3TRZA

Mouse lin28a in complex with let-7d microrna pre-element
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
136
structure length
130
Chain Sequence
PQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSEDRCYNCGGLDHHAKECKLPPQPKKCHFCQSINHMVASCPLKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords Protein lin-28 homolog A
publication title Molecular Basis for Interaction of let-7 MicroRNAs with Lin28.
pubmed doi rcsb
source organism Mus musculus
total genus 30
structure length 130
sequence length 136
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00098 zf-CCHC Zinc knuckle
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3trzA01
4.10.60.10 Few Secondary Structures Irregular HIV-1 Nucleocapsid Protein Zinc finger, CCHC-type 3trzA02
1X6OA 4L5QA 4YCUA 4MZ9A 4IO9A 3CPFA 1XNRL 4DV7Q 3I4MG 4MTNA 3TREA 3KFUA 4DK3C 1XTDA 1NJIC 2LXKA 4BBRH 1LM0A 4YWKA 5DLQE 5IP9G 5IWAL 3JAMi 1C0AA 2VUMH 4GNXC 2EIFA 4A3LH 4HJ7A 5JJLA 4AH6A 4DK6C 4A3KG 1TXYA 4DR2Q 1PH5A 5M3MG 4KHPQ 1BBWA 1YNXA 1GVPA 4DV4L 4UY8C 4BA1I 1NY4A 2VUMG 2JZWA 4LF6Q 5C3EH 4JI6L 2CKZB 2K5VA 3KYHC 4DV4Q 2Q2UA 3CC2A 4BXXH 1QVFA 2NVTH 4A3GG 3F8TA 4C3JH 1WWGA 3OW2A 3CD6A 4BY7H 4A3JG 3RZOH 2K52A 4A3BH 5BR8Q 4APVA 1HNXL 1BVSA 3HOVH 1A8VA 5C3EG 1VQ5A 4BXXG 2LI8A 2ASBA 3H3VH 4BA2I 4P72A 2ZTEA 1HNXQ 4R4OA 3IRBA 4BY7G 1HZBA 1WJJA 4A3BG 4JYAL 2CFMA 1K8GA 3KLWA 4KHZA 3HOVG 2BA1A 3TEHB 4MNOA 2QA4A 2HHHQ 4QGUA 4GOPB 2M3ZA 1YHAA 4QIWE 2UXCQ 2IT1A 4PMWA 4JG2A 4GOPC 1NBWA 3ULPA 1XJVA 4BBSH 1B7YB 4LNQA 1XPUA 3F2CA 3KF6B 3CCJA 1YJWA 5GAHC 1EIFA 5GQOA 5JEAJ 1YJNA 5M5YH 2R7ZH 2R7DA 2AWNA 1PH3A 4DUZQ 4GLAC 1YIJA 1I94L 4BBSG 4JI5Q 4OWWB 3K0XA 1XNQQ 2RHQB 1AAFA 1XMOL 1X9NA 3CCRA 3I2ZA 1XPRA 1I6HH 1AH9A 2ZTCA 4TVAB 5LMUL 2YTYA 5EAYA 1PH7A 3HOWH 4AIMA 3PUZA 4DR1Q 5C44G 4OONA 1VQBA 2H5XA 1P16A 3ERSX 4WJ3M 1E7ZA 2MO1A 5JEAG 3GDEA 1JMCA 1VQLA 1U0LA 4IPDA 4NXMQ 3TS2A 3PUYA 1HNWQ 4C3HH 4DV6L 3U58A 2YYZA 3HOWG 4QQBX 3CP0A 4JI3L 3PUXA 4JCVE 1TWFH 3PUWA 1QUQB 4L5TA 1N36L 1X3GA 4LFAL 4GKKL 4OO1G 4JI8L 2E2JH 3G71A 4JBWA 5IYBH 2IX1A 2VQFL 3UDGA 4KI0A 3ER0A 4AYBG 1VQCA 2JA8H 1Q12A 5ELNA 3UDIA 5H1SE 4IPHA 4HJAA 3M3YH 4IFDG 4YCVA 3CW2C 4A4IA 4DR3L 2RCNA 2MNAA 2Z6KA 3L2PA 1FGUA 1HZCA 1VS0A 1UEBA 2N3SA 1I5FA 4NXNL 1GKHA 1OXUA 3WWVA 4B3TL 3KOJA 1Z9FA 1VQAA 3BU2A 2NVYH 4LUOA 4YWMA 4JI7Q 3HOZG 2V1CC 1IBMQ 3M9BA 1B8AA 1NTGA 1IYJB 3FP9A 2NZOA 3A74A 3K81C 4GS3A 4YWLA 1CKMA 1DGSA 4DV2Q 4AQYL 1YI2A 1FJGQ 2UUCL 3AEVA 1HJPA 1NMFA 2CQOA 4B3ML 1VQDA 4A3EG 2QGQA 3CCUA 2KHIA 1GM5A 4LFBL 4GLXA 3CMAA 3G6EA 4OWTB 2RHSB 3M4QA 4LF9L 1N32Q 2UXDL 3PO3H 1M1KC 3PV0A 5LMNL 1V1QA 4Y7NH 3J81c 4DR5Q 4NB3A 4RG1A 3HOYH 4JI4L 2K5NA 3GTKH 2ZTDA 4LW1A 3GTQH 3PO3G 1W3SA 2WB1G 4OX9L 1IBLL 1WI5A 2JK8A 3HOYG 4JBJA 4GLVB 2F3IA 5GADC 2ZM6Q 2ZJPA 4HIMA 1OXSC 3J80c 4DV7L 1CSPA 3OTOQ 3M85A 2E2HH 1MFSA 4GNXA 1S72A 1SMXA 3S1RH 1JJCB 2DGYA 3U4VA 3PGZA 5FLXc 1HR0W 2I5MX 4XIGS 2YV5A 4JC0A 2K50A 1ASYA 4B3RQ 4LF8Q 3STBD 2ID0A 4DR2L 4KHPL 4B3SL 2I5HA 2IHFA 4QJFA 4YY3Q 1SE8A 2RF4A 4DR6Q 4ME3A 4LF7Q 2ZJRA 4PZ7A 1TWHH 2WB1E 4GN5A 5C0XG 2EXDA 4DV0Q 4B3SQ 4LF6L 1I3QH 2D0OA 4GKJQ 2MFIA 4BBRG 3I55A 3D0FA 2JJQA 1VQNA 2KBNA 4X65Q 2OQKA 4A3LG 2AKWB 2BH2A 4XTCS 5BR8L 2K4KA 4A3MH 1C7YA 1BBUA 3RN5A 2NN6G 3NBHB 1F6UA 1RIPA 1E24A 1WFQA 1HZAA 3H15A 1LUZA 4DAMA 5IT9c 1Q7YC 2Y0SG 3PIPA 3CCLA 3GTLH 2N49A 4DR4L 1HR0Q 4L5SA 3K80C 2HHHL 1A62A 1E22A 1A1TA 3BZCA 2MQHA 3CCMA 1PH4A 3GO5A 2KCMA 3S2DH 4DR4Q 1Q46A 2UXCL 4A3CH 1R9TH 1QZGA 3CAMA 1N33Q 2BH8A 1PFSA 1YHQA 2JA5H 1A63A 2EXFA 3KJOA 2KENA 5J3BA 1YJ9A 1JJGA 4DUZL 1VQ8A 1CKNA 5GROA 2B29A 4DPGA 3CC7A 4JI5L 2JA5G 5IYCH 1L1OB 4R1JA 1VQ6A 1XNQL 1UE7A 1PH2A 2VL6A 2UU9Q 4A3DH 2E8GA 5JJIA 1L1OC 2C35B 2Y0SE 3KDFA 2OCEA 2D0PA 3EN2A 3K8AA 1Z47A 4POFA 1J5EL 2UUBL 3J7ZC 1PYSB 4IOAA 2HQLA 4DR1L 5IYCG 3CMEA 3RN2A 2JEAI 2R7ZG 1G51A 4IJLA 1J5EQ 3J7A5 1Q1EA 2LSSA 2AMCB 2OQ0A 2UUBQ 4A3DG 4NXML 2D62A 1L0WA 1HNWL 3PF5A 4LF5Q 3F2BA 3S14H 1YVCA 1X65A 3DLLA 3GTGH 1CKOA 2R7FA 2F4VL 3CC4A 1OXXK 3HOUH 1Y1VH 2Z0SA 3AYHB 5HY6A 4YHHQ 1D8LA 4A93H 1S3OA 2IX0A 4DR7Q 4IFDJ 4WJ4A 1MIUA 1K73C 1N9WA 2F4VQ 2OTJA 1Q1BA 3HKZE 4HJ8A 1KL9A 1VQEA 2B3GA 2ZJQA 1VQIA 1Y1VG 4EQ5A 4A93G 1PVOA 3L7ZC 4HJ9A 1UE6A 3BJUA 3RR5A 3CCSA 3S17H 3GTPH 3S2HH 4GN4B 4IJHA 2FXQA 4BY1H 1SR3A 3JC66 3PO2H 2HIXA 1JE5A 4EX5A 4QY7A 2ES2A 3CCQA 1HNZQ 3ICEA 3W1GA 1VQFA 5IY0A 2GN5A 2UXBQ 2Q2IA 2AHOB 4DNIA 4X66Q 1Y1WH 2JEBI 4P73A 4JI7L 2JA8G 3PF4A 4RMFA 2E2IH 3KJPA 3CCEA 1IBML 4K0KL 1TWAH 1AE3A 4JI1L 3GTOH 4JI0Q 2I5LX 4DV2L 1FJGL 4J15A 4C2MH 5IP7H 4DV3Q 2E5LQ 2Q2TA 3L0OA 2B63H 2WFWA 1T9HA 4X62L 3UDXA 2VZAA 4UP8A 3PCOB 3UDFA 4A75A 4IFDI 3RZDH 2UUAQ 4X62Q 1UE1A 4DUYQ 4R4IA 1N32L 4DAYB 1QVCA 5IYBG 1SFOH 2NVQH 3S16H 4R4CA 1E1OA 4OXPA 4X6AH 4DR5L 1W2BA 2PQAB 4IPCA 3AFPA 1Q8KA 1LTLA 4FDBA 1EIYB 1WWDA 4LUVA 3H0GH 3NEMA 1PV4A 1PH9A 1CUKA 1IL2A 1YEZA 1X55A 1Q86C 2R93H 1N8RC 2LXJA 3U50C 5M3FH 3M7NA 2KHJA 2KCTA 1OXTA 1UWVA 2CCZA 2AWOA 2IHEA 2WAQG 2ZM6L 1EQQA 4K0KQ 1VQPA 1IXRA 1BKBA 1SLJA 3OTOL 1OTCA 3BZKA 1JT8A 5C0XJ 2R93G 2VQEQ 4JOIC 3TRZA 4O0AA 1SROA 1YHBA 2IHXA 4OWXB 3TQYA 2VS1A 3RLFA 3G4SA 1PH6A 3CF5A 1H95A 1YBYA 1XPOA 4B3RL 1VQJA 4LF8L 2Q2HA 4O2DA 3GTJH 1EFWA 1HZ9A 2VNUD 1JJ2A 1M90C 3A5UA 1Y14B 3CQZH 2CWPA 4YY3L 4DR6L 1SN8A 1U6PA 2K75A 4LF7L 3ULLA 2JA9A 1V9PA 3SGIA 4DV0L 1EQRA 3STBC 4DV5Q 2JA6H 3S24A 4GKJL 4A3IH 3LGJA 2EC7A 1BJ6A 1JB7A 3T1YQ 1KHIA 1P8LA 4X65L 1VQ4A 4LFCQ 4DV1Q 2WAQE 4Y52H 1LYLA 1TWGH 1EUJA 2CQFA 3VDYA 5FJ8H 2PI2A 3I4MH 2JA6G 3RLNA 3S1MH 4A3IG 1SRUA 1KAWA 3K7UC 4X64Q 3W5OA 3GTMH 4LF4Q 5IP9H 3CXCA 1XMQQ 2A19A 1FVIA 3UE1A 1HR0L 2OWOA 4A3KH 2CWAA 5FJ8G 5M3MH 3T1HQ 3HFZB 3ZJYC 3PSIA 4GNXB 2K14A 1K0RA 2XTIA 4A3MG 4UPAA 2YU9H 5C0XI 1N33L 1XNRQ 4GOPA 3W1BA 1VQOA 3E9IA 1VQGA 1EWIA 3J81i 2A1AA 4QL5A 2YTVA 4JI1Q 1EYGA 4A3FH 2EQSA 3I4OA 4A3GH 5IWAQ 3NYBB 1PH1A 1FL0A 1ESKA 1Q82C 1Q3ZA 3I4NH 3KF6A 4A3JH 1X56A 4DKAC 1VCIA 3ULJA 3Q8DA 1L1OA 3RLOA 2NN6I 3D31A 3M4OH 1X54A 2HIVA 4A3CG 4A3FG 4R4QA 2UU9L 2YSAA 4A76A 3CCVA 3I4NG 1EOVA 4JI6Q 1MKHA 3HKZG 5K36G 2N8NA 3J80i 1O7IA 2DUDA 2OTLA 1IBKL 1KD1C 3M4PA 2GVBA 5FLMH 2XGTA 4IPGA 4LF5L 1A0IA 1IBKQ 2VW9A 1KC8C 3A5ZB 3H3VI 1WCMH 4YCWA 1E3PA 4DR7L 4YHHL 1NE3A 1NMGA 4JYAQ 4P71A 5FLMG 1V43A 1KRSA 2HT1A 1MJEA 5JJKA 1QUQA 2K5HA 3HKSA 1KQSA 3J81j 1Q81C 1WCMG 1QVGA 3OYYA 4HIOA 4GN3B 2PMZE 5GAEC 4PZ8A 1CKNB 1X3FA 4LWCA 2JQOA 3HOUG 1VQMA 2BA0A 5C44H 1L2FA 2QEXA 1I94Q 1GO3E 1HNZL 5GAGC 3KDFB 5HGQA 2UXBL 1VQHA 2MO0A 1XMOQ 4X66L 5E7NA 1WWEA 5C4XH 4HIDA 3HOXH 1Q3YA 5LMUQ 4LUZA 4H02A 2PI2E 1KIXA 1VQ7A 4JI0L 1WYDA 4DV3L 4BY1G 3MXNB 4HJ5A 3K7AH 1PH8A 2E5LL 4JBKA 3PO2G 4OO1I 5C4XG 1PA6A 2PNHA 3HOXG 3A0JA 2L4LA 1X3EA 4JBMA 4DV6Q 4POGA 1N34L 1K9MC 4JI3Q 1Y1WG 1KRTA 2UUAL 1J6QA 3F1ZA 4DUYL 3TS0A 3EBEA 3G48A 1N36Q 4LFAQ 1N34Q 1C9OA 2VY3A 3U4ZA 4JI8Q 4GKKQ 5IP7G 3E0EA 1ASZA 3MEFA 2PQAA 2VQFQ 2B63G 1OXVA 1PYBA 2IY5B 2F52A 1YZ6A 1VQ9A 4IOCA 1G291 3GD7A 1MJCA 2GVAA 4UP9A 5IE8A 3HOZH 3KF8B 2R6GA 3I7FA 4HIKA 2ALYB 3DM3A 3JAMc 3PUVA 2JA7H 1YITA 5LMNW 4DR3Q 1A6BB 5M5WH 4A3EH 4JOIA 1WWFA 1U5KA 4PG3A 4B3TQ 3FHWA 1B70B 5ELOA 4NXNQ 1CSQA 3S1NH 1K8AC 2R92H 4R4TA 2Z6KC 4C3IH 2VQEL 2A8VA 2JA7G 3H0GG 4AYBE 4JI2L 3I56A 1G6PA 1I50H 1WOCA 3EIVA 4L5RC 3NELA 4AQYQ 3CPWA 5M3FG 4UP7A 5IYDH 1PHJA 4JV5L 2UUCQ 4JI2Q 1K3RA 1UE5A 4B3MQ 2R92G 1QZHA 4P74A 2N78A 3E9HA 4KLKA 3FKIH 4LFBQ 3B6YA 2L15A 4JV5Q 4DV5L 5IYDG 5C4JH 1VQKA 1IZ6A 3T1YL 4P75A 1AE2A 4TQUS 4LF9Q 2UXDQ 2NVXH 4LFCL 5AJ3L 4DV1L 5LMNQ 2ATWA 1HH2P 3FKIG 3RNUA 3NENA 3F2DA 1D7QA 4PZ6A 4JI4Q 3AQQA 5AJ3Q 2NZHA 1S40A 3S1QH 4X64L 1KXLA 2YTXA 3S15H 4LF4L 2I0QA 3AFQA 1RL2A 2JE6I 3UE0A 1K83H 4ALPA 1XMQL 1TWCH 5M5XH 3PIOA 4OX9Q 1IBLQ 1GD7A 4NPSA 2WP8J 3T1HL 1E1TA
chains in the Genus database with same CATH superfamily
