0F A;  4DF7 A;  1YNN D;  5LMN Q;  1I94 L;  1LTG D;  2ZJQ A;  3ERS X;  3GTQ B;  3EQL C;  4X65 Q;  3SR1 A;  1XMQ L;  2JE6 I;  2UXB Q;  1L2F A;  2I5H A;  3J7A 5;  1MSG A;  3NEM A;  5CYU A;  2HCI A;  1ASY A;  1D5Z C;  1FGU A;  1TQO A;  4WJ4 A;  1XPU A;  5TSS A;  3PO2 B;  4A3J B;  5IGG A;  2GA4 B;  3HOW G;  1EQV A;  4JI4 L;  1CKM A;  3PUX A;  5KND A;  4L5Q A;  4C3J B;  1KQS A;  2JZW A;  4QUC A;  3AMU A;  3U9S A;  3KLS A;  1EFI D;  4KTA A;  3J80 i;  3I73 A;  4BA1 I;  1IBM Q;  4POF A;  3RN5 A;  4LFB L;  5C4X G;  2LY7 A;  3WOF A;  1EYG A;  3NBH A;  1SYD A;  4OHJ A;  2BH8 A;  2RA4 A;  2F4V L;  1VF5 C;  1Y1V G;  1QZG A;  1TXY A;  3FVQ A;  1N32 Q;  2R93 H;  3IFD A;  4P75 A;  5I6Y A;  1Q1B A;  1Q46 A;  2X6G A;  1IYU A;  3NQT A;  3S24 A;  4FO2 A;  4LWC A;  1NY4 A;  2MJ8 A;  4XQN A;  4KJN A;  4CGY B;  1E2V A;  2B2W C;  3Q8D A;  1FJG Q;  2R7D A;  1B4O A;  1SRO A;  1IXR A;  4RA8 A;  2O5J C;  3BDO A;  1SR3 A;  4A3D B;  3VA5 A;  5FLX E;  2XNA C;  3CCR A;  4HN7 A;  2I5L X;  3F2D A;  1VQF A;  1ICW A;  1H95 A;  1EY0 A;  5IE8 A;  3HGB A;  4A3C H;  1K73 C;  4L5S A;  5C6A A;  2B29 A;  3M4P A;  4A3J H;  1U6P A;  3OIP A;  5FOB B;  4A93 G;  3MFY A;  2F52 A;  2N78 A;  3MXP A;  4P74 A;  5F2D A;  1HR0 L;  1WCM H;  1DXM A;  4O0A A;  2AWO A;  2X69 A;  1IBL L;  3Q0A A;  4A3F B;  4DAY B;  4DR4 Q;  2R7Z G;  1IL2 A;  4CBV A;  3BYY B;  2FMC A;  3KDF A;  1BR9 A;  3NTH A;  3QB3 A;  2NVT H;  4Y52 H;  1ASZ A;  3Q6S A;  4HMJ A;  4IUV A;  1IHZ A;  4LF8 L;  3PF4 A;  1IZ6 A;  2L4L A;  1E1O A;  1Q82 C;  3X3M A;  1JWM D;  2A68 D;  3ULP A;  2SNS A;  5IYB H;  4OWX B;  3HKZ E;  1O78 A;  3OSO A;  2MUY A;  3CCS A;  1RKN A;  5JJL A;  3E9H A;  2OCE A;  1JE4 A;  1HRJ A;  2K28 A;  4DNI A;  5JJZ A;  1EUJ A;  2UUB L;  1BNZ A;  1G91 A;  2NYZ D;  2PQA B;  2M3Z A;  2K5V A;  1SNQ A;  4K5W A;  5KYL A;  2UU9 Q;  1AEX A;  4A3B G;  1PZK D;  3PIP A;  1LAB A;  5GQO A;  3A54 A;  1ROD A;  5C4X B;  1E7Z A;  4FF1 A;  4X3K A;  2DN8 A;  2F4I A;  2EPB A;  1NE3 A;  1TWG H;  4B3T Q;  4IAL A;  2BCO A;  3PIP 3;  3S17 B;  1JB7 A;  3QG1 A;  1STN A;  3H94 A;  1YHA A;  2B63 H;  2L4N A;  1J6Q A;  1CSP A;  4NXM Q;  3QO2 A;  1UE6 A;  1L0W A;  4XYQ A;  2UUC Q;  3TSS A;  1MJE A;  1I4P A;  1LTS D;  4C1N I;  4A3F H;  1A1T A;  4YHH Q;  1LLR D;  3H6M A;  2HQE A;  3PO3 H;  2ALY B;  2UXD L;  3HOX G;  5LHY 1;  3D4R A;  1XTC D;  1VQM A;  1EY7 A;  1KTK A;  1PXU A;  3BZC A;  4PMW A;  3D31 A;  2QCP X;  2NBF A;  1RTO A;  2NTS A;  1FD7 D;  2H5X A;  1WTQ A;  1M8A A;  2CQF A;  5HY6 A;  5LL6 X;  2ASB A;  1CKO A;  4RFB A;  2SEB D;  2NVY B;  2Z6K C;  4F8M A;  5AJ3 L;  4FXD A;  1H9S B;  4Y7N B;  3F2U A;  5NUC A;  2NZH A;  3CW2 C;  1U4P A;  3K5O A;  4UP7 A;  5IT9 c;  1BVS A;  4PV1 C;  3HOW H;  5JVG 3;  4A93 B;  1PLF A;  4IUR A;  1MI2 A;  3D4D A;  3JAM E;  4RG1 A;  3NEL A;  4CKE A;  3HOV B;  3CCM A;  2HCC A;  1PTO B;  2B3G A;  3BDC A;  1N36 L;  5C4X H;  2NZ1 D;  2R7Z B;  1SYG A;  1X3Q A;  2KQ3 A;  5GAH C;  1E3P A;  4I7A A;  4R8I A;  5CBE E;  3W3A A;  3I4M G;  1VQ4 A;  3ERO A;  2ATW A;  1Y1V H;  4F7X A;  1OXX K;  5LMU Q;  5E4W C;  2IY5 B;  2F1M A;  2ZJP A;  4JBJ A;  4DUY L;  3GTG H;  5ELC A;  1D2B A;  1VQ7 A;  4YIJ A;  1VQN A;  5C3E H;  4R1J A;  3I4L A;  5KRU A;  1HQM C;  2HDM A;  3RZD B;  1X3E A;  3GTJ B;  5CBA E;  1Y8P B;  2F0M A;  4OGQ C;  1K9M C;  2EZV A;  