4L5QA 1KLUD 5ELCA 1XNRL 1JORA 4DV7Q 4A3FB 2MUYA 3SVMA 1R4QB 3TREA 3I4NB 4DK3C 1XTDA 4YWKA 5KYIA 3JAMi 4K5WA 1ZXTA 2VUMH 5JJLA 4A3KG 5M3MG 1BBWA 3T51B 2RA4A 1O80A 1QILA 2DNEA 1X32A 2I46A 4C3JH 3IKJA 4A3JG 3RZOH 2K52A 1XWEA 4A3BH 2F0SA 2RKSA 1TY0A 3HOVH 5EGTA 2F0UA 2LI8A 3CKIB 5IGDA 4BA2I 1HNXQ 2ZTEA 3HOUB 2DJFC 2BDNA 5CV4A 2CFMA 4JYAL 3KLWA 1D5XC 4KK7A 4QGUA 4GOPB 2M3ZA 4QIWE 1FD7D 3R2IA 2UXCQ 1Y69U 5M9OA 3Q22A 1XPUA 3KF6B 2IX3A 1PRTD 5GQOA 3NXWA 1RHPA 4GLAC 1YIJA 1ENAA 3PO2B 1SEBD 5C4XB 1C4QA 4CDFC 1WTQA 4OWWB 3K0XA 3RMHA 4IUTA 1XMOL 4UAIA 5CGKA 3VR4A 1PH7A 2PQEA 3ERSX 2B63B 1E7ZA 2MO1A 3MA2B 1JMCA 4NXMQ 4OO1H 4IPDA 1STEA 2EZVA 1DOMA 3KLSA 4DV6L 3HOWG 4QQBX 3CP0A 1B9NA 1BOSA 3PUXA 3F2UA 3PUWA 1QUQB 2A73B 3TP5A 4CJ0B 1HCZA 1SJHD 4DU9A 2E2JH 1S5ED 1MD2D 4IFDH 3HOZB 1LT4D 1B2TA 1Q12A 1B44D 2P5ZX 2K5DA 4YCVA 4C1NI 4A4IA 1PRTF 1JICA 1FGUA 1VS0A 3WWVA 1UEBA 4C3IB 1OXUA 1IKLA 3BU2A 4YWLA 5ISRA 1IYJB 1CT1D 5IYBH 4DV2Q 4GS3A 3OIPA 2Z6BA 2UUCL 4B3ML 1VQDA 4A3EG 2QGQA 5BN4A 4LFBL 4GLXA 4CKBA 3CMAA 3G6EA 1FYCA 1PFNA 4KD3A 4OWTB 2RHSB 1WTWA 3PO3H 5EPJA 4Y7NH 1SNQA 4DR5Q 4RG1A 1K83B 1SJED 2EYFA 1TWCB 3GTQH 4IZ8A 3D3RA 2WB1G 1E2WA 4OX9L 3J81L 3QJYA 2JK8A 4KJNA 1TU2B 2L5TA 1MGSA 3SK4A 2NB0A 4HIMA 1QE6A 3N52A 3J80c 2YU9B 2E2HH 1BCPD 4X3UA 2EYOA 2XIWA 3S1RH 5FO7B 1PDQA 4A3GB 2O5JC 2YV5A 5C0XH 3C46A 4DR2L 4XYQA 4KHPL 2I5HA 1AW7A 5CR3A 4DR6Q 2WB1E 2EXDA 2BE5D 4NMZA 2MFIA 1SSOA 3K5NA 2JJQA 1DOKA 2OQKA 2HD3A 2AKWB 4XTCS 5BR8L 4JW0A 3NBHB 2F0VA 4R8IA 3H15A 1LUZA 1M8AA 2Y0SG 3CCLA 1TT2A 2N49A 4FNFA 1ICFB 4C3JG 3BZCA 2MQHA 3CCMA 2A69D 1PH4A 2KCMA 4DR4Q 4BBSB 1Q46A 2AQ1B 4KY7A 4A3CH 1R9TH 3CAMA 3I90A 1B50A 2F3VA 1BCPF 2M9VA 1YJ9A 3C3LA 5GROA 4HCSA 1PTOD 3GQBA 3K5LA 2F0PA 5IYCH 1XNQL 3NTKA 3Q24A 1UE7A 2UU9Q 2A6ED 2C35B 2Y0SE 3K8AA 1K8MA 3EN2A 2ICIA 4CKCA 1S5DD 1JC7A 1GOZA 2RDGA 3CMEA 2QDLA 2AMCB 3EROA 3SR1A 1KNEA 4LF5Q 3S14H 1TWFB 2SEBD 3GTGH 3CC4A 4LJZC 3HOUH 5HY6A 4ZLTF 1EU4A 4DR7Q 4IFDJ 1S3OA 1JWUD 2AUJD 1Q1BA 3BVGA 4RCNA 4HJ8A 2JA8B 1KL9A 2L1BA 5JVH3 1B4OA 1STHA 1VQIA 1STBA 2ZJQA 1DD2A 3GV6A 4A93G 5FO9B 1PVOA 3BJUA 5CV9A 2FXQA 2IL8A 2OT2A 1S5BD 1SR3A 2PZTA 3PO2H 2B2VC 1JE5A 5I6YA 2ES2A 3QOJA 2NVYB 5DAUA 1PTOF 5IY0A 5A2QE 1O7YA 4EQOA 4L6TB 2Q8RE 1QG7A 1IBML 3K6OA 1TWAH 4QB4A 1MSGA 5IP7H 2B63H 3UDXA 5T1IA 3J80E 3UDFA 3RZDH 1CZWA 4DUYQ 1T5EA 1N32L 4RGOS 3HOYB 5IYBG 3K5OA 1SFOH 2MP1A 1PMRA 1E1OA 4OXPA 1LV9A 1W2BA 1UUPA 1EU3A 3TP6A 4EQNA 1EIYB 4OIKA 5JAVA 3H0GH 1CTMA 3D8GA 3U50C 4KKUA 2CCZA 2WAQG 1EQQA 4K0KQ 1VQPA 1IXRA 4IUQA 5C0XJ 1I4XA 2EYPA 2IHXA 1SROA 3TQYA 5FKAC 2VS1A 1PH6A 3HG9A 4B3RL 1VQJA 3A7LA 4LF8L 1WTOA 3DWPA 1BUVT 1EFWA 1GHKA 1HZ9A 1NUCA 1TWHB 3FDTA 4LF7L 3ULLA 1B3AA 4DV0L 1EQRA 2MPMA 4DV5Q 2EC7A 1HUNA 3T1YQ 1KHIA 1P8LA 2CW0D 4X65L 1WVLA 4DV1Q 2WAQE 4P2CB 4EGVA 3Q0AA 5FJ8H 1TIID 2JA6G 3GTLB 1SRUA 2B2YA 1KAWA 1FR3A 3GTMH 3W5OA 3NHHA 1DONA 3J7YW 3CXCA 2A19A 1FVIA 4MTKA 3UE1A 1HR0L 1EL0A 3E6ZX 4GNXB 3PSIA 1CK1A 2YU9H 2XTIA 1A3VA 1LTID 4GOPA 2A1AA 4QL5A 4A3GH 3I4OA 1WTRA 5I9OA 3NYBB 1FL0A 4EQPA 3KF6A 3HZXA 4KKTA 1H9KA 3AMUA 1L1OA 3RLOA 4A3DB 2K05A 2H4OA 4CDEC 3H94A 3HS0C 4A3FG 1ZYRC 4A3CG 4A76A 3CCVA 3I4NG 1SYFA 2RDFA 4FXGC 1C8CA 2DUDA 1PFBA 1KDBA 2GVBA 2F03A 1EOTA 5JPNC 3K5MA 3DHQA 4PNYA 4IPGA 4WORA 3VR3A 1EEFD 3I8ZA 4H0LC 4C3HB 3D4WA 5I9PA 5D3DA 3M7GA 1LTTD 4KY6A 1V43A 2HT1A 1QUQA 3ND8A 4OEMB 3J81j 4K6LA 1Q81C 1H9JA 3S2HB 2EY1A 2ZXPA 4J1MA 4BY1B 1J8IA 5GAEC 3Q6SA 1X3FA 3HOUG 3KBGA 3SK6A 1GO3E 5JEAH 3KDFB 2RSNA 3J7AV 2UXBL 1VQHA 3P75A 5E7NA 3NWSA 4HIDA 3HOXH 1Q3YA 1KLGD 3C1EA 4CGYB 1F9QA 1I4HA 1SBBB 4JI0L 1VQ7A 3A8IE 3MXNB 3K7AH 5IGFA 3MXGA 3PO2G 4OO1I 5C4XG 1PA6A 4ZCKA 1CI3M 2NVQB 5JOBA 1EIGA 1LABA 3F1ZA 3TS0A 2IW3A 5CBEE 4GKKQ 2VY3A 4JI8Q 2FINB 5IP7G 2VQFQ 2B63G 1OXVA 2LFNA 1RTNA 4IOCA 2GVAA 2R93B 5IE8A 1BQQT 3I7FA 3DM3A 2JA7H 3W3AA 4DR3Q 1RCVD 4NP5A 2Z4IA 1U5KA 4NXNQ 5ELOA 3M4YA 2R92H 4R4TA 2VQEL 3H0GG 4AYBE 1O7ZA 5IYDH 4UP7A 4JI2Q 1QZHA 4A3IB 5E4WC 3B6YA 2L15A 4JV5Q 4X3SA 1GUGA 2ZXOA 1IZ6A 4LF9Q 5E4XA 2UXDQ 1AP0A 1CM9A 3AB9A 3A8KE 2QKIC 5LMNQ 3RNUA 3NENA 2AQ3B 3F2DA 1D7QA 2NZHA 1KXLA 4FXDA 3K0YA 3A54A 1XMQL 3PIOA 4Q5VA 3T13A 1RODA 5KNBA 4K14A 3CPFA 4F8MA 3VYSA 2I07B 4MTNA 4N9TA 3KFUA 3DMUA 1A2UA 2LXKA 2R3ZA 5DLQE 1C0AA 2EIFA 4DK6C 5CORA 2F0LA 4ZRZA 1SNDA 3DM1A 3VA7A 4LF6Q 3R3OA 1EWCA 2Q2UA 1QVFA 4A3GG 4KN4C 4DA2A 3CD6A 1DCZA 1HNXL 3T16A 1A8VA 4BXXG 1BO0A 1D5MC 2DN8A 4X3TA 4DAVA 4KHZA 2NUCA 1SYCA 3TEHB 4MNOA 2QA4A 2HHHQ 3VA5A 1YHAA 3L3OC 4GZYC 2IT1A 1HHVA 4PMWA 4JG2A 4GOPC 3ULPA 1XJVA 5C44B 1B7YB 1YJWA 1PRTB 5JEAJ 4ZQ3A 2AWNA 3P1HA 1PH3A 5CV7A 1D2BA 4MIUA 1I94L 4BBSG 3BVZA 4JI5Q 2RHQB 1AAFA 3NTHA 3HEJA 1Y1WB 1I6HH 5E1FA 5EAYA 2HDMA 3HOWH 1MSHA 4XQJA 3PUZA 4DR1Q 1SE4A 1SDFA 5EPLA 1MI2A 2B2UC 2AQ2B 5JEAG 2Q8TA 1VQLA 3PUYA 4C3HH 3U58A 1S5FD 4JCVE 1OO9B 3RUZA 4L5TA 1N36L 1X3GA 2E76C 4LFAL 4JBWA 3I73A 4KI0A 3FEWX 4DN4M 4IQZA 2O5IC 2RBMA 4KKSA 3M3YH 4HJAA 1CHPD 3CW2C 1U4MA 3S1NB 2Z1CA 4CHTB 3I91A 4IURA 3L2PA 3GP7A 2DY8A 1KDAA 1ZKOA 1E0BA 1VQAA 4LUOA 3FMCA 2AUKA 4YWMA 3HRZC 3URYA 1ILPA 4JI1Q 4AQYL 2ZXRA 1PFMA 1CKMA 1DGSA 1FJGQ 3FKIB 2B8GA 2EDGA 3AEVA 2CQOA 3CQZB 1SMYC 5C4JB 2MGSA 2KHIA 2RSOA 2CQAA 3SE0A 1G91A 4DNTB 3IAYA 4NDXA 3M4QA 2B2TA 3PV0A 3S1QB 1V1OA 3J81c 3S15B 4NB3A 3GTKH 2K5NA 2MJ8A 3DUZA 1WI5A 3HOYG 1K0SA 4IUUA 3X3NA 4GLVB 1RKNA 5NUCA 3OOCA 2ZJPA 1CSPA 3OTOQ 4GNXA 4ZKCB 1JJCB 1PYWD 5ELBA 3U4VA 1ZEQX 2K50A 1ASYA 2ID0A 2IHFA 4YY3Q 1IYUA 2RQXA 5C3EB 5FLXL 2NVTB 4O1NA 4PZ7A 3N6RA 4B3SQ 1L0YB 1DOLA 2D0OA 3I4LA 4BY7B 3I55A 4RWSC 3FVQA 2EE1A 5G3LD 1C7YA 1BBUA 5FO8B 4DAMA 4DR4L 2FFKB 4XQQA 4KY5A 3TSSA 2NTSA 2L55A 4OELB 4IALA 5IT9L 1QZGA 1N33Q 1I4PA 2R7ZB 5M5YB 2EXFA 5KGUA 3SEBA 2ZT9C 3KJOA 2KENA 1ZYRD 3C1FA 4DUZL 1VQ8A 1PTOB 4DPGA 1SE3A 3CC7A 1L1OB 2J0TD 4V190 5KNDA 4FF3A 1LTSD 2HUGA 1PH2A 3KDFA 2GA4B 2OCEA 1FNUA 3MZ5A 2KOLA 3J7ZC 1HA5A 2KQ3A 1NAPA 3RN2A 2JEAI 1G51A 4ULLA 2OQ0A 1WTXA 2G9HD 4A3DG 1HNWL 4AYBB 3PF5A 1YNJC 3MXNA 5G3LF 1YVCA 2D9UA 2F0EA 2R7FA 2Z0SA 3AYHB 1D8LA 4A93H 2IX0A 2EYHA 1PZJD 1SE2A 4EVOA 2F4VQ 2J4XA 2B3GA 2WIIB 1Z6HA 3SK8A 1TY2A 4C3HG 3TZDA 4DNRB 1UE6A 3CCSA 1UNSA 3GTPH 4GN4B 3ND9A 4IJHA 1Y8OB 4LMQD 3JC66 1G2TA 1HNZQ 1H9MA 1STNA 1VQFA 3J81E 1E2VA 1Y1WH 2D5DA 4JI7L 4KN7C 3KJPA 1I50B 1SNMA 3GTOH 4C2MH 4DV3Q 2E5LQ 2EJFC 2KEDA 1STYA 2WFWA 2PZUA 1H9SA 1WD0A 4X62Q 4R4IA 1QVCA 3KLRA 1UEAB 3I72A 4X6AH 2K03A 3I3CA 3AFPA 1LTLA 4FDBA 4DF7A 4UDUC 1PH9A 1D1KA 2F1MA 1IL2A 1X55A 3A8JE 1TS4A 3JAML 1UWVA 1FGBD 3CRKC 2ZM6L 4U68A 1BKBA 1OTCA 1JT8A 1GUOA 2R93G 1V8QA 1AZPA 4BBRB 4ILWA 1TS3A 3CQZH 2CWPA 3L9AX 1I3QB 2K75A 3PQIA 5KIXA 1V9PA 1U4LA 2JA6H 3S24A 4GKJL 4XT1B 4A3MB 1VQ4A 4B9WA 4LFCQ 3OSOA 1TWGH 1EUJA 1IL8A 2CQFA 3I4MH 4A3IG 3K7UC 4LF4Q 1ILQA 2OF1A 2Z8LA 3S2DB 2A6HC 2PNRC 3T1HQ 5I6WA 3HFZB 1QNKA 3ZJYC 2JA5B 1XNRQ 2WINB 4UPAA 3W1BA 4CDCC 1VQGA 1ESKA 4A3FH 3TN2A 2K04A 4RCOA 1Q82C 3I4NH 1X56A 4DKAC 3ULJA 5J1ZA 1X54A 1TVXA 3QIAA 5IODA 4C1NK 3AU7A 1EZ6A 3J80i 2FMMA 4I65A 1EY8A 1GXDC 4ABNA 2R61A 1A0IA 1Y1VB 1IBKQ 2F0DA 1RF2D 1KC8C 3A5ZB 2QW7A 1DM0B 3OMCA 3UI2A 3H09A 1E3PA 2K32A 3NQIA 4YHHL 4JYAQ 1XTCD 3TZUA 1W6JA 1KRSA 1AZQA 2XNAC 5HURA 4K5XA 1EY0A 1IW7C 3OYYA 1EY5A 4GN3B 1STAA 5A35A 1I6VC 1PXUA 4YIJA 1DXMA 1L2FA 5GAGC 5HGQA 4PMBA 2E2IB 2MO0A 1XMOQ 4X66L 5F2DA 5C4XH 4LUZA 4H02A 2Z9HA 1TS5A 3V05A 1ESFA 4HJ5A 1D5ZC 4JBMA 4K5VA 4DV6Q 5EJWA 4HTHA 1Y1WG 2EJMA 3S16B 1BXTA 3J7AF 2UUAL 4DAYA 4HSPA 3EBEA 2F0JA 4KV6A 1R4PB 1N34Q 3U4ZA 1BF4A 3R93A 5CV8A 1PYBA 5DM63 2F52A 1VQ9A 3GD7A 4NKLA 2DNCA 4UP9A 5M3FB 3HOZH 2R6GA 4HIKA 2ALYB 3SK5A 1YITA 5LMNW 1DZ1A 4JOIA 4CKEA 2KHSA 1B70B 3IFTA 2V4DA 1K8AC 4C3IH 2A8VA 3GTJB 1SMYD 4JI2L 1G6PA 1I50H 3MAQA 1PHJA 4JV5L 2UUCQ 1K3RA 4B3MQ 4P74A 3E9HA 2F0KA 4KLKA 4LFBQ 2C5CA 4QUFA 3V96A 4P75A 3S1MB 1NR2A 2JXMB 2Q8IB 1HA6A 3FKIG 5C3WA 4PZ6A 4Q0FA 3AQQA 4X64L 4A3KB 2YTXA 3AFQA 3VR5A 5M3MB 4ALPA 1K83H 1X3PA 4X3KA 4FF2A 3KUPA 4TRDA 1TWCH 4OX9Q 4NPSA 1RJTA 3BS1A 4YCUA 4IO9A 3I4MG 3V2TA 1NCVA 5HGTA 3MFGA 2PMZB 4BBRH 3TDQA 5IWAL 4M8AA 1JOQA 4A3LH 5C6AA 3A56A 4DR2Q 4U673 4KHPQ 1YNXA 4UY8C 1ONLA 1NY4A 1F2ZA 4JI6L 2CKZB 2K5VA 3KYHC 4DV4Q 5TSSA 4BXXH 3F8TA 1WWGA 3OW2A 1WCMB 4N9PA 5BR8Q 5C3EG 3QR8A 1VQ5A 1GUSA 3DWAA 2ASBA 3H3VH 3OWEB 4R4OA 4BY7G 1HZBA 1K8GA 2BA1A 2M2LA 2CVRA 4KMUC 3U9OA 1NBWA 4BBSH 2XVSA 3NE5B 3PMFA 3F2CA 3CCJA 5E3FA 2L4NA 1EIFA 1QOHA 1O7LA 1YJNA 3T56B 1KNAA 1Y8PB 1K28A 2R7DA 2KECA 2KCCA 3ONAB 4K8IA 1XNQQ 2O2LD 5JJZA 1X9NA 1TR5A 2BOSA 1XPRA 4TVAB 1GUTA 1YNJD 5LMUL 1G8ZD 4ZUJA 1MHWC 4I7ZC 2CH4W 3LWEA 1VQBA 2HCCA 2H5XA 4WJ3M 1U0LA 5CBAE 1AEXA 2B2WA 4JI3L 2HQEA 1TWFH 1LT6D 2IX1A 3BZDB 3ER0A 4AYBG 1VQCA 2KUMA 2JA8H 4IUPA 1EWHA 5ELNA 3UDIA 2A74C 4IPHA 5M5WB 4A3EB 1XX8A 3SHLA 2KCNA 2RCNA 1AN8A 1J9OA 1KAAA 2MNAA 2Z6KA 2QF7A 4ODGA 3P7JA 4B3TL 1GKHA 2SNMA 3KOJA 1Z9FA 2NVYH 3NQTA 2DJGC 3HOZG 1PLFA 1IBMQ 1B8AA 1NTGA 4H7BA 2M00A 1HQMC 1HJPA 2EOTA 3CCUA 1EFID 1GM5A 1H9SB 2NVXB 4C3IG 1N32Q 3QG1A 1GUNA 2NBFA 4XYOA 1V1QA 1F77A 3HOYH 1G2SA 4XQNA 3S9WA 4JI4L 5M5XB 2D2CC 5ELEA 3G7LA 4CJ1B 1F2LA 4J8QA 1IBLL 1U9RA 4JBJA 2F3IA 1FNVA 1JOKA 2VB3X 1JE4A 3EA6A 4DV7L 1I4RA 3M85A 2VUMB 1B9MA 1F2YA 1SMXA 5J39A 5FLXc 4B3RQ 4LF8Q 4MHEA 5EPKA 4B3SL 4QJFA 1SE8A 4ME3A 4LF7Q 4G7HC 1TWHH 4GN5A 4C3JB 4DV0Q 3RZOB 4A3BB 4BBRG 2KBNA 4X65Q 3HOVB 4A3LG 2BH2A 1LO5D 2K4KA 1ET9A 2A6HD 3RN5A 2NN6G 1RIPA 1WFQA 1HZAA 4RGMA 5IT9c 3GTLH 2B2YC 1HR0Q 4L5SA 3SDZA 1JCKB 2K5WA 3HP3A 2UXCL 1LT3D 2A69C 2BH8A 1PFSA 2K01A 4RGTA 4Z9CB 5J3BA 4WFN3 1JJGA 3DWQA 1HPCA 2JA5G 1VQ6A 2PPBC 4M1UB 4A3DH 2E8GA 5JJIA 1L1OC 1S5CD 1VMPA 1KABA 1BBXC 2D0PA 5D65A 1PYSB 1Q8IA 4IOAA 4XT3B 2HQLA 1J5EQ 2QCPX 1Q1EA 2UUBQ 2K33A 4NXML 2D62A 1YNNC 1L0WA 3KK7A 3F2BA 1X65A 2VB2X 2F0GA 2F4VL 1OXXK 5IOCA 1IW7D 2E2JB 1SNOA 1QJOA 1MIUA 1N9WA 2LMCB 3HKZE 3D4DA 1HUMA 1PZKD 4E6IA 1Y1VG 5AFWA 1X3QA 1EYDA 1EQVA 2LY7A 3RR5A 3S2HH 1MBYA 4RA8A 1RDPD 3QO2A 2EXZA 4BY1H 1WTHA 4EX5A 1JQYD 3W1GA 4HAEA 2GN5A 2UXBQ 2Q2IA 4P73A 2JA8G 3PF4A 3LWUA 4RMFA 1AE3A 4F87A 4JI0Q 4DV2L 2K28A 4J15A 3PIO3 1EYCA 3L0OA 3RD4A 4N8FA 5EQ0A 1QB5D 1T9HA 4ZUIA 4X62L 2VZAA 2H1EA 4UP8A 3PO3B 1ENFA 4H44C 1I4GA 4A75A 1UE1A 4Y7NB 2OEOA 5FLXE 4DAYB 2NVQH 5LL6X 3GTQB 4DR5L 1RD9D 1CA5A 4IPCA 1SYDA 2X69A 4PV1C 3NEMA 1PV4A 1S4ZA 3ITPA 1H9RA 5J22A 1Q86C 2R93H 4BS9A 3M7NA 2E2HB 2KCTA 1OXTA 5BN3A 3R2TA 2AWOA 3S1RB 4KHVA 3OPOA 3K59A 2VQEQ 1YHBA 3G4SA 2C9OA 1BCPB 2MHVA 3MHBA 5IT9E 1H95A 2Q2HA 3ERQA 1JJ2A 1M90C 1VF5C 4JVZA 3A5UA 1Y14B 4DR6L 1SN8A 1TQOA 2JA9A 3FPUB 2Z4HA 3STBC 4A3IH 3LGJA 4K2LA 1JB3A 2K5QA 1JB7A 1BJ6A 2CW0C 1WD1A 1LYLA 5IIFA 2PI2A 3RLNA 3SXHA 1ET6A 5IP9H 2N88A 3KLSX 1XMQQ 3VYUA 2IWHA 3H3VC 1R9TB 2PCFB 4O42A 4BWGB 3QWNA 1HXYD 2K14A 4RHRA 1VQOA 1EWIA 3J81i 2EY6A 2YTVA 2EQSA 5D14A 1HTLD 1PH1A 1VCIA 1HRJA 2F0OA 2NN6I 3D31A 4FVMA 4HMIA 2YSAA 2UU9L 2XWJB 4WJWA 2PZWA 3DEOA 3U9SA 1EOVA 3G6JB 5I2XA 1MKHA 3DXJC 3EVQA 1IBKL 3S14B 3M4PA 3GTGB 1XXGA 2XGTA 2PO4A 4LF5L 1FNWA 2F0NA 3H3VI 3D6CA 4DR7L 1NMGA 5FLMG 1MJEA 2K5HA 1KQSA 2FHTA 1WCMG 3K57A 4G7OC 4HIOA 2PMZE 4IN3A 1Q90A 1CZGA 2B2VA 1NNXA 1CKNB 4LWCA 2BA0A 1EY6A 5C44H 3MTSA 4JK1C 2QEXA 1I94Q 1A2TA 4G7ZC 1EIHA 4UHVA 1WWEA 1TWAB 4HCEA 3JAME 3MEHA 2F3WA 4DXFA 4OIJA 4ZYSA 2BCOA 2PI2E 4FF1A 1WYDA 2KVMA 4BY1G 1PH8A 2PNHA 3RZDB 2L4LA 1X3EA 2NZ1D 4POGA 1N34L 5IGBA 1K9MC 1SFOB 2K7VA 2EY5A 1KRTA 2QEJC 1J6QA 4DUYL 2K6AA 1N36Q 4LFAQ 4HEDA 1BDOA 3WOFA 2B8FA 2PQAA 3H0GB 2IY5B 3VR2A 2QILA 4IUNA 4N8X1 2XSCA 3MXUA 4FYDA 5CV5A 2LKVA 2O4XA 2CHBD 5EKKA 5D3IB 4B9XA 4K0KL 1WWFA 3FHWA 1CSQA 3S1NH 4DAPA 4C56C 4WRDA 3EQLC 5T1GA 3NELA 4AQYQ 3CPWA 1D6EC 2XWBB 1UE5A 3TP8A 5EKIA 2N78A 3A7AB 4HMJA 4RGNA 5KYLA 1GUWA 3FKIH 4DV5L 2PW7A 5C4JH 3X3MA 3T1YL 4DV1L 2ATWA 1HH2P 3GTMB 2ICEC 1SYBA 4OGQC 3MC0B 2B2TC 3S1QH 5AJ3Q 2FMCA 3S15H 3FPPA 1SNPA 2L0CA 4S3SA 1STGA 2WP8J 1E1TA 1X6OA 4ZAIA 3VYRA 4MZ9A 5IGCA 3P20A 4G57A 1LTBD 1NJIC 1D1IA 3HKZB 1LM0A 4TSSA 5IP9G 4GNXC 4HJ7A 1T5XD 4AH6A 1TXYA 1PH5A 3BDOA 1A3UA 3VR6A 1GVPA 4DV4L 1B1ZA 4BA1I 5C4HA 1EZ8A 3E3XA 2VUMG 5DEHA 3NK9A 2JZWA 5C3EH 5KNCA 3CC2A 1JWMD 3OIQA 2NVTH 5COYA 3QB3A 4BY7H 2TMPA 4APVA 3TP7A 5LL6S 1BVSA 4F88A 1EY4A 4P72A 3IRBA 1WJJA 4A3BG 5CYUA 2IPKD 2JYOA 5L37A 3HOVG 1GHJA 4DGZA 4LNQA 1U4PA 1O78A 2A68C 5C4ZA 5GAHC 3S17B 2EJGC 1HFNA 1SYGA 5M5YH 2R7ZH 4DUZQ 2KA7A 2WKDA 2L11A 3HOXB 1I4QA 1PTOH 3CCRA 3I2ZA 1AH9A 2ZTCA 1ENCA 1YNND 3BYYB 3K7AB 2YTYA 1ESRA 1Q3LA 4AIMA 5C44G 4OONA 1P16A 3TS2A 1HNWQ 1F9SA 3FRPB 3GDEA 3H91A 3EJIA 2YYZA 4FF4A 1NR4A 1QWYA 3TBIB 1EYAA 3ZYYX 2NWGA 4GKKL 4OO1G 4JI8L 3G71A 1K3BC 1PZID 5KEEA 1B53A 2ENBA 3VYTA 2VQFL 3UDGA 3K58A 4CBVA 3KF8A 2JA7B 2KJXA 5IGGA 5H1SE 4HR7B 4IFDG 2FJ2A 1F2MA 4DR3L 1VDZA 2PW5A 2R92B 2OXPA 3EFXD 1HZCA 2N3SA 4NXNL 1I5FA 4RHSA 4V0BA 1II3A 1V1PB 1GJXA 4JI7Q 1QCBD 2V1CC 3M9BA 3FP9A 2NZOA 3A74A 3H6MA 3K81C 1YI2A 1NMFA 3MFYA 4TKOB 2JN4A 4DXGA 5ELDA 2CH4A 3CU7A 4LK1C 3OMGA 4XDXA 4LF9L 2UXDL 5I2YA 1M1KC 5LMNL 1JR0D 2ZTDA 4LW1A 3PO3G 4HSVA 1W3SA 4ID6A 3R8BA 1IKMA 5A2QL 4LAAA 2WACA 5GADC 1B3QA 3IFDA 2ZM6Q 1OXSC 4QIWB 1MFSA 1LT5D 1S72A 1HFGA 2E2DC 5EBDA 2DGYA 1HR0W 2XN9C 3PGZA 2I5MX 4XIGS 4JC0A 4DFAA 3STBD 3J80L 4A3JB 4RKLA 5BN5A 3CRLC 2RF4A 3M4OB 4H13C 1KDCA 2ZJRA 1WTPA 4G4KA 2F4IA 5C0XG 1TS2A 4LF6L 1I3QH 2NN6H 5IGEA 4GKJQ 3D0FA 1VQNA 2L12A 4A3MH 2L9HA 1F6UA 3E5SA 1E24A 1XYIA 1A6XA 2J7ZA 1Q7YC 3PIPA 3K80C 1WTVA 1BR9A 3OHXC 2HHHL 1A62A 1E22A 5DNFA 1A1TA 3S2DH 3GO5A 4K2KA 3HGBA 4J6HA 5FK9C 4L63B 2G9DA 1HQRD 1YHQA 2JA5H 1A63A 1UAPA 5K36H 1Y8NB 4QMGA 5EBCA 3IL8A 1CKNA 2B29A 2IJ0A 4FO2A 5LHY1 3KBXA 4JI5L 5FOBB 1I6HB 1LACA 4R1JA 3TMEA 1C48A 1ICWA 1PRTC 3HOWB 2VL6A 2WV6D 1EQTA 4POFA 4L5RC 1J5EL 1Z47A 2UUBL 2B2UA 1A15A 4DR1L 5IYCG 2R7ZG 4IJLA 2N55A 3J7A5 2LSSA 4R9WA 5ELFA 3C2PA 3DLLA 2B39A 1CKOA 1JOOA 3OWFA 1W6KA 1Y1VH 4YHHQ 4RH6A 4WJ4A 4JPBW 1K73C 2OTJA 2SDFA 3WOEA 4KD4A 1VQEA 5DM73 3A55A 3M3YB 4EQ5A 3L7ZC 4HJ9A 3S17H 3NP8A 1NSNS 3MVVA 5C5MA 2HIXA 4QY7A 3ICEA 2K1BA 3CCQA 3Q23A 1VMCA 2AHOB 4DNIA 2X6GA 2JEBI 4X66Q 1K8OA 2E2IH 3CCEA 4JI1L 2E74C 2I5LX 1FJGL 2Q2TA 2BDOA 2RCFA 3OW7A 4HN7A 2EY2A 1SXTA 4CDDC 3PCOB 1F9RA 4ZK9B 2WB1B 4IFDI 2UUAQ 3BDLA 3NBIA 3NSWA 1SAPA 3GTKB 3S16H 4R4CA 2QDBA 2JP1A 3NUCA 2PQAB 1LTGD 2F0IA 1Q8KA 1WWDA 2XRQD 3O13A 4LUVA 1CUKA 1YEZA 1N8RC 2LXJA 1JWSD 5M3FH 2KHJA 2XRSD 1E2ZA 2IHEA 4I7AA 1SLJA 3OTOL 3BZKA 1IHZA 4JOIC 3PIP3 4ME5A 4O0AA 3TRZA 2EVBA 4OWXB 2F0TA 3RLFA 3CF5A 1U4RA 1YBYA 1XPOA 4O2DA 3GTJH 3NTIA 4K8JA 1BCPC 2VNUD 1HTPA 4RAUC 4YY3L 2EYLA 1U6PA 2F0QA 3SGIA 1G6ZA 5JVG3 2Y0SB 4FP5D 4DK0A 4RKBA 1DYQA 1CFMA 1QNUA 4Y52H 3NBHA 3VDYA 2BE5C 3S1MH 5I4DA 2PYKA 2NYZD 3QOLA 4X64Q 3I70A 4R8NA 2OWOA 4A3KH 2CWAA 5FJ8G 5M3MH 1IYVA 1K0RA 1M4VA 4A3MG 2NTTA 1BNZA 5C0XI 1N33L 3D6WA 3E9IA 4IUVA 1KTKA 1EYGA 1CA6A 3T53B 5IWAQ 2F0WA 1Q3ZA 4A3JH 4F7XA 3Q8DA 3M4OH 2HIVA 4R4QA 2EPBA 4JI6Q 3HKZG 1PTOC 5K36G 2N8NA 2SNSA 3BG3A 1O7IA 2OTLA 4B08A 1CQVA 3MXPA 1KD1C 2A6EC 5FLMH 4CJ2C 4A93B 2VW9A 1WCMH 4YCWA 1NE3A 2G5DA 4NW2A 4P71A 2A68D 5JJKA 3HKSA 3BYTB 1QVGA 3LNNA 4MN3A 3GTPB 2EYMA 4K6DA 5EKLA 4PZ8A 4L8JA 5CV6A 2JQOA 3D4RA 1VQMA 3CHBD 3MWYW 2HDLA 1LTRD 2JSOA 1HNZL 4KTAA 3GTOB 4C2MB 2F0FA 1A3TA 5C5LA 4DK1A 5LMUQ 1V1PA 5KRUA 1KIXA 4DV3L 5C3XA 5JPMC 2E5LL 1RTOA 4JBKA 1SNCA 3DEPA 3WDNA 4PMCA 3HOXG 3A0JA 4KJOA 2RDHA 4JI3Q 3BDCA 2B2WC 1CQFA 2F0HA 3G48A 3T4AC 4QUCA 1C9OA 1SYEA 1ASZA 3E0EA 3MEFA 2WAQB 1L0XB 1EEID 1YZ6A 1G291 1MJCA 4XXEA 1CHQD 3KF8B 1TKWB 2KEEA 2HCIA 3E0JA 3JAMc 3PUVA 2WKCA 2SOBA 2EYJA 1VF7A 1A6BB 1LLRD 5M5WH 4A3EH 3BVMA 4PG3A 4B3TQ 2LS01 4PQXA 2JA7G 2Z6KC 4FXKC 1AFPA 2A5HA 3I56A 3EIVA 1WOCA 4QCLA 1ML0D 5M3FG 2R92G 4OHJA 1LTAD 2JA6B 2F0MA 1Z7TA 1DJRD 2VXWA 3GV3A 2TSSA 5IYDG 2X6LA 1TWGB 1VQKA 4TQUS 1AE2A 3I4MB 2RVLA 3NWTA 2NVXH 4LFCL 5AJ3L 1EY9A 4RFBA 5CMDA 2E75C 1EY7A 5CC4A 4ZKBB 4JI4Q 1S40A 3NPPA 5K5PA 4LF4L 2I0QA 1RL2A 3UE0A 2JE6I 3LX0A 2DY7A 4OL7A 1F9PA 4QF4A 5M5XH 3W2DA 1IBLQ 1GD7A 3T1HL
chains in the Genus database with same CATH topology
1X6OA 4L5QA 4YCUA 4MZ9A 4IO9A 3CPFA 1XNRL 4DV7Q 3I4MG 4MTNA 3TREA 3KFUA 4DK3C 1XTDA 1NJIC 2LXKA 4BBRH 1LM0A 4YWKA 5DLQE 5IP9G 5IWAL 3JAMi 1C0AA 2VUMH 4GNXC 2EIFA 4A3LH 4HJ7A 5JJLA 4AH6A 4DK6C 4A3KG 1TXYA 4DR2Q 1PH5A 5M3MG 4KHPQ 1BBWA 1YNXA 1GVPA 4DV4L 4UY8C 4BA1I 1NY4A 2VUMG 2JZWA 4LF6Q 5C3EH 4JI6L 2CKZB 2K5VA 3KYHC 4DV4Q 2Q2UA 3CC2A 4BXXH 1QVFA 2NVTH 4A3GG 3F8TA 4C3JH 1WWGA 3OW2A 3CD6A 4BY7H 4A3JG 3RZOH 2K52A 4A3BH 5BR8Q 4APVA 1HNXL 1BVSA 3HOVH 1A8VA 5C3EG 1VQ5A 4BXXG 2LI8A 2ASBA 3H3VH 4BA2I 4P72A 2ZTEA 1HNXQ 4R4OA 3IRBA 4BY7G 1HZBA 1WJJA 4A3BG 4JYAL 2CFMA 1K8GA 3KLWA 4KHZA 3HOVG 2BA1A 3TEHB 4MNOA 2QA4A 2HHHQ 4QGUA 4GOPB 2M3ZA 1YHAA 4QIWE 2UXCQ 2IT1A 4PMWA 4JG2A 4GOPC 1NBWA 3ULPA 1XJVA 4BBSH 1B7YB 4LNQA 1XPUA 3F2CA 3KF6B 3CCJA 1YJWA 5GAHC 1EIFA 5GQOA 5JEAJ 1YJNA 5M5YH 2R7ZH 2R7DA 2AWNA 1PH3A 4DUZQ 4GLAC 1YIJA 1I94L 4BBSG 4JI5Q 4OWWB 3K0XA 1XNQQ 2RHQB 1AAFA 1XMOL 1X9NA 3CCRA 3I2ZA 1XPRA 1I6HH 1AH9A 2ZTCA 4TVAB 5LMUL 2YTYA 5EAYA 1PH7A 3HOWH 4AIMA 3PUZA 4DR1Q 5C44G 4OONA 1VQBA 2H5XA 1P16A 3ERSX 4WJ3M 1E7ZA 2MO1A 5JEAG 3GDEA 1JMCA 1VQLA 1U0LA 4IPDA 4NXMQ 3TS2A 3PUYA 1HNWQ 4C3HH 4DV6L 3U58A 2YYZA 3HOWG 4QQBX 3CP0A 4JI3L 3PUXA 4JCVE 1TWFH 3PUWA 1QUQB 4L5TA 1N36L 1X3GA 4LFAL 4GKKL 4OO1G 4JI8L 2E2JH 3G71A 4JBWA 5IYBH 2IX1A 2VQFL 3UDGA 4KI0A 3ER0A 4AYBG 1VQCA 2JA8H 1Q12A 5ELNA 3UDIA 5H1SE 4IPHA 4HJAA 3M3YH 4IFDG 4YCVA 3CW2C 4A4IA 4DR3L 2RCNA 2MNAA 2Z6KA 3L2PA 1FGUA 1HZCA 1VS0A 1UEBA 2N3SA 1I5FA 4NXNL 1GKHA 1OXUA 3WWVA 4B3TL 3KOJA 1Z9FA 1VQAA 3BU2A 2NVYH 4LUOA 4YWMA 4JI7Q 3HOZG 2V1CC 1IBMQ 3M9BA 1B8AA 1NTGA 1IYJB 3FP9A 2NZOA 3A74A 3K81C 4GS3A 4YWLA 1CKMA 1DGSA 4DV2Q 4AQYL 1YI2A 1FJGQ 2UUCL 3AEVA 1HJPA 1NMFA 2CQOA 4B3ML 1VQDA 4A3EG 2QGQA 3CCUA 2KHIA 1GM5A 4LFBL 4GLXA 3CMAA 3G6EA 4OWTB 2RHSB 3M4QA 4LF9L 1N32Q 2UXDL 3PO3H 1M1KC 3PV0A 5LMNL 1V1QA 4Y7NH 3J81c 4DR5Q 4NB3A 4RG1A 3HOYH 4JI4L 2K5NA 3GTKH 2ZTDA 4LW1A 3GTQH 3PO3G 1W3SA 2WB1G 4OX9L 1IBLL 1WI5A 2JK8A 3HOYG 4JBJA 4GLVB 2F3IA 5GADC 2ZM6Q 2ZJPA 4HIMA 1OXSC 3J80c 4DV7L 1CSPA 3OTOQ 3M85A 2E2HH 1MFSA 4GNXA 1S72A 1SMXA 3S1RH 1JJCB 2DGYA 3U4VA 3PGZA 5FLXc 1HR0W 2I5MX 4XIGS 2YV5A 4JC0A 2K50A 1ASYA 4B3RQ 4LF8Q 3STBD 2ID0A 4DR2L 4KHPL 4B3SL 2I5HA 2IHFA 4QJFA 4YY3Q 1SE8A 2RF4A 4DR6Q 4ME3A 4LF7Q 2ZJRA 4PZ7A 1TWHH 2WB1E 4GN5A 5C0XG 2EXDA 4DV0Q 4B3SQ 4LF6L 1I3QH 2D0OA 4GKJQ 2MFIA 4BBRG 3I55A 3D0FA 2JJQA 1VQNA 2KBNA 4X65Q 2OQKA 4A3LG 2AKWB 2BH2A 4XTCS 5BR8L 2K4KA 4A3MH 1C7YA 1BBUA 3RN5A 2NN6G 3NBHB 1F6UA 1RIPA 1E24A 1WFQA 1HZAA 3H15A 1LUZA 4DAMA 5IT9c 1Q7YC 2Y0SG 3PIPA 3CCLA 3GTLH 2N49A 4DR4L 1HR0Q 4L5SA 3K80C 2HHHL 1A62A 1E22A 1A1TA 