5A2Q E;  3T51 B;  5C4H A;  1VMP A;  2IHE A;  3E9I A;  2YYZ A;  2UXC L;  2RSN A;  1GUG A;  2VS1 A;  1LYL A;  1VQC A;  4A3B B;  1PRT C;  4EQP A;  4JI7 Q;  3NYB B;  3TEH B;  1II3 A;  2IPK D;  1VQO A;  3GTO B;  4DV3 L;  2EE1 A;  5IP9 G;  2D62 A;  1JCK B;  2SOB A;  2EOT A;  3HEJ A;  4MHE A;  4OL7 A;  1QJO A;  5KEE A;  3VYS A;  5CR3 A;  3WOE A;  1HNW L;  5EBD A;  3CME A;  3K7A B;  1G29 1;  1W6J A;  2DY7 A;  4ZCK A;  4K6L A;  1Y8O B;  2AKW B;  2ZXO A;  4A93 H;  3G7L A;  1P16 A;  1H9M A;  4BWG B;  1CQF A;  4IZ8 A;  4C56 C;  3FDT A;  1WD0 A;  2YU9 B;  2OQK A;  2R7Z H;  2LI8 A;  1AFP A;  2EVB A;  2K6A A;  2Z6B A;  4IUQ A;  3R93 A;  1K8O A;  1MFS A;  4HCS A;  3HOX B;  3S14 B;  3SE0 A;  1CI3 M;  3H3V H;  4NP5 A;  5ISR A;  1OXU A;  1X54 A;  5FO7 B;  5EKI A;  1PFB A;  2F3W A;  5I6W A;  2K5H A;  2F0Q A;  4BXX H;  2K32 A;  2BE5 C;  5HGT A;  1A3V A;  3N52 A;  2P5Z X;  5I2Y A;  5IP7 H;  4TVA B;  1HZB A;  3RZD H;  5IWA Q;  3GTJ H;  5I9P A;  4UP9 A;  3U9O A;  2IX1 A;  3I56 A;  1WWG A;  1VQL A;  1QVC A;  3MEH A;  3HOZ H;  4K6D A;  4QB4 A;  4A3B H;  4N9T A;  1KD1 C;  3K80 C;  4PZ8 A;  4B3S Q;  2B8G A;  3C1F A;  1WTV A;  3GTP H;  2JEA I;  4EQO A;  2IT1 A;  1TII D;  1KIX A;  4XYO A;  3AU7 A;  5GAG C;  4HIM A;  1TS4 A;  4R8N A;  5ELF A;  1SEB D;  3A55 A;  2CQA A;  3GTM H;  1XPR A;  3OTO L;  1DOK A;  1Z7T A;  4HAE A;  2J0T D;  3Q22 A;  3M3Y H;  2H4O A;  2YU9 H;  3ZYY X;  1F2M A;  3F2B A;  2N49 A;  1VQ8 A;  4LFA Q;  4ZKC B;  5M5X H;  1I4H A;  1HNZ L;  1ONL A;  4IFD J;  1N33 L;  3U4V A;  1BJ6 A;  3DM3 A;  4X62 L;  5T1G A;  2Q2T A;  4QGU A;  4DR6 Q;  2GVA A;  4FF3 A;  4JI5 L;  4BY7 G;  4LUO A;  2YSA A;  1IYJ B;  1CKN B;  1VQH A;  4NMZ A;  5A35 A;  1PYW D;  3GTL B;  4IOC A;  2LS0 1;  2KHJ A;  1Q90 A;  1A63 A;  2L0C A;  3K7U C;  1EIG A;  4XDX A;  2E2I H;  3B6Y A;  3MXN B;  1ENF A;  4DAY A;  5FLM H;  3A5U A;  1O7Z A;  4JI3 Q;  2B2V A;  2GVB A;  4UY8 C;  4HCE A;  1PRT D;  5C5L A;  1B50 A;  2QDL A;  4X3U A;  4DK0 A;  4RMF A;  2JJQ A;  4KHV A;  3RMH A;  3P20 A;  2JN4 A;  1IBK Q;  1SRU A;  1BKB A;  4HJ8 A;  3NTI A;  4IFD H;  2K5N A;  2AUJ D;  2HIX A;  3PIO A;  4DV2 L;  3CQZ B;  4IUP A;  1Q7Y C;  4DV5 Q;  3MEF A;  1D8L A;  1SNO A;  3S1R H;  3I4M H;  4K8J A;  1BOS A;  1EWC A;  1HA6 A;  1SLJ A;  4A3M H;  3D8G A;  5CC4 A;  3PIO 3;  1W3S A;  2WAQ E;  4C1N K;  3T1H Q;  1O7I A;  1GHK A;  1XTD A;  1LT6 D;  2CVR A;  1T5X D;  1YNN C;  3ER0 A;  3A0J A;  2DJF C;  3DWQ A;  5JEA G;  4KY5 A;  3A74 A;  4J6H A;  4K5X A;  3HOU H;  1EOT A;  2PCF B;  4JI2 L;  3NHH A;  4DN4 M;  1S72 A;  1YNJ C;  5FLX L;  5C4J B;  2C35 B;  3H3V I;  5I4D A;  2HD3 A;  1I4Q A;  2BE5 D;  2UUA L;  2TMP A;  4DV4 L;  2N88 A;  4YWL A;  1LT3 D;  5IGB A;  2FXQ A;  3GTL H;  3RLN A;  4DV7 Q;  2DNC A;  1L1O B;  1JJG A;  4KJO A;  1SMY D;  1YVC A;  2C5C A;  4QIW E;  1J8I A;  1KRT A;  5M3F H;  3GV3 A;  2RKS A;  4LNQ A;  2OQ0 A;  1Y14 B;  4KI0 A;  3DM1 A;  3V05 A;  5H1S E;  1E2W A;  3I8Z A;  1I4X A;  4KHP L;  3H0G G;  3G71 A;  1K8A C;  3MWY W;  5EKK A;  1K3R A;  5COY A;  1ZYR C;  4GLV B;  5J3B A;  5DLQ E;  4CKB A;  2E5L Q;  3TP8 A;  4KKU A;  4UHV A;  4JI6 L;  1STG A;  2CH4 W;  3ND8 A;  1XNQ L;  2F0F A;  2Y0S E;  4XTC S;  4LF9 Q;  3A8I E;  1DM0 B;  3NP8 A;  4HJA A;  4DV0 L;  2R92 G;  4BY7 B;  2XGT A;  2ES2 A;  4JI8 L;  4XXE A;  1PH4 A;  3I70 A;  