3BZCA 2MQHA 3CCMA 1PH4A 3GO5A 2KCMA 3S2DH 4DR4Q 1Q46A 2UXCL 4A3CH 1R9TH 1QZGA 3CAMA 1N33Q 2BH8A 1PFSA 1YHQA 2JA5H 1A63A 2EXFA 3KJOA 2KENA 5J3BA 1YJ9A 1JJGA 4DUZL 1VQ8A 1CKNA 5GROA 2B29A 4DPGA 3CC7A 4JI5L 2JA5G 5IYCH 1L1OB 4R1JA 1VQ6A 1XNQL 1UE7A 1PH2A 2VL6A 2UU9Q 4A3DH 2E8GA 5JJIA 1L1OC 2C35B 2Y0SE 3KDFA 2OCEA 2D0PA 3EN2A 3K8AA 1Z47A 4POFA 1J5EL 2UUBL 3J7ZC 1PYSB 4IOAA 2HQLA 4DR1L 5IYCG 3CMEA 3RN2A 2JEAI 2R7ZG 1G51A 4IJLA 1J5EQ 3J7A5 1Q1EA 2LSSA 2AMCB 2OQ0A 2UUBQ 4A3DG 4NXML 2D62A 1L0WA 1HNWL 3PF5A 4LF5Q 3F2BA 3S14H 1YVCA 1X65A 3DLLA 3GTGH 1CKOA 2R7FA 2F4VL 3CC4A 1OXXK 3HOUH 1Y1VH 2Z0SA 3AYHB 5HY6A 4YHHQ 1D8LA 4A93H 1S3OA 2IX0A 4DR7Q 4IFDJ 4WJ4A 1MIUA 1K73C 1N9WA 2F4VQ 2OTJA 1Q1BA 3HKZE 4HJ8A 1KL9A 1VQEA 2B3GA 2ZJQA 1VQIA 1Y1VG 4EQ5A 4A93G 1PVOA 3L7ZC 4HJ9A 1UE6A 3BJUA 3RR5A 3CCSA 3S17H 3GTPH 3S2HH 4GN4B 4IJHA 2FXQA 4BY1H 1SR3A 3JC66 3PO2H 2HIXA 1JE5A 4EX5A 4QY7A 2ES2A 3CCQA 1HNZQ 3ICEA 3W1GA 1VQFA 5IY0A 2GN5A 2UXBQ 2Q2IA 2AHOB 4DNIA 4X66Q 1Y1WH 2JEBI 4P73A 4JI7L 2JA8G 3PF4A 4RMFA 2E2IH 3KJPA 3CCEA 1IBML 4K0KL 1TWAH 1AE3A 4JI1L 3GTOH 4JI0Q 2I5LX 4DV2L 1FJGL 4J15A 4C2MH 5IP7H 4DV3Q 2E5LQ 2Q2TA 3L0OA 2B63H 2WFWA 1T9HA 4X62L 3UDXA 2VZAA 4UP8A 3PCOB 3UDFA 4A75A 4IFDI 3RZDH 2UUAQ 4X62Q 1UE1A 4DUYQ 4R4IA 1N32L 4DAYB 1QVCA 5IYBG 1SFOH 2NVQH 3S16H 4R4CA 1E1OA 4OXPA 4X6AH 4DR5L 1W2BA 2PQAB 4IPCA 3AFPA 1Q8KA 1LTLA 4FDBA 1EIYB 1WWDA 4LUVA 3H0GH 3NEMA 1PV4A 1PH9A 1CUKA 1IL2A 1YEZA 1X55A 1Q86C 2R93H 1N8RC 2LXJA 3U50C 5M3FH 3M7NA 2KHJA 2KCTA 1OXTA 1UWVA 2CCZA 2AWOA 2IHEA 2WAQG 2ZM6L 1EQQA 4K0KQ 1VQPA 1IXRA 1BKBA 1SLJA 3OTOL 1OTCA 3BZKA 1JT8A 5C0XJ 2R93G 2VQEQ 4JOIC 3TRZA 4O0AA 1SROA 1YHBA 2IHXA 4OWXB 3TQYA 2VS1A 3RLFA 3G4SA 1PH6A 3CF5A 1H95A 1YBYA 1XPOA 4B3RL 1VQJA 4LF8L 2Q2HA 4O2DA 3GTJH 1EFWA 1HZ9A 2VNUD 1JJ2A 1M90C 3A5UA 1Y14B 3CQZH 2CWPA 4YY3L 4DR6L 1SN8A 1U6PA 2K75A 4LF7L 3ULLA 2JA9A 1V9PA 3SGIA 4DV0L 1EQRA 3STBC 4DV5Q 2JA6H 3S24A 4GKJL 4A3IH 3LGJA 2EC7A 1BJ6A 1JB7A 3T1YQ 1KHIA 1P8LA 4X65L 1VQ4A 4LFCQ 4DV1Q 2WAQE 4Y52H 1LYLA 1TWGH 1EUJA 2CQFA 3VDYA 5FJ8H 2PI2A 3I4MH 2JA6G 3RLNA 3S1MH 4A3IG 1SRUA 1KAWA 3K7UC 4X64Q 3W5OA 3GTMH 4LF4Q 5IP9H 3CXCA 1XMQQ 2A19A 1FVIA 3UE1A 1HR0L 2OWOA 4A3KH 2CWAA 5FJ8G 5M3MH 3T1HQ 3HFZB 3ZJYC 3PSIA 4GNXB 2K14A 1K0RA 2XTIA 4A3MG 4UPAA 2YU9H 5C0XI 1N33L 1XNRQ 4GOPA 3W1BA 1VQOA 3E9IA 1VQGA 1EWIA 3J81i 2A1AA 4QL5A 2YTVA 4JI1Q 1EYGA 4A3FH 2EQSA 3I4OA 4A3GH 5IWAQ 3NYBB 1PH1A 1FL0A 1ESKA 1Q82C 1Q3ZA 3I4NH 3KF6A 4A3JH 1X56A 4DKAC 1VCIA 3ULJA 3Q8DA 1L1OA 3RLOA 2NN6I 3D31A 3M4OH 1X54A 2HIVA 4A3CG 4A3FG 4R4QA 2UU9L 2YSAA 4A76A 3CCVA 3I4NG 1EOVA 4JI6Q 1MKHA 3HKZG 5K36G 2N8NA 3J80i 1O7IA 2DUDA 2OTLA 1IBKL 1KD1C 3M4PA 2GVBA 5FLMH 2XGTA 4IPGA 4LF5L 1A0IA 1IBKQ 2VW9A 1KC8C 3A5ZB 3H3VI 1WCMH 4YCWA 1E3PA 4DR7L 4YHHL 1NE3A 1NMGA 4JYAQ 4P71A 5FLMG 1V43A 1KRSA 2HT1A 1MJEA 5JJKA 1QUQA 2K5HA 3HKSA 1KQSA 3J81j 1Q81C 1WCMG 1QVGA 3OYYA 4HIOA 4GN3B 2PMZE 5GAEC 4PZ8A 1CKNB 1X3FA 4LWCA 2JQOA 3HOUG 1VQMA 2BA0A 5C44H 1L2FA 2QEXA 1I94Q 1GO3E 1HNZL 5GAGC 3KDFB 5HGQA 2UXBL 1VQHA 2MO0A 1XMOQ 4X66L 5E7NA 1WWEA 5C4XH 4HIDA 3HOXH 1Q3YA 5LMUQ 4LUZA 4H02A 2PI2E 1KIXA 1VQ7A 4JI0L 1WYDA 4DV3L 4BY1G 3MXNB 4HJ5A 3K7AH 1PH8A 2E5LL 4JBKA 3PO2G 4OO1I 5C4XG 1PA6A 2PNHA 3HOXG 3A0JA 2L4LA 1X3EA 4JBMA 4DV6Q 4POGA 1N34L 1K9MC 4JI3Q 1Y1WG 1KRTA 2UUAL 1J6QA 3F1ZA 4DUYL 3TS0A 3EBEA 3G48A 1N36Q 4LFAQ 1N34Q 1C9OA 2VY3A 3U4ZA 4JI8Q 4GKKQ 5IP7G 3E0EA 1ASZA 3MEFA 2PQAA 2VQFQ 2B63G 1OXVA 1PYBA 2IY5B 2F52A 1YZ6A 1VQ9A 4IOCA 1G291 3GD7A 1MJCA 2GVAA 4UP9A 5IE8A 3HOZH 3KF8B 2R6GA 3I7FA 4HIKA 2ALYB 3DM3A 3JAMc 3PUVA 2JA7H 1YITA 5LMNW 4DR3Q 1A6BB 5M5WH 4A3EH 4JOIA 1WWFA 1U5KA 4PG3A 4B3TQ 3FHWA 1B70B 5ELOA 4NXNQ 1CSQA 3S1NH 1K8AC 2R92H 4R4TA 2Z6KC 4C3IH 2VQEL 2A8VA 2JA7G 3H0GG 4AYBE 4JI2L 3I56A 1G6PA 1I50H 1WOCA 3EIVA 4L5RC 3NELA 4AQYQ 3CPWA 5M3FG 4UP7A 5IYDH 1PHJA 4JV5L 2UUCQ 4JI2Q 1K3RA 1UE5A 4B3MQ 2R92G 1QZHA 4P74A 2N78A 3E9HA 4KLKA 3FKIH 4LFBQ 3B6YA 2L15A 4JV5Q 4DV5L 5IYDG 5C4JH 1VQKA 1IZ6A 3T1YL 4P75A 1AE2A 4TQUS 4LF9Q 2UXDQ 2NVXH 4LFCL 5AJ3L 4DV1L 5LMNQ 2ATWA 1HH2P 3FKIG 3RNUA 3NENA 3F2DA 1D7QA 4PZ6A 4JI4Q 3AQQA 5AJ3Q 2NZHA 1S40A 3S1QH 4X64L 1KXLA 2YTXA 3S15H 4LF4L 2I0QA 3AFQA 1RL2A 2JE6I 3UE0A 1K83H 4ALPA 1XMQL 1TWCH 5M5XH 3PIOA 4OX9Q 1IBLQ 1GD7A 4NPSA 2WP8J 3T1HL 1E1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6O A;  4L5Q A;  4YCU A;  4MZ9 A;  4IO9 A;  3CPF A;  1XNR L;  4DV7 Q;  3I4M G;  4MTN A;  3TRE A;  3KFU A;  4DK3 C;  1XTD A;  1NJI C;  2LXK A;  4BBR H;  1LM0 A;  4YWK A;  5DLQ E;  5IP9 G;  5IWA L;  3JAM i;  1C0A A;  2VUM H;  4GNX C;  2EIF A;  4A3L H;  4HJ7 A;  5JJL A;  4AH6 A;  4DK6 C;  4A3K G;  1TXY A;  4DR2 Q;  1PH5 A;  5M3M G;  4KHP Q;  1BBW A;  1YNX A;  1GVP A;  4DV4 L;  4UY8 C;  4BA1 I;  1NY4 A;  2VUM G;  2JZW A;  4LF6 Q;  5C3E H;  4JI6 L;  2CKZ B;  2K5V A;  3KYH C;  4DV4 Q;  2Q2U A;  3CC2 A;  4BXX H;  1QVF A;  2NVT H;  4A3G G;  3F8T A;  4C3J H;  1WWG A;  3OW2 A;  3CD6 A;  4BY7 H;  4A3J G;  3RZO H;  2K52 A;  4A3B H;  5BR8 Q;  4APV A;  1HNX L;  1BVS A;  3HOV H;  1A8V A;  5C3E G;  1VQ5 A;  4BXX G;  2LI8 A;  2ASB A;  3H3V H;  4BA2 I;  4P72 A;  2ZTE A;  1HNX Q;  4R4O A;  3IRB A;  4BY7 G;  1HZB A;  1WJJ A;  4A3B G;  4JYA L;  2CFM A;  1K8G A;  3KLW A;  4KHZ A;  3HOV G;  2BA1 A;  3TEH B;  4MNO A;  2QA4 A;  2HHH Q;  4QGU A;  4GOP B;  2M3Z A;  1YHA A;  4QIW E;  2UXC Q;  2IT1 A;  4PMW A;  4JG2 A;  4GOP C;  1NBW A;  3ULP A;  1XJV A;  4BBS H;  1B7Y B;  4LNQ A;  1XPU A;  3F2C A;  3KF6 B;  3CCJ A;  1YJW A;  5GAH C;  1EIF A;  5GQO A;  5JEA J;  1YJN A;  5M5Y H;  2R7Z H;  2R7D A;  2AWN A;  1PH3 A;  4DUZ Q;  4GLA C;  1YIJ A;  1I94 L;  4BBS G;  4JI5 Q;  4OWW B;  3K0X A;  1XNQ Q;  2RHQ B;  1AAF A;  1XMO L;  1X9N A;  3CCR A;  3I2Z A;  1XPR A;  1I6H H;  1AH9 A;  2ZTC A;  4TVA B;  5LMU L;  2YTY A;  5EAY A;  1PH7 A;  3HOW H;  4AIM A;  3PUZ A;  4DR1 Q;  5C44 G;  4OON A;  1VQB A;  2H5X A;  1P16 A;  3ERS X;  4WJ3 M;  1E7Z A;  2MO1 A;  5JEA G;  3GDE A;  1JMC A;  1VQL A;  1U0L A;  4IPD A;  4NXM Q;  3TS2 A;  3PUY A;  1HNW Q;  4C3H H;  4DV6 L;  3U58 A;  2YYZ A;  3HOW G;  4QQB X;  3CP0 A;  4JI3 L;  3PUX A;  4JCV E;  1TWF H;  3PUW A;  1QUQ B;  4L5T A;  1N36 L;  1X3G A;  4LFA L;  4GKK L;  4OO1 G;  4JI8 L;  2E2J H;  3G71 A;  4JBW A;  5IYB H;  2IX1 A;  2VQF L;  3UDG A;  4KI0 A;  3ER0 A;  4AYB G;  1VQC A;  2JA8 H;  1Q12 A;  5ELN A;  3UDI A;  5H1S E;  4IPH A;  4HJA A;  3M3Y H;  4IFD G;  4YCV A;  3CW2 C;  4A4I A;  4DR3 L;  2RCN A;  2MNA A;  2Z6K A;  3L2P A;  1FGU A;  1HZC A;  1VS0 A;  1UEB A;  2N3S A;  1I5F A;  4NXN L;  1GKH A;  1OXU A;  3WWV A;  4B3T L;  3KOJ A;  1Z9F A;  1VQA A;  3BU2 A;  2NVY H;  4LUO A;  4YWM A;  4JI7 Q;  3HOZ G;  2V1C C;  1IBM Q;  3M9B A;  1B8A A;  1NTG A;  1IYJ B;  3FP9 A;  2NZO A;  3A74 A;  3K81 C;  4GS3 A;  4YWL A;  1CKM A;  1DGS A;  4DV2 Q;  4AQY L;  1YI2 A;  1FJG Q;  2UUC L;  3AEV A;  1HJP A;  1NMF A;  2CQO A;  4B3M L;  1VQD A;  4A3E G;  2QGQ A;  3CCU A;  2KHI A;  1GM5 A;  4LFB L;  4GLX A;  3CMA A;  3G6E A;  4OWT B;  2RHS B;  3M4Q A;  4LF9 L;  1N32 Q;  2UXD L;  3PO3 H;  1M1K C;  3PV0 A;  5LMN L;  1V1Q A;  4Y7N H;  3J81 c;  4DR5 Q;  4NB3 A;  4RG1 A;  3HOY H;  4JI4 L;  2K5N A;  3GTK H;  2ZTD A;  4LW1 A;  3GTQ H;  3PO3 G;  1W3S A;  2WB1 G;  4OX9 L;  1IBL L;  1WI5 A;  2JK8 A;  3HOY G;  4JBJ A;  4GLV B;  2F3I A;  5GAD C;  2ZM6 Q;  2ZJP A;  4HIM A;  1OXS C;  3J80 c;  4DV7 L;  1CSP A;  3OTO Q;  3M85 A;  2E2H H;  1MFS A;  4GNX A;  1S72 A;  1SMX A;  3S1R H;  1JJC B;  2DGY A;  3U4V A;  3PGZ A;  5FLX c;  1HR0 W;  2I5M X;  4XIG S;  2YV5 A;  4JC0 A;  2K50 A;  1ASY A;  4B3R Q;  4LF8 Q;  3STB D;  2ID0 A;  4DR2 L;  4KHP L;  4B3S L;  2I5H A;  2IHF A;  4QJF A;  4YY3 Q;  1SE8 A;  2RF4 A;  4DR6 Q;  4ME3 A;  4LF7 Q;  2ZJR A;  4PZ7 A;  1TWH H;  2WB1 E;  4GN5 A;  5C0X G;  2EXD A;  4DV0 Q;  4B3S Q;  4LF6 L;  1I3Q H;  2D0O A;  4GKJ Q;  2MFI A;  4BBR G;  3I55 A;  3D0F A;  2JJQ A;  1VQN A;  2KBN A;  4X65 Q;  2OQK A;  4A3L G;  2AKW B;  2BH2 A;  4XTC S;  5BR8 L;  2K4K A;  4A3M H;  1C7Y A;  1BBU A;  3RN5 A;  2NN6 G;  3NBH B;  1F6U A;  1RIP A;  1E24 A;  1WFQ A;  1HZA A;  3H15 A;  1LUZ A;  4DAM A;  5IT9 c;  1Q7Y C;  2Y0S G;  3PIP A;  3CCL A;  3GTL H;  2N49 A;  4DR4 L;  1HR0 Q;  4L5S A;  3K80 C;  2HHH L;  1A62 A;  1E22 A;  1A1T A;  3BZC A;  2MQH A;  3CCM A;  1PH4 A;  3GO5 A;  2KCM A;  3S2D H;  4DR4 Q;  1Q46 A;  2UXC L;  4A3C H;  1R9T H;  1QZG A;  3CAM A;  1N33 Q;  2BH8 A;  1PFS A;  1YHQ A;  2JA5 H;  1A63 A;  2EXF A;  3KJO A;  2KEN A;  5J3B A;  1YJ9 A;  1JJG A;  4DUZ L;  1VQ8 A;  1CKN A;  5GRO A;  2B29 A;  4DPG A;  3CC7 A;  4JI5 L;  2JA5 G;  5IYC H;  1L1O B;  4R1J A;  1VQ6 A;  1XNQ L;  1UE7 A;  1PH2 A;  2VL6 A;  2UU9 Q;  4A3D H;  2E8G A;  5JJI A;  1L1O C;  2C35 B;  2Y0S E;  3KDF A;  2OCE A;  2D0P A;  3EN2 A;  3K8A A;  1Z47 A;  4POF A;  1J5E L;  2UUB L;  3J7Z C;  1PYS B;  4IOA A;  2HQL A;  4DR1 L;  5IYC G;  3CME A;  3RN2 A;  2JEA I;  2R7Z G;  1G51 A;  4IJL A;  1J5E Q;  3J7A 5;  1Q1E A;  2LSS A;  2AMC B;  2OQ0 A;  2UUB Q;  4A3D G;  4NXM L;  2D62 A;  1L0W A;  1HNW L;  3PF5 A;  4LF5 Q;  3F2B A;  3S14 H;  1YVC A;  1X65 A;  3DLL A;  3GTG H;  1CKO A;  2R7F A;  2F4V L;  3CC4 A;  1OXX K;  3HOU H;  1Y1V H;  2Z0S A;  3AYH B;  5HY6 A;  4YHH Q;  1D8L A;  4A93 H;  1S3O A;  2IX0 A;  4DR7 Q;  4IFD J;  4WJ4 A;  1MIU A;  1K73 C;  1N9W A;  2F4V Q;  2OTJ A;  1Q1B A;  3HKZ E;  4HJ8 A;  1KL9 A;  1VQE A;  2B3G A;  2ZJQ A;  1VQI A;  1Y1V G;  4EQ5 A;  4A93 G;  1PVO A;  3L7Z C;  4HJ9 A;  1UE6 A;  3BJU A;  3RR5 A;  3CCS A;  3S17 H;  3GTP H;  3S2H H;  4GN4 B;  4IJH A;  2FXQ A;  4BY1 H;  1SR3 A;  3JC6 6;  3PO2 H;  2HIX A;  1JE5 A;  4EX5 A;  4QY7 A;  2ES2 A;  3CCQ A;  1HNZ Q;  3ICE A;  3W1G A;  1VQF A;  5IY0 A;  2GN5 A;  2UXB Q;  2Q2I A;  2AHO B;  4DNI A;  4X66 Q;  1Y1W H;  2JEB I;  4P73 A;  4JI7 L;  2JA8 G;  3PF4 A;  4RMF A;  2E2I H;  3KJP A;  3CCE A;  1IBM L;  4K0K L;  1TWA H;  1AE3 A;  4JI1 L;  3GTO H;  4JI0 Q;  2I5L X;  4DV2 L;  1FJG L;  4J15 A;  4C2M H;  5IP7 H;  4DV3 Q;  2E5L Q;  2Q2T A;  3L0O A;  2B63 H;  2WFW A;  1T9H A;  4X62 L;  3UDX A;  2VZA A;  4UP8 A;  3PCO B;  3UDF A;  4A75 A;  4IFD I;  3RZD H;  2UUA Q;  4X62 Q;  1UE1 A;  4DUY Q;  4R4I A;  1N32 L;  4DAY B;  1QVC A;  5IYB G;  1SFO H;  2NVQ H;  3S16 H;  4R4C A;  1E1O A;  4OXP A;  4X6A H;  4DR5 L;  1W2B A;  2PQA B;  4IPC A;  3AFP A;  1Q8K A;  1LTL A;  4FDB A;  1EIY B;  1WWD A;  4LUV A;  3H0G H;  3NEM A;  1PV4 A;  1PH9 A;  1CUK A;  1IL2 A;  1YEZ A;  1X55 A;  1Q86 C;  2R93 H;  1N8R C;  2LXJ A;  3U50 C;  5M3F H;  3M7N A;  2KHJ A;  2KCT A;  1OXT A;  1UWV A;  2CCZ A;  2AWO A;  2IHE A;  2WAQ G;  2ZM6 L;  1EQQ A;  4K0K Q;  1VQP A;  1IXR A;  1BKB A;  1SLJ A;  3OTO L;  1OTC A;  3BZK A;  1JT8 A;  5C0X J;  2R93 G;  2VQE Q;  4JOI C;  3TRZ A;  4O0A A;  1SRO A;  1YHB A;  2IHX A;  4OWX B;  3TQY A;  2VS1 A;  3RLF A;  3G4S A;  1PH6 A;  3CF5 A;  1H95 A;  1YBY A;  1XPO A;  4B3R L;  1VQJ A;  4LF8 L;  2Q2H A;  4O2D A;  3GTJ H;  1EFW A;  1HZ9 A;  2VNU D;  1JJ2 A;  1M90 C;  3A5U A;  1Y14 B;  3CQZ H;  2CWP A;  4YY3 L;  4DR6 L;  1SN8 A;  1U6P A;  2K75 A;  4LF7 L;  3ULL A;  2JA9 A;  1V9P A;  3SGI A;  4DV0 L;  1EQR A;  3STB C;  4DV5 Q;  2JA6 H;  3S24 A;  4GKJ L;  4A3I H;  3LGJ A;  2EC7 A;  1BJ6 A;  1JB7 A;  3T1Y Q;  1KHI A;  1P8L A;  4X65 L;  1VQ4 A;  4LFC Q;  4DV1 Q;  2WAQ E;  4Y52 H;  1LYL A;  1TWG H;  1EUJ A;  2CQF A;  3VDY A;  5FJ8 H;  2PI2 A;  3I4M H;  2JA6 G;  3RLN A;  3S1M H;  4A3I G;  1SRU A;  1KAW A;  3K7U C;  4X64 Q;  3W5O A;  3GTM H;  4LF4 Q;  5IP9 H;  3CXC A;  1XMQ Q;  2A19 A;  1FVI A;  3UE1 A;  1HR0 L;  2OWO A;  4A3K H;  2CWA A;  5FJ8 G;  5M3M H;  3T1H Q;  3HFZ B;  3ZJY C;  3PSI A;  4GNX B;  2K14 A;  1K0R A;  2XTI A;  4A3M G;  4UPA A;  2YU9 H;  5C0X I;  1N33 L;  1XNR Q;  4GOP A;  3W1B A;  1VQO A;  3E9I A;  1VQG A;  1EWI A;  3J81 i;  2A1A A;  4QL5 A;  2YTV A;  4JI1 Q;  1EYG A;  4A3F H;  2EQS A;  3I4O A;  4A3G H;  5IWA Q;  3NYB B;  1PH1 A;  1FL0 A;  1ESK A;  1Q82 C;  1Q3Z A;  3I4N H;  3KF6 A;  4A3J H;  1X56 A;  4DKA C;  1VCI A;  3ULJ A;  3Q8D A;  1L1O A;  3RLO A;  2NN6 I;  3D31 A;  3M4O H;  1X54 A;  2HIV A;  4A3C G;  4A3F G;  4R4Q A;  2UU9 L;  2YSA A;  4A76 A;  3CCV A;  3I4N G;  1EOV A;  4JI6 Q;  1MKH A;  3HKZ G;  5K36 G;  2N8N A;  3J80 i;  1O7I A;  2DUD A;  2OTL A;  1IBK L;  1KD1 C;  3M4P A;  2GVB A;  5FLM H;  2XGT A;  4IPG A;  4LF5 L;  1A0I A;  1IBK Q;  2VW9 A;  1KC8 C;  3A5Z B;  3H3V I;  1WCM H;  4YCW A;  1E3P A;  4DR7 L;  4YHH L;  1NE3 A;  1NMG A;  4JYA Q;  4P71 A;  5FLM G;  1V43 A;  1KRS A;  2HT1 A;  1MJE A;  5JJK A;  1QUQ A;  2K5H A;  3HKS A;  1KQS A;  3J81 j;  1Q81 C;  1WCM G;  1QVG A;  3OYY A;  4HIO A;  4GN3 B;  2PMZ E;  5GAE C;  4PZ8 A;  1CKN B;  1X3F A;  4LWC A;  2JQO A;  3HOU G;  1VQM A;  2BA0 A;  5C44 H;  1L2F A;  2QEX A;  1I94 Q;  1GO3 E;  1HNZ L;  5GAG C;  3KDF B;  5HGQ A;  2UXB L;  1VQH A;  2MO0 A;  1XMO Q;  4X66 L;  5E7N A;  1WWE A;  5C4X H;  4HID A;  3HOX H;  1Q3Y A;  5LMU Q;  4LUZ A;  4H02 A;  2PI2 E;  1KIX A;  1VQ7 A;  4JI0 L;  1WYD A;  4DV3 L;  4BY1 G;  3MXN B;  4HJ5 A;  3K7A H;  1PH8 A;  2E5L L;  4JBK A;  3PO2 G;  4OO1 I;  5C4X G;  1PA6 A;  2PNH A;  3HOX G;  3A0J A;  2L4L A;  1X3E A;  4JBM A;  4DV6 Q;  4POG A;  1N34 L;  1K9M C;  4JI3 Q;  1Y1W G;  1KRT A;  2UUA L;  1J6Q A;  3F1Z A;  4DUY L;  3TS0 A;  3EBE A;  3G48 A;  1N36 Q;  4LFA Q;  1N34 Q;  1C9O A;  2VY3 A;  3U4Z A;  4JI8 Q;  4GKK Q;  5IP7 G;  3E0E A;  1ASZ A;  3MEF A;  2PQA A;  2VQF Q;  2B63 G;  1OXV A;  1PYB A;  2IY5 B;  2F52 A;  1YZ6 A;  1VQ9 A;  4IOC A;  1G29 1;  3GD7 A;  1MJC A;  2GVA A;  4UP9 A;  5IE8 A;  3HOZ H;  3KF8 B;  2R6G A;  3I7F A;  4HIK A;  2ALY B;  3DM3 A;  3JAM c;  3PUV A;  2JA7 H;  1YIT A;  5LMN W;  4DR3 Q;  1A6B B;  5M5W H;  4A3E H;  4JOI A;  1WWF A;  1U5K A;  4PG3 A;  4B3T Q;  3FHW A;  1B70 B;  5ELO A;  4NXN Q;  1CSQ A;  3S1N H;  1K8A C;  2R92 H;  4R4T A;  2Z6K C;  4C3I H;  2VQE L;  2A8V A;  2JA7 G;  3H0G G;  4AYB E;  4JI2 L;  3I56 A;  1G6P A;  1I50 H;  1WOC A;  3EIV A;  4L5R C;  3NEL A;  4AQY Q;  3CPW A;  5M3F G;  4UP7 A;  5IYD H;  1PHJ A;  4JV5 L;  2UUC Q;  4JI2 Q;  1K3R A;  1UE5 A;  4B3M Q;  2R92 G;  1QZH A;  4P74 A;  2N78 A;  3E9H A;  4KLK A;  3FKI H;  4LFB Q;  3B6Y A;  2L15 A;  4JV5 Q;  4DV5 L;  5IYD G;  5C4J H;  1VQK A;  1IZ6 A;  3T1Y L;  4P75 A;  1AE2 A;  4TQU S;  4LF9 Q;  2UXD Q;  2NVX H;  4LFC L;  5AJ3 L;  4DV1 L;  5LMN Q;  2ATW A;  1HH2 P;  3FKI G;  3RNU A;  3NEN A;  3F2D A;  1D7Q A;  4PZ6 A;  4JI4 Q;  3AQQ A;  5AJ3 Q;  2NZH A;  1S40 A;  3S1Q H;  4X64 L;  1KXL A;  2YTX A;  3S15 H;  4LF4 L;  2I0Q A;  3AFQ A;  1RL2 A;  2JE6 I;  3UE0 A;  1K83 H;  4ALP A;  1XMQ L;  1TWC H;  5M5X H;  3PIO A;  4OX9 Q;  1IBL Q;  1GD7 A;  4NPS A;  2WP8 J;  3T1H L;  1E1T A; 
#chains in the Genus database with same CATH topology
 4L5Q A;  1KLU D;  5ELC A;  1XNR L;  1JOR A;  4DV7 Q;  4A3F B;  2MUY A;  3SVM A;  1R4Q B;  3TRE A;  3I4N B;  4DK3 C;  1XTD A;  4YWK A;  5KYI A;  3JAM i;  4K5W A;  1ZXT A;  2VUM H;  5JJL A;  4A3K G;  5M3M G;  1BBW A;  3T51 B;  2RA4 A;  1O80 A;  1QIL A;  2DNE A;  1X32 A;  2I46 A;  4C3J H;  3IKJ A;  4A3J G;  3RZO H;  2K52 A;  1XWE A;  4A3B H;  2F0S A;  2RKS A;  1TY0 A;  3HOV H;  5EGT A;  2F0U A;  2LI8 A;  3CKI B;  5IGD A;  4BA2 I;  1HNX Q;  2ZTE A;  3HOU B;  2DJF C;  2BDN A;  5CV4 A;  2CFM A;  4JYA L;  3KLW A;  1D5X C;  4KK7 A;  4QGU A;  4GOP B;  2M3Z A;  4QIW E;  1FD7 D;  3R2I A;  2UXC Q;  1Y69 U;  5M9O A;  3Q22 A;  1XPU A;  3KF6 B;  2IX3 A;  1PRT D;  5GQO A;  3NXW A;  1RHP A;  4GLA C;  1YIJ A;  1ENA A;  3PO2 B;  1SEB D;  5C4X B;  1C4Q A;  4CDF C;  1WTQ A;  4OWW B;  3K0X A;  3RMH A;  4IUT A;  1XMO L;  4UAI A;  5CGK A;  3VR4 A;  1PH7 A;  2PQE A;  3ERS X;  2B63 B;  1E7Z A;  2MO1 A;  3MA2 B;  1JMC A;  4NXM Q;  4OO1 H;  4IPD A;  1STE A;  2EZV A;  1DOM A;  3KLS A;  4DV6 L;  3HOW G;  4QQB X;  3CP0 A;  1B9N A;  1BOS A;  3PUX A;  3F2U A;  3PUW A;  1QUQ B;  2A73 B;  3TP5 A;  4CJ0 B;  1HCZ A;  1SJH D;  4DU9 A;  2E2J H;  1S5E D;  1MD2 D;  4IFD H;  3HOZ B;  1LT4 D;  1B2T A;  1Q12 A;  1B44 D;  2P5Z X;  2K5D A;  4YCV A;  4C1N I;  4A4I A;  1PRT F;  1JIC A;  1FGU A;  1VS0 A;  3WWV A;  1UEB A;  4C3I B;  1OXU A;  1IKL A;  3BU2 A;  4YWL A;  5ISR A;  1IYJ B;  1CT1 D;  5IYB H;  4DV2 Q;  4GS3 A;  3OIP A;  2Z6B A;  2UUC L;  4B3M L;  1VQD A;  4A3E G;  2QGQ A;  5BN4 A;  4LFB L;  4GLX A;  4CKB A;  3CMA A;  3G6E A;  1FYC A;  1PFN A;  4KD3 A;  4OWT B;  2RHS B;  1WTW A;  3PO3 H;  5EPJ A;  4Y7N H;  1SNQ A;  4DR5 Q;  4RG1 A;  1K83 B;  1SJE D;  2EYF A;  1TWC B;  3GTQ H;  4IZ8 A;  3D3R A;  2WB1 G;  1E2W A;  4OX9 L;  3J81 L;  3QJY A;  2JK8 A;  4KJN A;  1TU2 B;  2L5T A;  1MGS A;  3SK4 A;  2NB0 A;  4HIM A;  1QE6 A;  3N52 A;  3J80 c;  2YU9 B;  2E2H H;  1BCP D;  4X3U A;  2EYO A;  2XIW A;  3S1R H;  5FO7 B;  1PDQ A;  4A3G B;  2O5J C;  2YV5 A;  5C0X H;  3C46 A;  4DR2 L;  4XYQ A;  4KHP L;  2I5H A;  1AW7 A;  5CR3 A;  4DR6 Q;  2WB1 E;  2EXD A;  2BE5 D;  4NMZ A;  2MFI A;  1SSO A;  3K5N A;  2JJQ A;  1DOK A;  2OQK A;  2HD3 A;  2AKW B;  4XTC S;  5BR8 L;  4JW0 A;  3NBH B;  2F0V A;  4R8I A;  3H15 A;  1LUZ A;  1M8A A;  2Y0S G;  3CCL A;  1TT2 A;  2N49 A;  4FNF A;  1ICF B;  4C3J G;  3BZC A;  2MQH A;  3CCM A;  2A69 D;  1PH4 A;  2KCM A;  4DR4 Q;  4BBS B;  1Q46 A;  2AQ1 B;  4KY7 A;  4A3C H;  1R9T H;  3CAM A;  3I90 A;  1B50 A;  2F3V A;  1BCP F;  2M9V A;  1YJ9 A;  3C3L A;  5GRO A;  4HCS A;  1PTO D;  3GQB A;  3K5L A;  2F0P A;  5IYC H;  1XNQ L;  3NTK A;  3Q24 A;  1UE7 A;  2UU9 Q;  2A6E D;  2C35 B;  2Y0S E;  3K8A A;  1K8M A;  3EN2 A;  2ICI A;  4CKC A;  1S5D