2PO4 A;  4OX9 Q;  4L5T A;  3CPW A;  1FNU A;  3VA7 A;  1H9R A;  5IYC G;  1VQK A;  2EY5 A;  4PNY A;  3SK5 A;  3S9W A;  1WWF A;  4MNO A;  4H44 C;  4OEL B;  3S16 B;  2IHF A;  5IGF A;  4ZLT F;  2RCN A;  5IIF A;  3BG3 A;  4DR3 L;  2Q2H A;  4G7O C;  1CFM A;  4LF5 Q;  1EY6 A;  4DR7 Q;  2HIV A;  4DV6 L;  2DGY A;  4GOP B;  1TU2 B;  3GDE A;  2PMZ B;  1I94 Q;  2EY2 A;  1QE6 A;  4HR7 B;  2IHX A;  2EYL A;  4IO9 A;  1F9P A;  3VR2 A;  4A3E G;  1A3T A;  3C46 A;  1UEA B;  1VQJ A;  1N9W A;  1VQB A;  2I07 B;  4ABN A;  5I9O A;  1JE5 A;  1L0X B;  2E75 C;  2J4X A;  4JI4 Q;  1V9P A;  3DWA A;  4JK1 C;  4GZY C;  2VL6 A;  3J80 c;  1XXG A;  4JC0 A;  1SNP A;  1HHV A;  2R61 A;  2VQF L;  3AB9 A;  3KJP A;  2J7Z A;  1NMG A;  4LFB Q;  2F0L A;  1E24 A;  1UUP A;  2A6E C;  2FJ2 A;  1DD2 A;  4KY7 A;  2D0O A;  1WTR A;  3J81 j;  1EWH A;  2G9D A;  3TME A;  2RCF A;  1BO0 A;  3DUZ A;  3EIV A;  3KLS X;  3TP6 A;  2E2H B;  3LX0 A;  3BZD B;  1BQQ T;  2RQX A;  2IWH A;  4R9W A;  1U4L A;  2BA1 A;  2F4V Q;  4DNT B;  3HOY G;  5DAU A;  3OWF A;  3S1N H;  2OWO A;  4H13 C;  2JA8 G;  3OMC A;  1S5C D;  1UNS A;  4L6T B;  4BY7 H;  3HZX A;  2K14 A;  1YHB A;  2XRQ D;  4HJ9 A;  2B2Y A;  4N8F A;  2Z9H A;  4G57 A;  2JA5 B;  5BR8 L;  3JAM L;  1J9O A;  4Z9C B;  2R6G A;  3K0Y A;  3EJI A;  3TP7 A;  1D5X C;  1YNJ D;  1J5E L;  3FKI H;  2L15 A;  3S16 H;  5K36 H;  1KAW A;  4J8Q A;  5JEA J;  4CKC A;  1YI2 A;  2NVQ H;  1M4V A;  1STH A;  5HUR A;  4DPG A;  3BS1 A;  2QA4 A;  4B3R L;  1B3A A;  3P75 A;  1V43 A;  5IT9 E;  2ID0 A;  1KNA A;  1HNX Q;  3S2D B;  2KCN A;  4DK6 C;  4V0B A;  3H0G B;  5ELO A;  1SE2 A;  3TP5 A;  1VQD A;  3BZK A;  2BDN A;  1KLG D;  2F0S A;  4DUZ L;  1QZH A;  1EQT A;  1SE4 A;  2VZA A;  2F0D A;  1WWE A;  1WI5 A;  1HPC A;  3SVM A;  4C2M B;  1S3O A;  4H7B A;  1JOK A;  4EX5 A;  2EXD A;  4IQZ A;  1H9K A;  2NN6 G;  4ID6 A;  5A2Q L;  1HR0 Q;  2R92 B;  5CV8 A;  4LW1 A;  1L0Y B;  1IBL Q;  1EL0 A;  1ZYR D;  3RUZ A;  1CQV A;  1R4Q B;  1QVG A;  1UE1 A;  5JEA H;  1ESK A;  2E2H H;  1RD9 D;  1STA A;  3PSI A;  2PZW A;  3J81 E;  1D1I A;  4P71 A;  3C1E A;  1O7Y A;  1V1P B;  4UDU C;  1SJH D;  2WP8 J;  1EIY B;  2FMM A;  2CQO A;  1HZ9 A;  1F9R A;  1PDQ A;  1HCZ A;  1V8Q A;  3BDL A;  3VYT A;  1SND A;  2ZTD A;  3HRZ C;  3GTQ H;  1SMX A;  1O80 A;  4S3S A;  5ELB A;  4A3E B;  4AH6 A;  3I72 A;  5M5Y B;  2E2D C;  2UUB Q;  4MTK A;  1U0L A;  4IUT A;  1HJP A;  3JC6 6;  2D2C C;  3BYT B;  3PO2 H;  4ME3 A;  2K7V A;  2JEB I;  4IJL A;  1IYV A;  4KK7 A;  3K5M A;  1E0B A;  2F0V A;  5KNC A;  4PZ7 A;  3SK8 A;  4C3J H;  1GHJ A;  1I6V C;  3HOV G;  2VNU D;  2XVS A;  1MBY A;  4C3H G;  3CCL A;  2M2L A;  5M9O A;  1GUN A;  1HFN A;  3IL8 A;  1JJ2 A;  4U68 A;  2B2V C;  1OXS C;  3DEO A;  5EPL A;  3RLO A;  3RR5 A;  3OW7 A;  4DXG A;  3HOY B;  2EYM A;  4IPG A;  2JA8 B;  4C2M H;  2F0G A;  1YHQ A;  2WAQ G;  2VUM G;  3NE5 B;  4JI1 L;  4OIK A;  1N32 L;  5DM6 3;  1C8C A;  2A6E D;  3GP7 A;  1JWS D;  2PI2 E;  4X64 L;  3MXN A;  3BJU A;  1EU3 A;  2B8F A;  4L5R C;  1Y8N B;  1VS0 A;  1LM0 A;  1PH5 A;  4ZUI A;  1MSH A;  2V1C C;  1UWV A;  2UXD Q;  1ICF B;  5C44 G;  3RZO B;  1IKM A;  1STB A;  4JVZ A;  1BBW A;  4CJ2 C;  2PMZ E;  1PZJ D;  2BDO A;  3P7J A;  4MN3 A;  4J15 A;  2K33 A;  1GM5 A;  4ZQ3 A;  2G9H D;  1SYB A;  5EPK A;  4A3D H;  1SN8 A;  5FJ8 G;  1I50 B;  5AJ3 Q;  1NNX A;  