D;  1JC7 A;  1GOZ A;  2RDG A;  3CME A;  2QDL A;  2AMC B;  3ERO A;  3SR1 A;  1KNE A;  4LF5 Q;  3S14 H;  1TWF B;  2SEB D;  3GTG H;  3CC4 A;  4LJZ C;  3HOU H;  5HY6 A;  4ZLT F;  1EU4 A;  4DR7 Q;  4IFD J;  1S3O A;  1JWU D;  2AUJ D;  1Q1B A;  3BVG A;  4RCN A;  4HJ8 A;  2JA8 B;  1KL9 A;  2L1B A;  5JVH 3;  1B4O A;  1STH A;  1VQI A;  1STB A;  2ZJQ A;  1DD2 A;  3GV6 A;  4A93 G;  5FO9 B;  1PVO A;  3BJU A;  5CV9 A;  2FXQ A;  2IL8 A;  2OT2 A;  1S5B D;  1SR3 A;  2PZT A;  3PO2 H;  2B2V C;  1JE5 A;  5I6Y A;  2ES2 A;  3QOJ A;  2NVY B;  5DAU A;  1PTO F;  5IY0 A;  5A2Q E;  1O7Y A;  4EQO A;  4L6T B;  2Q8R E;  1QG7 A;  1IBM L;  3K6O A;  1TWA H;  4QB4 A;  1MSG A;  5IP7 H;  2B63 H;  3UDX A;  5T1I A;  3J80 E;  3UDF A;  3RZD H;  1CZW A;  4DUY Q;  1T5E A;  1N32 L;  4RGO S;  3HOY B;  5IYB G;  3K5O A;  1SFO H;  2MP1 A;  1PMR A;  1E1O A;  4OXP A;  1LV9 A;  1W2B A;  1UUP A;  1EU3 A;  3TP6 A;  4EQN A;  1EIY B;  4OIK A;  5JAV A;  3H0G H;  1CTM A;  3D8G A;  3U50 C;  4KKU A;  2CCZ A;  2WAQ G;  1EQQ A;  4K0K Q;  1VQP A;  1IXR A;  4IUQ A;  5C0X J;  1I4X A;  2EYP A;  2IHX A;  1SRO A;  3TQY A;  5FKA C;  2VS1 A;  1PH6 A;  3HG9 A;  4B3R L;  1VQJ A;  3A7L A;  4LF8 L;  1WTO A;  3DWP A;  1BUV T;  1EFW A;  1GHK A;  1HZ9 A;  1NUC A;  1TWH B;  3FDT A;  4LF7 L;  3ULL A;  1B3A A;  4DV0 L;  1EQR A;  2MPM A;  4DV5 Q;  2EC7 A;  1HUN A;  3T1Y Q;  1KHI A;  1P8L A;  2CW0 D;  4X65 L;  1WVL A;  4DV1 Q;  2WAQ E;  4P2C B;  4EGV A;  3Q0A A;  5FJ8 H;  1TII D;  2JA6 G;  3GTL B;  1SRU A;  2B2Y A;  1KAW A;  1FR3 A;  3GTM H;  3W5O A;  3NHH A;  1DON A;  3J7Y W;  3CXC A;  2A19 A;  1FVI A;  4MTK A;  3UE1 A;  1HR0 L;  1EL0 A;  3E6Z X;  4GNX B;  3PSI A;  1CK1 A;  2YU9 H;  2XTI A;  1A3V A;  1LTI D;  4GOP A;  2A1A A;  4QL5 A;  4A3G H;  3I4O A;  1WTR A;  5I9O A;  3NYB B;  1FL0 A;  4EQP A;  3KF6 A;  3HZX A;  4KKT A;  1H9K A;  3AMU A;  1L1O A;  3RLO A;  4A3D B;  2K05 A;  2H4O A;  4CDE C;  3H94 A;  3HS0 C;  4A3F G;  1ZYR C;  4A3C G;  4A76 A;  3CCV A;  3I4N G;  1SYF A;  2RDF A;  4FXG C;  1C8C A;  2DUD A;  1PFB A;  1KDB A;  2GVB A;  2F03 A;  1EOT A;  5JPN C;  3K5M A;  3DHQ A;  4PNY A;  4IPG A;  4WOR A;  3VR3 A;  1EEF D;  3I8Z A;  4H0L C;  4C3H B;  3D4W A;  5I9P A;  5D3D A;  3M7G A;  1LTT D;  4KY6 A;  1V43 A;  2HT1 A;  1QUQ A;  3ND8 A;  4OEM B;  3J81 j;  4K6L A;  1Q81 C;  1H9J A;  3S2H B;  2EY1 A;  2ZXP A;  4J1M A;  4BY1 B;  1J8I A;  5GAE C;  3Q6S A;  1X3F A;  3HOU G;  3KBG A;  3SK6 A;  1GO3 E;  5JEA H;  3KDF B;  2RSN A;  3J7A V;  2UXB L;  1VQH A;  3P75 A;  5E7N A;  3NWS A;  4HID A;  3HOX H;  1Q3Y A;  1KLG D;  3C1E A;  4CGY B;  1F9Q A;  1I4H A;  1SBB B;  4JI0 L;  1VQ7 A;  3A8I E;  3MXN B;  3K7A H;  5IGF A;  3MXG A;  3PO2 G;  4OO1 I;  5C4X G;  1PA6 A;  4ZCK A;  1CI3 M;  2NVQ B;  5JOB A;  1EIG A;  1LAB A;  3F1Z A;  3TS0 A;  2IW3 A;  5CBE E;  4GKK Q;  2VY3 A;  4JI8 Q;  2FIN B;  5IP7 G;  2VQF Q;  2B63 G;  1OXV A;  2LFN A;  1RTN A;  4IOC A;  2GVA A;  2R93 B;  5IE8 A;  1BQQ T;  3I7F A;  3DM3 A;  2JA7 H;  3W3A A;  4DR3 Q;  1RCV D;  4NP5 A;  2Z4I A;  1U5K A;  4NXN Q;  5ELO A;  3M4Y A;  2R92 H;  4R4T A;  2VQE L;  3H0G G;  4AYB E;  1O7Z A;  5IYD H;  4UP7 A;  4JI2 Q;  1QZH A;  4A3I B;  5E4W C;  3B6Y A;  2L15 A;  4JV5 Q;  4X3S A;  1GUG A;  2ZXO A;  1IZ6 A;  4LF9 Q;  5E4X A;  2UXD Q;  1AP0 A;  1CM9 A;  3AB9 A;  3A8K E;  2QKI C;  5LMN Q;  3RNU A;  3NEN A;  2AQ3 B;  3F2D A;  1D7Q A;  2NZH A;  1KXL A;  4FXD A;  3K0Y A;  3A54 A;  1XMQ L;  3PIO A;  4Q5V A;  3T13 A;  1ROD A;  5KNB A;  4K14 A;  3CPF A;  4F8M A;  3VYS A;  2I07 B;  4MTN A;  4N9T A;  3KFU A;  3DMU A;  1A2U A;  2LXK A;  2R3Z A;  5DLQ E;  1C0A A;  2EIF A;  4DK6 C;  5COR A;  2F0L A;  4ZRZ A;  1SND A;  3DM1 A;  3VA7 A;  4LF6 Q;  3R3O A;  1EWC A;  2Q2U A;  1QVF A;  4A3G G;  4KN4 C;  4DA2 A;  3CD6 A;  1DCZ A;  1HNX L;  3T16 A;  1A8V A;  4BXX G;  1BO0 A;  1D5M C;  2DN8 A;  4X3T A;  4DAV A;  4KHZ A;  2NUC A;  1SYC A;  3TEH B;  4MNO A;  2QA4 A;  2HHH Q;  3VA5 A;  1YHA A;  3L3O C;  4GZY C;  2IT1 A;  1HHV A;  4PMW A;  4JG2 A;  4GOP C;  3ULP A;  1XJV A;  5C44 B;  1B7Y B;  1YJW A;  1PRT B;  5JEA J;  4ZQ3 A;  2AWN A;  3P1H A;  1PH3 A;  5CV7 A;  1D2B A;  4MIU A;  1I94 L;  4BBS G;  3BVZ A;  4JI5 Q;  2RHQ B;  1AAF A;  3NTH A;  3HEJ A;  1Y1W B;  1I6H H;  5E1F A;  5EAY A;  2HDM A;  3HOW H;  1MSH A;  4XQJ A;  3PUZ A;  4DR1 Q;  1SE4 A;  1SDF A;  5EPL A;  1MI2 A;  2B2U C;  2AQ2 B;  5JEA G;  2Q8T A;  1VQL A;  3PUY A;  4C3H H;  3U58 A;  1S5F D;  4JCV E;  1OO9 B;  3RUZ A;  4L5T A;  1N36 L;  1X3G A;  2E76 C;  4LFA L;  4JBW A;  3I73 A;  4KI0 A;  3FEW X;  4DN4 M;  4IQZ A;  2O5I C;  2RBM A;  4KKS A;  3M3Y H;  4HJA A;  1CHP D;  3CW2 C;  1U4M A;  3S1N B;  2Z1C A;  4CHT B;  3I91 A;  4IUR A;  3L2P A;  3GP7 A;  2DY8 A;  1KDA A;  1ZKO A;  1E0B A;  1VQA A;  4LUO A;  3FMC A;  2AUK A;  4YWM A;  3HRZ C;  3URY A;  1ILP A;  4JI1 Q;  4AQY L;  2ZXR A;  1PFM A;  1CKM A;  1DGS A;  1FJG Q;  3FKI B;  2B8G A;  2EDG A;  3AEV A;  2CQO A;  3CQZ B;  1SMY C;  5C4J B;  2MGS A;  2KHI A;  2RSO A;  2CQA A;  3SE0 A;  1G91 A;  4DNT B;  3IAY A;  4NDX A;  3M4Q A;  2B2T A;  3PV0 A;  3S1Q B;  1V1O A;  3J81 c;  3S15 B;  4NB3 A;  3GTK H;  2K5N A;  2MJ8 A;  3DUZ A;  1WI5 A;  3HOY G;  1K0S A;  4IUU A;  3X3N A;  4GLV B;  1RKN A;  5NUC A;  3OOC A;  2ZJP A;  1CSP A;  3OTO Q;  4GNX A;  4ZKC B;  1JJC B;  1PYW D;  5ELB A;  3U4V A;  1ZEQ X;  2K50 A;  1ASY A;  2ID0 A;  2IHF A;  4YY3 Q;  1IYU A;  2RQX A;  5C3E B;  5FLX L;  2NVT B;  4O1N A;  4PZ7 A;  3N6R A;  4B3S Q;  1L0Y B;  1DOL A;  2D0O A;  3I4L A;  4BY7 B;  3I55 A;  4RWS C;  3FVQ A;  2EE1 A;  5G3L D;  1C7Y A;  1BBU A;  5FO8 B;  4DAM A;  4DR4 L;  2FFK B;  4XQQ A;  4KY5 A;  3TSS A;  2NTS A;  2L55 A;  4OEL B;  4IAL A;  5IT9 L;  1QZG A;  1N33 Q;  1I4P A;  2R7Z B;  5M5Y B;  2EXF A;  5KGU A;  3SEB A;  2ZT9 C;  3KJO A;  2KEN A;  1ZYR D;  3C1F A;  4DUZ L;  1VQ8 A;  1PTO B;  4DPG A;  1SE3 A;  3CC7 A;  1L1O B;  2J0T D;  4V19 0;  5KND A;  4FF3 A;  1LTS D;  2HUG A;  1PH2 A;  3KDF A;  2GA4 B;  2OCE A;  1FNU A;  3MZ5 A;  2KOL A;  3J7Z C;  1HA5 A;  2KQ3 A;  1NAP A;  3RN2 A;  2JEA I;  1G51 A;  4ULL A;  2OQ0 A;  1WTX A;  2G9H D;  4A3D G;  1HNW L;  4AYB B;  3PF5 A;  1YNJ C;  3MXN A;  5G3L F;  1YVC A;  2D9U A;  2F0E A;  2R7F A;  2Z0S A;  3AYH B;  1D8L A;  4A93 H;  2IX0 A;  2EYH A;  1PZJ D;  1SE2 A;  4EVO A;  2F4V Q;  2J4X A;  2B3G A;  2WII B;  1Z6H A;  3SK8 A;  1TY2 A;  4C3H G;  3TZD A;  4DNR B;  1UE6 A;  3CCS A;  1UNS A;  3GTP H;  4GN4 B;  3ND9 A;  4IJH A;  1Y8O B;  4LMQ D;  3JC6 6;  1G2T A;  1HNZ Q;  1H9M A;  1STN A;  1VQF A;  3J81 E;  1E2V A;  1Y1W H;  2D5D A;  4JI7 L;  4KN7 C;  3KJP A;  1I50 B;  1SNM A;  3GTO H;  4C2M H;  4DV3 Q;  2E5L Q;  2EJF C;  2KED A;  1STY A;  2WFW A;  2PZU A;  1H9S A;  1WD0 A;  4X62 Q;  4R4I A;  1QVC A;  3KLR A;  1UEA B;  3I72 A;  4X6A H;  2K03 A;  3I3C A;  3AFP A;  1LTL A;  4FDB A;  4DF7 A;  4UDU C;  1PH9 A;  1D1K A;  2F1M A;  1IL2 A;  1X55 A;  3A8J E;  1TS4 A;  3JAM L;  1UWV A;  1FGB D;  3CRK C;  2ZM6 L;  4U68 A;  1BKB A;  1OTC A;  1JT8 A;  1GUO A;  2R93 G;  1V8Q A;  1AZP A;  4BBR B;  4ILW A;  1TS3 A;  3CQZ H;  2CWP A;  3L9A X;  1I3Q B;  2K75 A;  3PQI A;  5KIX A;  1V9P A;  1U4L A;  2JA6 H;  3S24 A;  4GKJ L;  4XT1 B;  4A3M B;  1VQ4 A;  4B9W A;  4LFC Q;  3OSO A;  1TWG H;  1EUJ A;  1IL8 A;  2CQF A;  3I4M H;  4A3I G;  3K7U C;  4LF4 Q;  1ILQ A;  2OF1 A;  2Z8L A;  3S2D B;  2A6H C;  2PNR C;  3T1H Q;  5I6W A;  3HFZ B;  1QNK A;  3ZJY C;  2JA5 B;  1XNR Q;  2WIN B;  4UPA A;  3W1B A;  4CDC C;  1VQG A;  1ESK A;  4A3F H;  3TN2 A;  2K04 A;  4RCO A;  1Q82 C;  3I4N H;  1X56 A;  4DKA C;  3ULJ A;  5J1Z A;  1X54 A;  1TVX A;  3QIA A;  5IOD A;  4C1N K;  3AU7 A;  1EZ6 A;  3J80 i;  2FMM A;  4I65 A;  1EY8 A;  1GXD C;  4ABN A;  2R61 A;  1A0I A;  1Y1V B;  1IBK Q;  2F0D A;  1RF2 D;  1KC8 C;  3A5Z B;  2QW7 A;  1DM0 B;  3OMC A;  3UI2 A;  3H09 A;  1E3P A;  2K32 A;  3NQI A;  4YHH L;  4JYA Q;  1XTC D;  3TZU A;  1W6J A;  1KRS A;  1AZQ A;  2XNA C;  5HUR A;  4K5X A;  1EY0 A;  1IW7 C;  3OYY A;  1EY5 A;  4GN3 B;  1STA A;  5A35 A;  1I6V C;  1PXU A;  4YIJ A;  1DXM A;  1L2F A;  5GAG C;  5HGQ A;  4PMB A;  2E2I B;  2MO0 A;  1XMO Q;  4X66 L;  5F2D A;  5C4X H;  4LUZ A;  4H02 A;  2Z9H A;  1TS5 A;  3V05 A;  1ESF A;  4HJ5 A;  1D5Z C;  4JBM A;  4K5V A;  4DV6 Q;  5EJW A;  4HTH A;  1Y1W G;  2EJM A;  3S16 B;  1BXT A;  3J7A F;  2UUA L;  4DAY A;  4HSP A;  3EBE A;  2F0J A;  4KV6 A;  1R4P B;  1N34 Q;  3U4Z A;  1BF4 A;  3R93 A;  5CV8 A;  1PYB A;  5DM6 3;  2F52 A;  1VQ9 A;  3GD7 A;  4NKL A;  2DNC A;  4UP9 A;  5M3F B;  3HOZ H;  2R6G A;  4HIK A;  2ALY B;  3SK5 A;  1YIT A;  5LMN W;  1DZ1 A;  4JOI A;  4CKE A;  2KHS A;  1B70 B;  3IFT A;  2V4D A;  1K8A C;  4C3I H;  2A8V A;  3GTJ B;  1SMY D;  4JI2 L;  1G6P A;  1I50 H;  3MAQ A;  