4A3E H;  4JI0 L;  5HGQ A;  3K6O A;  1W2B A;  1TWH B;  2K75 A;  2QDB A;  3MTS A;  4DR5 L;  2D5D A;  4OO1 G;  4L8J A;  5IGE A;  4OWT B;  1F2Y A;  4KMU C;  1TT2 A;  5CV4 A;  3R3O A;  1N36 Q;  1UAP A;  4N8X 1;  2ICI A;  4KY6 A;  4A3L G;  4JBW A;  2PZT A;  1Q3L A;  5C0X G;  3AEV A;  3D6C A;  1TVX A;  2LXK A;  3S15 B;  1CA5 A;  4PG3 A;  4QUF A;  3A7L A;  1I4R A;  2BA0 A;  3T53 B;  4G4K A;  3HOY H;  3KF8 B;  1ENC A;  1DJR D;  1L1O A;  1GUO A;  1LT5 D;  5CGK A;  2Y0S G;  5LMN W;  5J39 A;  3URY A;  5J1Z A;  3T1Y L;  1R4P B;  1S5F D;  1LV9 A;  4DUY Q;  1KLU D;  5IOC A;  2ICE C;  4R4Q A;  5M3M G;  1DOL A;  2WKD A;  2JXM B;  1D7Q A;  2AUK A;  2RDG A;  3KK7 A;  4X3T A;  2R7F A;  4P72 A;  4GLX A;  4A3K B;  1WVL A;  4HSV A;  4BBS G;  4JOI A;  1XMO Q;  5FKA C;  2UXC Q;  3KJO A;  5DNF A;  2HQL A;  3HKS A;  1TWC B;  3PCO B;  4UPA A;  4NDX A;  1QIL A;  4LF4 Q;  3V2T A;  1KXL A;  4C3H B;  4DV3 Q;  1SDF A;  1LUZ A;  4NKL A;  1I50 H;  1HNW Q;  3S17 H;  4LF7 Q;  3CCU A;  1MD2 D;  3VR3 A;  1TWH H;  2HHH L;  3E0J A;  1GD7 A;  4K2L A;  4X66 L;  1CUK A;  4LUV A;  2NN6 H;  2WAQ B;  2VUM B;  4FVM A;  3H3V C;  3M7G A;  4NPS A;  2AQ2 B;  3CCE A;  1G6P A;  3RLF A;  4RKL A;  5EAY A;  1B3Q A;  3OYY A;  4QL5 A;  4RCN A;  3CPF A;  2KJX A;  3HG9 A;  3VYU A;  1UE7 A;  1TR5 A;  3ONA B;  3S15 H;  2QGQ A;  1E22 A;  5C44 B;  1EIH A;  1FNV A;  2KEC A;  4MZ9 A;  1Q3Z A;  2E76 C;  5BN5 A;  5D3D A;  3FPU B;  4M8A A;  1X56 A;  1W6K A;  4K0K L;  2NVY H;  3E3X A;  3V96 A;  4M1U B;  1VDZ A;  4Y7N H;  2L5T A;  4QIW B;  3K58 A;  1QNU A;  3RN2 A;  3L9A X;  2EXF A;  2Q2I A;  3NK9 A;  4NXN L;  5BN3 A;  2TSS A;  5ELN A;  1N8R C;  2F0I A;  5FLX c;  5CV7 A;  1NMF A;  1SE3 A;  1PRT F;  2B2Y C;  4A3G G;  1TS3 A;  3HOV H;  3RNU A;  3CHB D;  1PTO H;  2JA7 G;  4C3H H;  4HIO A;  1EQR A;  1PH1 A;  2ZM6 L;  2OF1 A;  3CRK C;  4RGN A;  4XQJ A;  1I4G A;  3T4A C;  3OTO Q;  3QOL A;  1JOR A;  3O13 A;  5E4X A;  3W2D A;  4JG2 A;  2Y0S B;  2K5W A;  2E8G A;  1K8G A;  2HUG A;  4ZYS A;  3CD6 A;  1GXD C;  3UE1 A;  3FHW A;  4CHT B;  4BBR B;  2L12 A;  5M3M B;  1B9M A;  2ZXR A;  3LGJ A;  1U5K A;  3S2H B;  1CTM A;  1RIP A;  4FNF A;  3J81 i;  1PH2 A;  1SMY C;  3OPO A;  2ZJR A;  3NBH B;  2RBM A;  4BBS B;  4X62 Q;  3OHX C;  5D65 A;  2F0O A;  1PVO A;  4IOA A;  5AFW A;  1HQR D;  1LTB D;  4JI5 Q;  1YNX A;  2A74 C;  4IPC A;  1EZ6 A;  1RHP A;  2EQS A;  1X32 A;  3ZJY C;  4HJ7 A;  5JOB A;  2WAC A;  2IX3 A;  3GTO H;  3IFT A;  2JK8 A;  3Q24 A;  3MXG A;  1PMR A;  2WFW A;  5IGC A;  1EYD A;  2V4D A;  3K7A H;  1V1Q A;  2NTT A;  3QWN A;  4PMC A;  4OO1 H;  3HFZ B;  4WRD A;  5L37 A;  4JV5 L;  1BCP B;  2IJ0 A;  1G6Z A;  3J80 E;  4QJF A;  1V1P A;  3CC7 A;  2WB1 G;  4A3I G;  4LF6 L;  4DV2 Q;  2MPM A;  4DR1 L;  1PTO D;  4FF2 A;  4C3I G;  5JJI A;  5EPJ A;  2Q8T A;  3HOX H;  3S14 H;  3L7Z C;  1HUM A;  1STY A;  1JT8 A;  1YIJ A;  1PFM A;  3W1B A;  2JA6 G;  4I7Z C;  5IOD A;  1WJJ A;  4DR2 L;  2DY8 A;  4DA2 A;  2NN6 I;  1HTP A;  5IYD G;  3CCQ A;  4JYA L;  4A4I A;  2QEX A;  1TWA B;  5IT9 L;  1JJC B;  5M3M H;  4RCO A;  5CV5 A;  3STB C;  5JJK A;  3C2P A;  1X3G A;  3N6R A;  3CXC A;  2EY6 A;  4JI2 Q;  5E7N A;  4BBS H;  3TZD A;  4LFC Q;  3NXW A;  3KDF B;  3EA6 A;  4BS9 A;  2N3S A;  3BVZ A;  4RH6 A;  2VQE L;  4B3S L;  3TBI B;  4A3G B;  2MO0 A;  2LXJ A;  1PYB A;  1VQG A;  