1PHJ A;  4JV5 L;  2UUC Q;  1K3R A;  4B3M Q;  4P74 A;  3E9H A;  2F0K A;  4KLK A;  4LFB Q;  2C5C A;  4QUF A;  3V96 A;  4P75 A;  3S1M B;  1NR2 A;  2JXM B;  2Q8I B;  1HA6 A;  3FKI G;  5C3W A;  4PZ6 A;  4Q0F A;  3AQQ A;  4X64 L;  4A3K B;  2YTX A;  3AFQ A;  3VR5 A;  5M3M B;  4ALP A;  1K83 H;  1X3P A;  4X3K A;  4FF2 A;  3KUP A;  4TRD A;  1TWC H;  4OX9 Q;  4NPS A;  1RJT A;  3BS1 A;  4YCU A;  4IO9 A;  3I4M G;  3V2T A;  1NCV A;  5HGT A;  3MFG A;  2PMZ B;  4BBR H;  3TDQ A;  5IWA L;  4M8A A;  1JOQ A;  4A3L H;  5C6A A;  3A56 A;  4DR2 Q;  4U67 3;  4KHP Q;  1YNX A;  4UY8 C;  1ONL A;  1NY4 A;  1F2Z A;  4JI6 L;  2CKZ B;  2K5V A;  3KYH C;  4DV4 Q;  5TSS A;  4BXX H;  3F8T A;  1WWG A;  3OW2 A;  1WCM B;  4N9P A;  5BR8 Q;  5C3E G;  3QR8 A;  1VQ5 A;  1GUS A;  3DWA A;  2ASB A;  3H3V H;  3OWE B;  4R4O A;  4BY7 G;  1HZB A;  1K8G A;  2BA1 A;  2M2L A;  2CVR A;  4KMU C;  3U9O A;  1NBW A;  4BBS H;  2XVS A;  3NE5 B;  3PMF A;  3F2C A;  3CCJ A;  5E3F A;  2L4N A;  1EIF A;  1QOH A;  1O7L A;  1YJN A;  3T56 B;  1KNA A;  1Y8P B;  1K28 A;  2R7D A;  2KEC A;  2KCC A;  3ONA B;  4K8I A;  1XNQ Q;  2O2L D;  5JJZ A;  1X9N A;  1TR5 A;  2BOS A;  1XPR A;  4TVA B;  1GUT A;  1YNJ D;  5LMU L;  1G8Z D;  4ZUJ A;  1MHW C;  4I7Z C;  2CH4 W;  3LWE A;  1VQB A;  2HCC A;  2H5X A;  4WJ3 M;  1U0L A;  5CBA E;  1AEX A;  2B2W A;  4JI3 L;  2HQE A;  1TWF H;  1LT6 D;  2IX1 A;  3BZD B;  3ER0 A;  4AYB G;  1VQC A;  2KUM A;  2JA8 H;  4IUP A;  1EWH A;  5ELN A;  3UDI A;  2A74 C;  4IPH A;  5M5W B;  4A3E B;  1XX8 A;  3SHL A;  2KCN A;  2RCN A;  1AN8 A;  1J9O A;  1KAA A;  2MNA A;  2Z6K A;  2QF7 A;  4ODG A;  3P7J A;  4B3T L;  1GKH A;  2SNM A;  3KOJ A;  1Z9F A;  2NVY H;  3NQT A;  2DJG C;  3HOZ G;  1PLF A;  1IBM Q;  1B8A A;  1NTG A;  4H7B A;  2M00 A;  1HQM C;  1HJP A;  2EOT A;  3CCU A;  1EFI D;  1GM5 A;  1H9S B;  2NVX B;  4C3I G;  1N32 Q;  3QG1 A;  1GUN A;  2NBF A;  4XYO A;  1V1Q A;  1F77 A;  3HOY H;  1G2S A;  4XQN A;  3S9W A;  4JI4 L;  5M5X B;  2D2C C;  5ELE A;  3G7L A;  4CJ1 B;  1F2L A;  4J8Q A;  1IBL L;  1U9R A;  4JBJ A;  2F3I A;  1FNV A;  1JOK A;  2VB3 X;  1JE4 A;  3EA6 A;  4DV7 L;  1I4R A;  3M85 A;  2VUM B;  1B9M A;  1F2Y A;  1SMX A;  5J39 A;  5FLX c;  4B3R Q;  4LF8 Q;  4MHE A;  5EPK A;  4B3S L;  4QJF A;  1SE8 A;  4ME3 A;  4LF7 Q;  4G7H C;  1TWH H;  4GN5 A;  4C3J B;  4DV0 Q;  3RZO B;  4A3B B;  4BBR G;  2KBN A;  4X65 Q;  3HOV B;  4A3L G;  2BH2 A;  1LO5 D;  2K4K A;  1ET9 A;  2A6H D;  3RN5 A;  2NN6 G;  1RIP A;  1WFQ A;  1HZA A;  4RGM A;  5IT9 c;  3GTL H;  2B2Y C;  1HR0 Q;  4L5S A;  3SDZ A;  1JCK B;  2K5W A;  3HP3 A;  2UXC L;  1LT3 D;  2A69 C;  2BH8 A;  1PFS A;  2K01 A;  4RGT A;  4Z9C B;  5J3B A;  4WFN 3;  1JJG A;  3DWQ A;  1HPC A;  2JA5 G;  1VQ6 A;  2PPB C;  4M1U B;  4A3D H;  2E8G A;  5JJI A;  1L1O C;  1S5C D;  1VMP A;  1KAB A;  1BBX C;  2D0P A;  5D65 A;  1PYS B;  1Q8I A;  4IOA A;  4XT3 B;  2HQL A;  1J5E Q;  2QCP X;  1Q1E A;  2UUB Q;  2K33 A;  4NXM L;  2D62 A;  1YNN C;  1L0W A;  3KK7 A;  3F2B A;  1X65 A;  2VB2 X;  2F0G A;  2F4V L;  1OXX K;  5IOC A;  1IW7 D;  2E2J B;  1SNO A;  1QJO A;  1MIU A;  1N9W A;  2LMC B;  3HKZ E;  3D4D A;  1HUM A;  1PZK D;  4E6I A;  1Y1V G;  5AFW A;  1X3Q A;  1EYD A;  1EQV A;  2LY7 A;  3RR5 A;  3S2H H;  1MBY A;  4RA8 A;  1RDP D;  3QO2 A;  2EXZ A;  4BY1 H;  1WTH A;  4EX5 A;  1JQY D;  3W1G A;  4HAE A;  2GN5 A;  2UXB Q;  2Q2I A;  4P73 A;  2JA8 G;  3PF4 A;  3LWU A;  4RMF A;  1AE3 A;  4F87 A;  4JI0 Q;  4DV2 L;  2K28 A;  4J15 A;  3PIO 3;  1EYC A;  3L0O A;  3RD4 A;  4N8F A;  5EQ0 A;  1QB5 D;  1T9H A;  4ZUI A;  4X62 L;  2VZA A;  2H1E A;  4UP8 A;  3PO3 B;  1ENF A;  4H44 C;  1I4G A;  4A75 A;  1UE1 A;  4Y7N B;  2OEO A;  5FLX E;  4DAY B;  2NVQ H;  5LL6 X;  3GTQ B;  4DR5 L;  1RD9 D;  1CA5 A;  4IPC A;  1SYD A;  2X69 A;  4PV1 C;  3NEM A;  1PV4 A;  1S4Z A;  3ITP A;  1H9R A;  5J22 A;  1Q86 C;  2R93 H;  4BS9 A;  3M7N A;  2E2H B;  2KCT A;  1OXT A;  5BN3 A;  3R2T A;  2AWO A;  3S1R B;  4KHV A;  3OPO A;  3K59 A;  2VQE Q;  1YHB A;  3G4S A;  2C9O A;  1BCP B;  2MHV A;  3MHB A;  5IT9 E;  1H95 A;  2Q2H A;  3ERQ A;  1JJ2 A;  1M90 C;  1VF5 C;  4JVZ A;  3A5U A;  1Y14 B;  4DR6 L;  1SN8 A;  1TQO A;  2JA9 A;  3FPU B;  2Z4H A;  3STB C;  4A3I H;  3LGJ A;  4K2L A;  1JB3 A;  2K5Q A;  1JB7 A;  1BJ6 A;  2CW0 C;  1WD1 A;  1LYL A;  5IIF A;  2PI2 A;  3RLN A;  3SXH A;  1ET6 A;  5IP9 H;  2N88 A;  3KLS X;  1XMQ Q;  3VYU A;  2IWH A;  3H3V C;  1R9T B;  2PCF B;  4O42 A;  4BWG B;  3QWN A;  1HXY D;  2K14 A;  4RHR A;  1VQO A;  1EWI A;  3J81 i;  2EY6 A;  2YTV A;  2EQS A;  5D14 A;  1HTL D;  1PH1 A;  1VCI A;  1HRJ A;  2F0O A;  2NN6 I;  3D31 A;  4FVM A;  4HMI A;  2YSA A;  2UU9 L;  2XWJ B;  4WJW A;  2PZW A;  3DEO A;  3U9S A;  1EOV A;  3G6J B;  5I2X A;  1MKH A;  3DXJ C;  3EVQ A;  1IBK L;  3S14 B;  3M4P A;  3GTG B;  1XXG A;  2XGT A;  2PO4 A;  4LF5 L;  1FNW A;  2F0N A;  3H3V I;  3D6C A;  4DR7 L;  1NMG A;  5FLM G;  1MJE A;  2K5H A;  1KQS A;  2FHT A;  1WCM G;  3K57 A;  4G7O C;  4HIO A;  2PMZ E;  4IN3 A;  1Q90 A;  1CZG A;  2B2V A;  1NNX A;  1CKN B;  4LWC A;  2BA0 A;  1EY6 A;  5C44 H;  3MTS A;  4JK1 C;  2QEX A;  1I94 Q;  1A2T A;  4G7Z C;  1EIH A;  4UHV A;  1WWE A;  1TWA B;  4HCE A;  3JAM E;  3MEH A;  2F3W A;  4DXF A;  4OIJ A;  4ZYS A;  2BCO A;  2PI2 E;  4FF1 A;  1WYD A;  2KVM A;  4BY1 G;  1PH8 A;  2PNH A;  3RZD B;  2L4L A;  1X3E A;  2NZ1 D;  4POG A;  1N34 L;  5IGB A;  1K9M C;  1SFO B;  2K7V A;  2EY5 A;  1KRT A;  2QEJ C;  1J6Q A;  4DUY L;  2K6A A;  1N36 Q;  4LFA Q;  4HED A;  1BDO A;  3WOF A;  2B8F A;  2PQA A;  3H0G B;  2IY5 B;  3VR2 A;  2QIL A;  4IUN A;  4N8X 1;  2XSC A;  3MXU A;  4FYD A;  5CV5 A;  2LKV A;  2O4X A;  2CHB D;  5EKK A;  5D3I B;  4B9X A;  4K0K L;  1WWF A;  3FHW A;  1CSQ A;  3S1N H;  4DAP A;  4C56 C;  4WRD A;  3EQL C;  5T1G A;  3NEL A;  4AQY Q;  3CPW A;  1D6E C;  2XWB B;  1UE5 A;  3TP8 A;  5EKI A;  2N78 A;  3A7A B;  4HMJ A;  4RGN A;  5KYL A;  1GUW A;  3FKI H;  4DV5 L;  2PW7 A;  5C4J H;  3X3M A;  3T1Y L;  4DV1 L;  2ATW A;  1HH2 P;  3GTM B;  2ICE C;  1SYB A;  4OGQ C;  3MC0 B;  2B2T C;  3S1Q H;  5AJ3 Q;  2FMC A;  3S15 H;  3FPP A;  1SNP A;  2L0C A;  4S3S A;  1STG A;  2WP8 J;  1E1T A;  1X6O A;  4ZAI A;  3VYR A;  4MZ9 A;  5IGC A;  3P20 A;  4G57 A;  1LTB D;  1NJI C;  1D1I A;  3HKZ B;  1LM0 A;  4TSS A;  5IP9 G;  4GNX C;  4HJ7 A;  1T5X D;  4AH6 A;  1TXY A;  1PH5 A;  3BDO A;  1A3U A;  3VR6 A;  1GVP A;  4DV4 L;  1B1Z A;  4BA1 I;  5C4H A;  1EZ8 A;  3E3X A;  2VUM G;  5DEH A;  3NK9 A;  2JZW A;  5C3E H;  5KNC A;  3CC2 A;  1JWM D;  3OIQ A;  2NVT H;  5COY A;  3QB3 A;  4BY7 H;  2TMP A;  4APV A;  3TP7 A;  5LL6 S;  1BVS A;  4F88 A;  1EY4 A;  4P72 A;  3IRB A;  1WJJ A;  4A3B G;  5CYU A;  2IPK D;  2JYO A;  5L37 A;  3HOV G;  1GHJ A;  4DGZ A;  4LNQ A;  1U4P A;  1O78 A;  2A68 C;  5C4Z A;  5GAH C;  3S17 B;  2EJG C;  1HFN A;  1SYG A;  5M5Y H;  2R7Z H;  4DUZ Q;  2KA7 A;  2WKD A;  2L11 A;  3HOX B;  1I4Q A;  1PTO H;  3CCR A;  3I2Z A;  1AH9 A;  2ZTC A;  1ENC A;  1YNN D;  3BYY B;  3K7A B;  2YTY A;  1ESR A;  1Q3L A;  4AIM A;  5C44 G;  4OON A;  1P16 A;  3TS2 A;  1HNW Q;  1F9S A;  3FRP B;  3GDE A;  3H91 A;  3EJI A;  2YYZ A;  4FF4 A;  1NR4 A;  1QWY A;  3TBI B;  1EYA A;  3ZYY X;  2NWG A;  4GKK L;  4OO1 G;  4JI8 L;  3G71 A;  1K3B C;  1PZI D;  5KEE A;  1B53 A;  2ENB A;  3VYT A;  2VQF L;  3UDG A;  3K58 A;  4CBV A;  3KF8 A;  2JA7 B;  2KJX A;  5IGG A;  5H1S E;  4HR7 B;  4IFD G;  2FJ2 A;  1F2M A;  4DR3 L;  1VDZ A;  2PW5 A;  2R92 B;  2OXP A;  3EFX D;  1HZC A;  2N3S A;  4NXN L;  1I5F A;  4RHS A;  4V0B A;  1II3 A;  1V1P B;  1GJX A;  4JI7 Q;  1QCB D;  2V1C C;  3M9B A;  3FP9 A;  2NZO A;  3A74 A;  3H6M A;  3K81 C;  1YI2 A;  1NMF A;  3MFY A;  4TKO B;  2JN4 A;  4DXG A;  5ELD A;  2CH4 A;  3CU7 A;  4LK1 C;  3OMG A;  4XDX A;  4LF9 L;  2UXD L;  5I2Y A;  1M1K C;  5LMN L;  1JR0 D;  2ZTD A;  4LW1 A;  3PO3 G;  4HSV A;  1W3S A;  4ID6 A;  3R8B A;  1IKM A;  5A2Q L;  4LAA A;  2WAC A;  5GAD C;  1B3Q A;  3IFD A;  2ZM6 Q;  1OXS C;  4QIW B;  1MFS A;  1LT5 D;  1S72 A;  1HFG A;  2E2D C;  5EBD A;  2DGY A;  1HR0 W;  2XN9 C;  3PGZ A;  2I5M X;  4XIG S;  4JC0 A;  4DFA A;  3STB D;  3J80 L;  4A3J B;  4RKL A;  5BN5 A;  3CRL C;  2RF4 A;  3M4O B;  4H13 C;  1KDC A;  2ZJR A;  1WTP A;  4G4K A;  2F4I A;  5C0X G;  1TS2 A;  4LF6 L;  1I3Q H;  2NN6 H;  5IGE A;  4GKJ Q;  3D0F A;  1VQN A;  2L12 A;  4A3M H;  2L9H A;  1F6U A;  3E5S A;  1E24 A;  1XYI A;  1A6X A;  2J7Z A;  1Q7Y C;  3PIP A;  3K80 C;  1WTV A;  1BR9 A;  3OHX C;  2HHH L;  1A62 A;  1E22 A;  5DNF A;  1A1T A;  3S2D H;  3GO5 A;  4K2K A;  3HGB A;  4J6H A;  5FK9 C;  4L63 B;  2G9D A;  1HQR D;  1YHQ A;  2JA5 H;  1A63 A;  1UAP A;  5K36 H;  1Y8N B;  4QMG A;  5EBC A;  3IL8 A;  1CKN A;  2B29 A;  2IJ0 A;  4FO2 A;  5LHY 1;  3KBX A;  4JI5 L;  5FOB B;  1I6H B;  1LAC A;  4R1J