3GV6 A;  3PUV A;  2JA7 B;  1B53 A;  3QR8 A;  3KBX A;  4RHS A;  4GN5 A;  2JQO A;  4G7H C;  4YCU A;  3S1Q B;  2F0E A;  2K50 A;  2ZXP A;  4AIM A;  4JCV E;  1EYA A;  1ML0 D;  4U67 3;  1XNR L;  1IW7 D;  3J81 L;  2QIL A;  3H09 A;  4XQQ A;  4KHP Q;  2ZTC A;  4RKB A;  2A6H D;  2AQ1 B;  4IJH A;  2VW9 A;  2PQA A;  1YJW A;  4ULL A;  1WD1 A;  1GUT A;  2B39 A;  2L55 A;  1K83 B;  4HIK A;  1KNE A;  2KEE A;  2Z0S A;  1K0R A;  1KDA A;  4FP5 D;  4GKK L;  2L9H A;  3KOJ A;  4XIG S;  4JI6 Q;  4EQ5 A;  1ET9 A;  3KF6 B;  1XJV A;  3PQI A;  4DR6 L;  4RAU C;  3SGI A;  1HUN A;  3NBI A;  5JPM C;  4WFN 3;  3J7Y W;  1EYC A;  1TS2 A;  4OXP A;  4DV0 Q;  1RJT A;  2KVM A;  4BY1 G;  1C7Y A;  3M7N A;  4RGT A;  4JI8 Q;  1I3Q B;  4ZRZ A;  1SJE D;  4CDF C;  1TWA H;  2JA5 G;  1A2T A;  2EYJ A;  5IP9 H;  3L3O C;  2QKI C;  1U9R A;  1GUS A;  1LAC A;  1U4R A;  1VQ9 A;  2RDF A;  4JI3 L;  4DR3 Q;  3CU7 A;  3W5O A;  2CWA A;  3M4O B;  2E2J B;  1L1O C;  2CW0 D;  4DV6 Q;  2QW7 A;  5ELD A;  5K5P A;  3JAM i;  1QB5 D;  2MP1 A;  1NUC A;  2ENB A;  1IBK L;  1PH9 A;  4A3G H;  2K4K A;  1RL2 A;  2WB1 B;  4A3I B;  5KNB A;  3CQZ H;  4C3I B;  4GN3 B;  3CCJ A;  4A3C G;  4ME5 A;  3S1Q H;  4QMG A;  4JOI C;  1WFQ A;  1VQE A;  1LTA D;  2JA6 B;  2XIW A;  1JOQ A;  4H0L C;  1F9S A;  1WCM G;  3T1H L;  2PNH A;  3NQI A;  1H9S A;  1O7L A;  2VQF Q;  4HJ5 A;  3I7F A;  4OO1 I;  2JSO A;  2I0Q A;  2H1E A;  2HT1 A;  1BCP D;  5EJW A;  4CDD C;  1NSN S;  3CAM A;  1EEI D;  2NWG A;  3MC0 B;  4LK1 C;  3H15 A;  3M9B A;  5C4J H;  3NTK A;  2A69 C;  5C0X I;  4GKJ L;  1X55 A;  1KDC A;  3CRL C;  1RTN A;  3E6Z X;  4GS3 A;  3D6W A;  4QCL A;  2K52 A;  2F3V A;  3KLW A;  1E1T A;  2QEJ C;  1Q86 C;  3STB D;  1XMQ Q;  3KBG A;  5GAD C;  5BR8 Q;  4GOP C;  3H91 A;  1J5E Q;  1DON A;  2F3I A;  4ZK9 B;  4APV A;  2F0H A;  4DV1 L;  3ND9 A;  3TS2 A;  4AQY L;  4WJ3 M;  4B3R Q;  4F88 A;  1JOO A;  1WYD A;  1SSO A;  3SHL A;  2EIF A;  3SDZ A;  4X6A H;  3PUW A;  1GUW A;  4B3M L;  4R4I A;  4R4C A;  3MZ5 A;  4YY3 L;  3NEN A;  2E5L L;  5BN4 A;  4C3I H;  1PZI D;  5IGD A;  4OEM B;  1X65 A;  4R4T A;  1LT4 D;  1SFO B;  2B63 G;  1R9T B;  2WKC A;  2B2U A;  3VR6 A;  1U4M A;  3F1Z A;  3T13 A;  3A8J E;  4LF9 L;  4GNX B;  3TDQ A;  3ULJ A;  1KC8 C;  4CDC C;  4IUU A;  2N55 A;  2O4X A;  4BY1 B;  4JPB W;  3ULL A;  4QQB X;  3MVV A;  1BDO A;  3MFG A;  4OWW B;  1OO9 B;  3X3N A;  1JIC A;  5CMD A;  2NB0 A;  1VQI A;  1A6B B;  5GRO A;  2YTV A;  1HH2 P;  1KDB A;  4WJW A;  4P2C B;  4JW0 A;  1EOV A;  3G6J B;  4GLA C;  1PA6 A;  5EQ0 A;  5C4Z A;  4EGV A;  1JR0 D;  2KBN A;  2MQH A;  4B9W A;  1QUQ B;  5I2X A;  1T5E A;  1D5M C;  4AYB G;  1ESF A;  2MHV A;  4LMQ D;  5EBC A;  1NR2 A;  2O2L D;  4IN3 A;  1CZG A;  2XSC A;  1AZQ A;  1SYC A;  1NBW A;  1WCM B;  4KN7 C;  1WTP A;  4KKT A;  1PFN A;  2KOL A;  2LFN A;  1Y69 U;  2AQ3 B;  2XWJ B;  3MA2 B;  3TQY A;  1EU4 A;  1LTR D;  4F87 A;  4K2K A;  2NVT B;  2F03 A;  1Z6H A;  1XYI A; 
#chains in the Genus database with same CATH homology
 1KD1 C;  3K80 C;  4PZ8 A;  4R4Q A;  5M3M G;  4B3S Q;  2KCT A;  3FP9 A;  1SFO H;  4LF8 Q;  1M90 C;  1KRS A;  2JEA I;  3GTP H;  2IT1 A;  1D7Q A;  1KIX A;  1R9T H;  4MTN A;  1FVI A;  1N34 L;  2R7F A;  1PYS B;  4P72 A;  3K8A A;  5GAG C;  4HIM A;  4GLX A;  3U50 C;  3S1M H;  4BBS G;  4JI1 Q;  4JOI A;  1XMO Q;  5LMN L;  4B3M Q;  4BY1 H;  3GTM H;  1XPR A;  1K83 H;  3U4Z A;  3OTO L;  4X65 L;  2ZTE A;  2IX0 A;  4YY3 Q;  4X64 Q;  3KJO A;  5C3E G;  2HQL A;  2D0P A;  2Z6K A;  3HKS A;  2UXB L;  3PCO B;  1VQA A;  1AAF A;  3M3Y H;  3A5Z B;  2JA5 H;  2BH2 A;  3PGZ A;  1A8V A;  4UPA A;  4LF4 Q;  3UDI A;  1KXL A;  1MIU A;  1G51 A;  4DV3 Q;  5IYB G;  4A3K G;  1LUZ A;  1UEB A;  2YU9 H;  1I50 H;  4DK3 C;  3F2B A;  4GN4 B;  4P73 A;  1WOC A;  1GKH A;  2N49 A;  1EFW A;  1EIF A;  4R4O A;  1VQ8 A;  3S17 H;  4LF7 Q;  3CCU A;  4LFA Q;  1HNW Q;  1I3Q H;  1TWH H;  3L2P A;  1PV4 A;  5M5X H;  4PZ6 A;  1HNX L;  5M5W H;  1HNZ L;  2HHH L;  1N33 L;  3U4V A;  1GD7 A;  4DV7 L;  4IFD J;  1BJ6 A;  4X66 L;  1CUK A;  1VCI A;  2NZO A;  1IBM L;  3S2D H;  3PV0 A;  3H0G H;  4LUV A;  2WB1 E;  3DM3 A;  4X62 L;  1C9O A;  4NPS A;  1MKH A;  3CCE A;  2Q2T A;  4QGU A;  4DR6 Q;  1G6P A;  1WWD A;  2GVA A;  2RHQ B;  3RLF A;  1YJ9 A;  3KFU A;  5EAY A;  1EQQ A;  4JI0 Q;  4JI5 L;  4UP8 A;  3M4O H;  4LUO A;  4BY7 G;  1IYJ B;  1CKN B;  2E2J H;  2YSA A;  1CKN A;  1VQH A;  3OYY A;  4QL5 A;  3CPF A;  1VQP A;  1B70 B;  1UE7 A;  4IOC A;  4DR5 Q;  3S15 H;  2QGQ A;  1E22 A;  2KHJ A;  4DAM A;  2NVX H;  1A0I A;  4A3D G;  1A63 A;  3K7U C;  3CMA A;  2E2I H;  3AFP A;  3M4Q A;  3B6Y A;  2R92 H;  4MZ9 A;  4A3I H;  1Q3Z A;  3MXN B;  1TWF H;  4JI3 Q;  3W1G A;  5FLM H;  2CWP A;  3A5U A;  2GVB A;  4UY8 C;  3CF5 A;  4DUZ Q;  1C0A A;  5IYC H;  2A1A A;  3DLL A;  1SE8 A;  2XTI A;  4O2D A;  1X56 A;  4RMF A;  1YEZ A;  2JJQ A;  2JA6 H;  4K0K L;  1IBK Q;  2NVY H;  3TRE A;  1SRU A;  3G6E A;  1BKB A;  2CCZ A;  4HJ8 A;  3CC2 A;  4Y7N H;  2K5N A;  2HIX A;  3PIO A;  4DV2 L;  3VDY A;  1JMC A;  4A3F G;  3RN2 A;  1Q12 A;  1Q7Y C;  4OX9 L;  1FJG L;  2EXF A;  2Q2I A;  5IYD H;  4DV5 Q;  2MNA A;  4GNX C;  3T1Y Q;  1PH6 A;  3MEF A;  1D8L A;  3S1R H;  4NXN L;  3I55 A;  1QVF A;  4JBM A;  3I4M H;  3J7Z C;  5ELN A;  4A76 A;  1N8R C;  2JA9 A;  4KLK A;  5FLX c;  3G48 A;  4IFD I;  1NMF A;  1SLJ A;  2RF4 A;  1PFS A;  5IP7 G;  3OW2 A;  4A3M H;  1YBY A;  4A3G G;  2N8N A;  1W3S A;  3HOV H;  3RNU A;  2WAQ E;  3T1H Q;  1O7I A;  2JA7 G;  4C3H H;  5M5Y H;  4HIO A;  1EQR A;  1MJC A;  4LF5 L;  1N34 Q;  1Y1W H;  1XTD A;  4DR7 L;  1OTC A;  3BU2 A;  1PH1 A;  2ZM6 L;  1Z9F A;  3D0F A;  1Z47 A;  1FL0 A;  2YV5 A;  3PF5 A;  3HOZ G;  5LMN Q;  3ER0 A;  1I94 L;  3A0J A;  2ZJQ A;  5JEA G;  3ERS X;  3OTO Q;  4X65 Q;  1XMQ L;  1YZ6 A;  2JE6 I;  3A74 A;  1L2F A;  3HOU H;  2I5H A;  4JI2 L;  2UXB Q;  2AWN A;  3J7A 5;  1CSQ A;  1PH3 A;  1S72 A;  3NEM A;  4JG2 A;  1ASY A;  4DR4 L;  1FGU A;  2C35 B;  3KF6 A;  3H3V I;  4WJ4 A;  2E8G A;  1XPU A;  1K8G A;  3CD6 A;  3UE1 A;  3HOW G;  3FHW A;  2UUA L;  4JI4 L;  1CKM A;  3PUX A;  4HID A;  2CKZ B;  4DV4 L;  4L5Q A;  3LGJ A;  1U5K A;  4YWL A;  3GO5 A;  1KQS A;  2JZW A;  2FXQ A;  2HHH Q;  1RIP A;  3RLN A;  2OTL A;  3J81 i;  4DV7 Q;  3GTL H;  3AYH B;  1L1O B;  3J80 i;  4BA1 I;  4X66 Q;  4POF A;  3RN5 A;  1PH2 A;  1IBM Q;  2JA8 H;  4LFB L;  5C4X G;  1JJG A;  1YVC A;  2ZJR A;  1EYG A;  3NBH B;  4X62 Q;  4QIW E;  4IPD A;  1KRT A;  1PVO A;  4IOA A;  5M3F H;  2BH8 A;  4BBR G;  4JI5 Q;  1YNX A;  4IPC A;  4LNQ A;  4YWM A;  2OQ0 A;  1Y14 B;  2EQS A;  4KI0 A;  4YCV A;  5H1S E;  2F4V L;  3ZJY C;  4HJ7 A;  4YWK A;  4KHP L;  3GTO H;  1Y1V G;  2JK8 A;  3H0G G;  3G71 A;  1TXY A;  1QZG A;  1K8A C;  3RZO H;  1M1K C;  1K3R A;  2UU9 L;  1N32 Q;  2WFW A;  2R93 H;  4GLV B;  3K7A H;  1V1Q A;  5DLQ E;  5J3B A;  4P75 A;  4OON A;  1XPO A;  1U6P A;  2E5L Q;  1F6U A;  1Q1B A;  1Q46 A;  3S24 A;  3HFZ B;  4JI6 L;  2A19 A;  4JV5 L;  4LWC A;  1NY4 A;  4B3T L;  1XNQ L;  3L0O A;  2Y0S E;  4XTC S;  4LF9 Q;  4K0K Q;  4QJF A;  3CC7 A;  4HJA A;  4DV0 L;  2WB1 G;  2R92 G;  2XGT A;  4A3I G;  4LF6 L;  4DV2 Q;  4JI8 L;  2ES2 A;  3E0E A;  5FLM G;  4DR1 L;  1PH4 A;  3Q8D A;  2PI2 A;  4OX9 Q;  4L5T A;  3CPW A;  1FJG Q;  2R7D A;  5IYC G;  1VQK A;  1EWI A;  4NXM L;  5JJI A;  1WWF A;  1SRO A;  3HOX H;  3L7Z C;  1IXR A;  1HR0 W;  3S14 H;  4NXN Q;  4MNO A;  1JT8 A;  2UUC L;  1YIJ A;  1B7Y B;  1SR3 A;  2IHF A;  2AHO B;  3W1B A;  2JA6 G;  3CCR A;  2RCN A;  1WJJ A;  4DR3 L;  2Q2H A;  2I5L X;  3F2D A;  1VQF A;  4YHH L;  4DR2 L;  1H95 A;  4IFD G;  2RHS B;  5IE8 A;  4LF5 Q;  3EN2 A;  4DR7 Q;  4A3C H;  2HIV A;  4DV6 L;  1K73 C;  2DGY A;  2ZM6 Q;  2NN6 I;  2B29 A;  1BBU A;  3AQQ A;  3M4P A;  5IYD G;  3CCQ A;  4GOP A;  4GOP B;  4A4I A;  4DKA C;  3GDE A;  2QEX A;  4A3J H;  3F2C A;  4JYA L;  3I4N G;  4A93 G;  1JJC B;  5M3M H;  1I94 Q;  2F52 A;  2N78 A;  3STB C;  5JJK A;  4P74 A;  1X3G A;  2KCM A;  1HR0 L;  1WCM H;  4A3M G;  3CXC A;  2IHX A;  1AE2 A;  4O0A A;  4JI2 Q;  2AWO A;  4IO9 A;  1IBL L;  5E7N A;  3K0X A;  4DAY B;  4A3E G;  4DR4 Q;  2R7Z G;  1IL2 A;  4BBS H;  4LFC Q;  1VQJ A;  1N9W A;  1VQB A;  3KDF B;  3KDF A;  2NVT H;  2N3S A;  1JE5 A;  4Y52 H;  1ASZ A;  1YJN A;  2VQE L;  4JI4 Q;  1V9P A;  4B3S L;  3J81 c;  4LF8 L;  2VL6 A;  3AFQ A;  3J80 c;  1IZ6 A;  3PF4 A;  2MO0 A;  1E1O A;  1PYB A;  1VQG A;  2LXJ A;  4JC0 A;  1Q82 C;  3HOU G;  2L4L A;  3PUV A;  2VQF L;  3U58 A;  2CFM A;  3ULP A;  3KJP A;  5IYB H;  4GN5 A;  4A3K H;  1NMG A;  4OWX B;  2YTY A;  3HKZ E;  4LFB Q;  2JQO A;  1XMO L;  1E24 A;  4YCU A;  2K50 A;  2D0O A;  4AIM A;  3J81 j;  3CCS A;  4JCV E;  5JJL A;  2OCE A;  3E9H A;  2AMC B;  3EIV A;  1TWC H;  4DNI A;  1PHJ A;  4ALP A;  4LF4 L;  1XNR L;  2F4V Q;  2BA1 A;  3HOY G;  3S1N H;  1EUJ A;  1YIT A;  2UUB L;  2OWO A;  2JA8 G;  4KHP Q;  2ZTC A;  4GNX A;  2VW9 A;  2PQA B;  3I4O A;  4IJH A;  2PQA A;  1YJW A;  2M3Z A;  2K5V A;  3K81 C;  4BY7 H;  1OXV A;  4HIK A;  2UU9 Q;  4LF7 L;  2K14 A;  1YHB A;  4HJ9 A;  3GTK H;  2Z0S A;  1AE3 A;  5M3F G;  4A3B G;  1K0R A;  2GN5 A;  4TQU S;  3PIP A;  1VQ5 A;  4GKK L;  5GQO A;  3KOJ A;  5BR8 L;  4XIG S;  2R6G A;  1J5E L;  1HZA A;  1E7Z A;  4EQ5 A;  4JI6 Q;  3FKI H;  2L15 A;  5LMU L;  3S16 H;  4JV5 Q;  3IRB A;  2VUM H;  3KF6 B;  1KAW A;  1XJV A;  4B3T Q;  4DR6 L;  1NE3 A;  1TWG H;  3SGI A;  1Q8K A;  5JEA J;  1P8L A;  1YI2 A;  2NVQ H;  2QA4 A;  4OXP A;  4DPG A;  4DV0 Q;  4B3R L;  4BY1 G;  1C7Y A;  4LF6 Q;  1LTL A;  3M7N A;  4JI8 Q;  1JB7 A;  1Q1E A;  1KL9 A;  4DR1 Q;  1V43 A;  1YHA A;  4BXX G;  2B63 H;  2ID0 A;  1J6Q A;  1CSP A;  1HNZ Q;  1HNX Q;  4NXM Q;  1TWA H;  2JA5 G;  1NTG A;  1N33 Q;  1UE6 A;  4DK6 C;  5IP9 H;  1L0W A;  5ELO A;  2UUC Q;  5C44 H;  1MJE A;  5C0X J;  1Q3Y A;  2MO1 A;  1VQD A;  3BZK A;  1VQ9 A;  1S40 A;  4JI3 L;  4A3F H;  1A1T A;  4DR3 Q;  3W5O A;  1QUQ A;  2CWA A;  4YHH Q;  4DUZ L;  4DR2 Q;  1L1O C;  2VZA A;  1QZH A;  3M85 A;  5IY0 A;  1PH8 A;  4JI7 L;  1WWE A;  3PO3 H;  1WI5 A;  4DV6 Q;  2ALY B;  3PO3 G;  2UXC Q;  3JAM i;  2UXD L;  4JYA Q;  3HOX G;  1VQM A;  1S3O A;  1IBK L;  4EX5 A;  2EXD A;  1PH9 A;  4A3G H;  2NN6 G;  2K4K A;  1HR0 Q;  5FJ8 H;  4AYB E;  1RL2 A;  3BZC A;  4PMW A;  2MFI A;  3D31 A;  4LW1 A;  1IBL Q;  4POG A;  2A8V A;  3CQZ H;  4GN3 B;  2H5X A;  3CCJ A;  4A3C G;  3S1Q H;  1QVG A;  1UE1 A;  3KYH C;  4JOI C;  2CQF A;  1WFQ A;  1VQE A;  5HY6 A;  2ASB A;  1CKO A;  1ESK A;  2E2H H;  2VQE Q;  3PSI A;  2Z6K C;  5AJ3 L;  1WCM G;  4P71 A;  2PNH A;  3T1H L;  1EIY B;  2WP8 J;  2VQF Q;  4HJ5 A;  3I7F A;  2NZH A;  4OO1 I;  3CW2 C;  4UP7 A;  2CQO A;  1HZ9 A;  2I0Q A;  4A3L H;  4L5S A;  5IT9 c;  2HT1 A;  1BVS A;  3HOW H;  1KHI A;  2ZTD A;  4NB3 A;  3UE0 A;  3GTQ H;  1VQ6 A;  1GO3 E;  1SMX A;  3CAM A;  3EBE A;  3PUZ A;  4RG1 A;  3CCV A;  3NEL A;  3CCM A;  3H15 A;  3M9B A;  5C4J H;  4KHZ A;  2B3G A;  1N36 L;  1XNR Q;  4AH6 A;  5C4X H;  5C0X I;  1X55 A;  4GKJ L;  2UUB Q;  4GS3 A;  1U0L A;  5GAH C;  1HJP A;  1E3P A;  2K52 A;  4LUZ A;  3JC6 6;  3KLW A;  3PO2 H;  1I6H H;  4ME3 A;  4IJL A;  2JEB I;  4BBR H;  3I4M G;  1E1T A;  1VQ4 A;  3UDG A;  3UDF A;  1Q86 C;  3STB D;  4PZ7 A;  3I2Z A;  4C3J H;  5IWA L;  1XMQ Q;  2ATW A;  3S2H H;  4GKK Q;  5GAD C;  5BR8 Q;  4GOP C;  3HOV G;  2VNU D;  1Y1V H;  1J5E Q;  1OXX K;  5LMU Q;  2F3I A;  1Y1W G;  2IY5 B;  2ZJP A;  3CCL A;  4APV A;  4JBJ A;  4DV1 L;  3TS2 A;  4AQY L;  4DUY L;  3GTG H;  1VQ7 A;  3HKZ G;  1GVP A;  1JJ2 A;  5C3E H;  1VQN A;  2UUA Q;  4B3R Q;  4WJ3 M;  4R1J A;  3G4S A;  3F8T A;  1OXS C;  1WYD A;  4DV4 Q;  1X3E A;  1X6O A;  3RLO A;  3RR5 A;  1K9M C;  4IPG A;  2EIF A;  4C2M H;  4X6A H;  1HZC A;  3FKI G;  1YHQ A;  5K36 G;  2WAQ G;  3PUW A;  2VUM G;  4JI1 L;  2OTJ A;  2IHE A;  4B3M L;  1N32 L;  3E9I A;  4R4I A;  2YYZ A;  4R4C A;  1DGS A;  1I5F A;  2PI2 E;  4JBK A;  4YY3 L;  3BJU A;  4X64 L;  4L5R C;  2VS1 A;  1LYL A;  1VQC A;  3NEN A;  4H02 A;  3JAM c;  2E5L L;  2EC7 A;  1VS0 A;  4C3I H;  4JI7 Q;  1LM0 A;  3PUY A;  1X65 A;  4R4T A;  3NYB B;  3TEH B;  1PH5 A;  2B63 G;  1B8A A;  1VQO A;  2V1C C;  2YTX A;  1UWV A;  2UXD Q;  2Q2U A;  4DV3 L;  3F1Z A;  5IP9 G;  2D62 A;  4LF9 L;  5C44 G;  4GNX B;  4BA2 I;  3ULJ A;  1KC8 C;  4IPH A;  1A62 A;  1HNW L;  3CME A;  1BBW A;  3WWV A;  4LFA L;  3ULL A;  1G29 1;  4QQB X;  4A75 A;  1AH9 A;  2PMZ E;  1T9H A;  4OWW B;  2AKW B;  2LSS A;  3I4N H;  4A93 H;  4J15 A;  1GM5 A;  3TRZ A;  1P16 A;  4A3D H;  1VQI A;  1XNQ Q;  1A6B B;  1SN8 A;  5GRO A;  5FJ8 G;  2YTV A;  2OQK A;  1HH2 P;  5AJ3 Q;  4A3E H;  1NJI C;  4JI0 L;  5HGQ A;  2R93 G;  2R7Z H;  2LI8 A;  1W2B A;  4FDB A;  2K75 A;  1MFS A;  2VY3 A;  4DR5 L;  4OO1 G;  3H3V H;  3GD7 A;  1EOV A;  1UE5 A;  4GLA C;  1PA6 A;  2KHI A;  4OWT B;  4YCW A;  1OXU A;  1X54 A;  4QY7 A;  3UDX A;  1Q81 C;  2KBN A;  2MQH A;  1PH7 A;  3CP0 A;  1N36 Q;  1QUQ B;  2KEN A;  3CC4 A;  2UXC L;  4GKJ Q;  4AYB G;  2K5H A;  4LFC L;  2DUD A;  4A3L G;  4BXX H;  1OXT A;  4JBW A;  3TS0 A;  5C0X G;  3AEV A;  5GAE C;  2LXK A;  5IP7 H;  4TVA B;  1HZB A;  1NBW A;  4PG3 A;  1X9N A;  2BA0 A;  1X3F A;  3RZD H;  5IWA Q;  3GTJ H;  3ICE A;  4UP9 A;  3KF8 B;  3HOY H;  2JA7 H;  2IX1 A;  1L1O A;  3I56 A;  2Y0S G;  3TQY A;  5LMN W;  1WWG A;  1VQL A;  4DV5 L;  3T1Y L;  2I5M X;  1QVC A;  3HOZ H;  4DV1 Q;  3PO2 G;  4A3J G;  4AQY Q;  4DUY Q;  4A3B H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...