A;  3TME A;  1C48 A;  1ICW A;  1PRT C;  3HOW B;  2VL6 A;  2WV6 D;  1EQT A;  4POF A;  4L5R C;  1J5E L;  1Z47 A;  2UUB L;  2B2U A;  1A15 A;  4DR1 L;  5IYC G;  2R7Z G;  4IJL A;  2N55 A;  3J7A 5;  2LSS A;  4R9W A;  5ELF A;  3C2P A;  3DLL A;  2B39 A;  1CKO A;  1JOO A;  3OWF A;  1W6K A;  1Y1V H;  4YHH Q;  4RH6 A;  4WJ4 A;  4JPB W;  1K73 C;  2OTJ A;  2SDF A;  3WOE A;  4KD4 A;  1VQE A;  5DM7 3;  3A55 A;  3M3Y B;  4EQ5 A;  3L7Z C;  4HJ9 A;  3S17 H;  3NP8 A;  1NSN S;  3MVV A;  5C5M A;  2HIX A;  4QY7 A;  3ICE A;  2K1B A;  3CCQ A;  3Q23 A;  1VMC A;  2AHO B;  4DNI A;  2X6G A;  2JEB I;  4X66 Q;  1K8O A;  2E2I H;  3CCE A;  4JI1 L;  2E74 C;  2I5L X;  1FJG L;  2Q2T A;  2BDO A;  2RCF A;  3OW7 A;  4HN7 A;  2EY2 A;  1SXT A;  4CDD C;  3PCO B;  1F9R A;  4ZK9 B;  2WB1 B;  4IFD I;  2UUA Q;  3BDL A;  3NBI A;  3NSW A;  1SAP A;  3GTK B;  3S16 H;  4R4C A;  2QDB A;  2JP1 A;  3NUC A;  2PQA B;  1LTG D;  2F0I A;  1Q8K A;  1WWD A;  2XRQ D;  3O13 A;  4LUV A;  1CUK A;  1YEZ A;  1N8R C;  2LXJ A;  1JWS D;  5M3F H;  2KHJ A;  2XRS D;  1E2Z A;  2IHE A;  4I7A A;  1SLJ A;  3OTO L;  3BZK A;  1IHZ A;  4JOI C;  3PIP 3;  4ME5 A;  4O0A A;  3TRZ A;  2EVB A;  4OWX B;  2F0T A;  3RLF A;  3CF5 A;  1U4R A;  1YBY A;  1XPO A;  4O2D A;  3GTJ H;  3NTI A;  4K8J A;  1BCP C;  2VNU D;  1HTP A;  4RAU C;  4YY3 L;  2EYL A;  1U6P A;  2F0Q A;  3SGI A;  1G6Z A;  5JVG 3;  2Y0S B;  4FP5 D;  4DK0 A;  4RKB A;  1DYQ A;  1CFM A;  1QNU A;  4Y52 H;  3NBH A;  3VDY A;  2BE5 C;  3S1M H;  5I4D A;  2PYK A;  2NYZ D;  3QOL A;  4X64 Q;  3I70 A;  4R8N A;  2OWO A;  4A3K H;  2CWA A;  5FJ8 G;  5M3M H;  1IYV A;  1K0R A;  1M4V A;  4A3M G;  2NTT A;  1BNZ A;  5C0X I;  1N33 L;  3D6W A;  3E9I A;  4IUV A;  1KTK A;  1EYG A;  1CA6 A;  3T53 B;  5IWA Q;  2F0W A;  1Q3Z A;  4A3J H;  4F7X A;  3Q8D A;  3M4O H;  2HIV A;  4R4Q A;  2EPB A;  4JI6 Q;  3HKZ G;  1PTO C;  5K36 G;  2N8N A;  2SNS A;  3BG3 A;  1O7I A;  2OTL A;  4B08 A;  1CQV A;  3MXP A;  1KD1 C;  2A6E C;  5FLM H;  4CJ2 C;  4A93 B;  2VW9 A;  1WCM H;  4YCW A;  1NE3 A;  2G5D A;  4NW2 A;  4P71 A;  2A68 D;  5JJK A;  3HKS A;  3BYT B;  1QVG A;  3LNN A;  4MN3 A;  3GTP B;  2EYM A;  4K6D A;  5EKL A;  4PZ8 A;  4L8J A;  5CV6 A;  2JQO A;  3D4R A;  1VQM A;  3CHB D;  3MWY W;  2HDL A;  1LTR D;  2JSO A;  1HNZ L;  4KTA A;  3GTO B;  4C2M B;  2F0F A;  1A3T A;  5C5L A;  4DK1 A;  5LMU Q;  1V1P A;  5KRU A;  1KIX A;  4DV3 L;  5C3X A;  5JPM C;  2E5L L;  1RTO A;  4JBK A;  1SNC A;  3DEP A;  3WDN A;  4PMC A;  3HOX G;  3A0J A;  4KJO A;  2RDH A;  4JI3 Q;  3BDC A;  2B2W C;  1CQF A;  2F0H A;  3G48 A;  3T4A C;  4QUC A;  1C9O A;  1SYE A;  1ASZ A;  3E0E A;  3MEF A;  2WAQ B;  1L0X B;  1EEI D;  1YZ6 A;  1G29 1;  1MJC A;  4XXE A;  1CHQ D;  3KF8 B;  1TKW B;  2KEE A;  2HCI A;  3E0J A;  3JAM c;  3PUV A;  2WKC A;  2SOB A;  2EYJ A;  1VF7 A;  1A6B B;  1LLR D;  5M5W H;  4A3E H;  3BVM A;  4PG3 A;  4B3T Q;  2LS0 1;  4PQX A;  2JA7 G;  2Z6K C;  4FXK C;  1AFP A;  2A5H A;  3I56 A;  3EIV A;  1WOC A;  4QCL A;  1ML0 D;  5M3F G;  2R92 G;  4OHJ A;  1LTA D;  2JA6 B;  2F0M A;  1Z7T A;  1DJR D;  2VXW A;  3GV3 A;  2TSS A;  5IYD G;  2X6L A;  1TWG B;  1VQK A;  4TQU S;  1AE2 A;  3I4M B;  2RVL A;  3NWT A;  2NVX H;  4LFC L;  5AJ3 L;  1EY9 A;  4RFB A;  5CMD A;  2E75 C;  1EY7 A;  5CC4 A;  4ZKB B;  4JI4 Q;  1S40 A;  3NPP A;  5K5P A;  4LF4 L;  2I0Q A;  1RL2 A;  3UE0 A;  2JE6 I;  3LX0 A;  2DY7 A;  4OL7 A;  1F9P A;  4QF4 A;  5M5X H;  3W2D A;  1IBL Q;  1GD7 A;  3T1H L; 
#chains in the Genus database with same CATH homology
 1X6O A;  4L5Q A;  4YCU A;  4MZ9 A;  4IO9 A;  3CPF A;  1XNR L;  4DV7 Q;  3I4M G;  4MTN A;  3TRE A;  3KFU A;  4DK3 C;  1XTD A;  1NJI C;  2LXK A;  4BBR H;  1LM0 A;  4YWK A;  5DLQ E;  5IP9 G;  5IWA L;  3JAM i;  1C0A A;  2VUM H;  4GNX C;  2EIF A;  4A3L H;  4HJ7 A;  5JJL A;  4AH6 A;  4DK6 C;  4A3K G;  1TXY A;  4DR2 Q;  1PH5 A;  5M3M G;  4KHP Q;  1BBW A;  1YNX A;  1GVP A;  4DV4 L;  4UY8 C;  4BA1 I;  1NY4 A;  2VUM G;  2JZW A;  4LF6 Q;  5C3E H;  4JI6 L;  2CKZ B;  2K5V A;  3KYH C;  4DV4 Q;  2Q2U A;  3CC2 A;  4BXX H;  1QVF A;  2NVT H;  4A3G G;  3F8T A;  4C3J H;  1WWG A;  3OW2 A;  3CD6 A;  4BY7 H;  4A3J G;  3RZO H;  2K52 A;  4A3B H;  5BR8 Q;  4APV A;  1HNX L;  1BVS A;  3HOV H;  1A8V A;  5C3E G;  1VQ5 A;  4BXX G;  2LI8 A;  2ASB A;  3H3V H;  4BA2 I;  4P72 A;  2ZTE A;  1HNX Q;  4R4O A;  3IRB A;  4BY7 G;  1HZB A;  1WJJ A;  4A3B G;  4JYA L;  2CFM A;  1K8G A;  3KLW A;  4KHZ A;  3HOV G;  2BA1 A;  3TEH B;  4MNO A;  2QA4 A;  2HHH Q;  4QGU A;  4GOP B;  2M3Z A;  1YHA A;  4QIW E;  2UXC Q;  2IT1 A;  4PMW A;  4JG2 A;  4GOP C;  1NBW A;  3ULP A;  1XJV A;  4BBS H;  1B7Y B;  4LNQ A;  1XPU A;  3F2C A;  3KF6 B;  3CCJ A;  1YJW A;  5GAH C;  1EIF A;  5GQO A;  5JEA J;  1YJN A;  5M5Y H;  2R7Z H;  2R7D A;  2AWN A;  1PH3 A;  4DUZ Q;  4GLA C;  1YIJ A;  1I94 L;  4BBS G;  4JI5 Q;  4OWW B;  3K0X A;  1XNQ Q;  2RHQ B;  1AAF A;  1XMO L;  1X9N A;  3CCR A;  3I2Z A;  1XPR A;  1I6H H;  1AH9 A;  2ZTC A;  4TVA B;  5LMU L;  2YTY A;  5EAY A;  1PH7 A;  3HOW H;  4AIM A;  3PUZ A;  4DR1 Q;  5C44 G;  4OON A;  1VQB A;  2H5X A;  1P16 A;  3ERS X;  4WJ3 M;  1E7Z A;  2MO1 A;  5JEA G;  3GDE A;  1JMC A;  1VQL A;  1U0L A;  4IPD A;  4NXM Q;  3TS2 A;  3PUY A;  1HNW Q;  4C3H H;  4DV6 L;  3U58 A;  2YYZ A;  3HOW G;  4QQB X;  3CP0 A;  4JI3 L;  3PUX A;  4JCV E;  1TWF H;  3PUW A;  1QUQ B;  4L5T A;  1N36 L;  1X3G A;  4LFA L;  4GKK L;  4OO1 G;  4JI8 L;  2E2J H;  3G71 A;  4JBW A;  5IYB H;  2IX1 A;  2VQF L;  3UDG A;  4KI0 A;  3ER0 A;  4AYB G;  1VQC A;  2JA8 H;  1Q12 A;  5ELN A;  3UDI A;  5H1S E;  4IPH A;  4HJA A;  3M3Y H;  4IFD G;  4YCV A;  3CW2 C;  4A4I A;  4DR3 L;  2RCN A;  2MNA A;  2Z6K A;  3L2P A;  1FGU A;  1HZC A;  1VS0 A;  1UEB A;  2N3S A;  1I5F A;  4NXN L;  1GKH A;  1OXU A;  3WWV A;  4B3T L;  3KOJ A;  1Z9F A;  1VQA A;  3BU2 A;  2NVY H;  4LUO A;  4YWM A;  4JI7 Q;  3HOZ G;  2V1C C;  1IBM Q;  3M9B A;  1B8A A;  1NTG A;  1IYJ B;  3FP9 A;  2NZO A;  3A74 A;  3K81 C;  4GS3 A;  4YWL A;  1CKM A;  1DGS A;  4DV2 Q;  4AQY L;  1YI2 A;  1FJG Q;  2UUC L;  3AEV A;  1HJP A;  1NMF A;  2CQO A;  4B3M L;  1VQD A;  4A3E G;  2QGQ A;  3CCU A;  2KHI A;  1GM5 A;  4LFB L;  4GLX A;  3CMA A;  3G6E A;  4OWT B;  2RHS B;  3M4Q A;  4LF9 L;  1N32 Q;  2UXD L;  3PO3 H;  1M1K C;  3PV0 A;  5LMN L;  1V1Q A;  4Y7N H;  3J81 c;  4DR5 Q;  4NB3 A;  4RG1 A;  3HOY H;  4JI4 L;  2K5N A;  3GTK H;  2ZTD A;  4LW1 A;  3GTQ H;  3PO3 G;  1W3S A;  2WB1 G;  4OX9 L;  1IBL L;  1WI5 A;  2JK8 A;  3HOY G;  4JBJ A;  4GLV B;  2F3I A;  5GAD C;  2ZM6 Q;  2ZJP A;  4HIM A;  1OXS C;  3J80 c;  4DV7 L;  1CSP A;  3OTO Q;  3M85 A;  2E2H H;  1MFS A;  4GNX A;  1S72 A;  1SMX A;  3S1R H;  1JJC B;  2DGY A;  3U4V A;  3PGZ A;  5FLX c;  1HR0 W;  2I5M X;  4XIG S;  2YV5 A;  4JC0 A;  2K50 A;  1ASY A;  4B3R Q;  4LF8 Q;  3STB D;  2ID0 A;  4DR2 L;  4KHP L;  4B3S L;  2I5H A;  2IHF A;  4QJF A;  4YY3 Q;  1SE8 A;  2RF4 A;  4DR6 Q;  4ME3 A;  4LF7 Q;  2ZJR A;  4PZ7 A;  1TWH H;  2WB1 E;  4GN5 A;  5C0X G;  2EXD A;  4DV0 Q;  4B3S Q;  4LF6 L;  1I3Q H;  2D0O A;  4GKJ Q;  2MFI A;  4BBR G;  3I55 A;  3D0F A;  2JJQ A;  1VQN A;  2KBN A;  4X65 Q;  2OQK A;  4A3L G;  2AKW B;  2BH2 A;  4XTC S;  5BR8 L;  2K4K A;  4A3M H;  1C7Y A;  1BBU A;  3RN5 A;  2NN6 G;  3NBH B;  1F6U A;  1RIP A;  1E24 A;  1WFQ A;  1HZA A;  3H15 A;  1LUZ A;  4DAM A;  5IT9 c;  1Q7Y C;  2Y0S G;  3PIP A;  3CCL A;  3GTL H;  2N49 A;  4DR4 L;  1HR0 Q;  4L5S A;  3K80 C;  2HHH L;  1A62 A;  1E22 A;  1A1T A;  3BZC A;  2MQH A;  3CCM A;  1PH4 A;  3GO5 A;  2KCM A;  3S2D H;  4DR4 Q;  1Q46 A;  2UXC L;  4A3C H;  1R9T H;  1QZG A;  3CAM A;  1N33 Q;  2BH8 A;  1PFS A;  1YHQ A;  2JA5 H;  1A63 A;  2EXF A;  3KJO A;  2KEN A;  5J3B A;  1YJ9 A;  1JJG A;  4DUZ L;  1VQ8 A;  1CKN A;  5GRO A;  2B29 A;  4DPG A;  3CC7 A;  4JI5 L;  2JA5 G;  5IYC H;  1L1O B;  4R1J A;  1VQ6 A;  1XNQ L;  1UE7 A;  1PH2 A;  2VL6 A;  2UU9 Q;  4A3D H;  2E8G A;  5JJI A;  1L1O C;  2C35 B;  2Y0S E;  3KDF A;  2OCE A;  2D0P A;  3EN2 A;  3K8A A;  1Z47 A;  4POF A;  1J5E L;  2UUB L;  3J7Z C;  1PYS B;  4IOA A;  2HQL A;  4DR1 L;  5IYC G;  3CME A;  3RN2 A;  2JEA I;  2R7Z G;  1G51 A;  4IJL A;  1J5E Q;  3J7A 5;  1Q1E A;  2LSS A;  2AMC B;  2OQ0 A;  2UUB Q;  4A3D G;  4NXM L;  2D62 A;  1L0W A;  1HNW L;  3PF5 A;  4LF5 Q;  3F2B A;  3S14 H;  1YVC A;  1X65 A;  3DLL A;  3GTG H;  1CKO A;  2R7F A;  2F4V L;  3CC4 A;  1OXX K;  3HOU H;  1Y1V H;  2Z0S A;  3AYH B;  5HY6 A;  4YHH Q;  1D8L A;  4A93 H;  1S3O A;  2IX0 A;  4DR7 Q;  4IFD J;  4WJ4 A;  1MIU A;  1K73 C;  1N9W A;  2F4V Q;  2OTJ A;  1Q1B A;  3HKZ E;  4HJ8 A;  1KL9 A;  1VQE A;  2B3G A;  2ZJQ A;  1VQI A;  1Y1V G;  4EQ5 A;  4A93 G;  1PVO A;  3L7Z C;  4HJ9 A;  1UE6 A;  3BJU A;  3RR5 A;  3CCS A;  3S17 H;  3GTP H;  3S2H H;  4GN4 B;  4IJH A;  2FXQ A;  4BY1 H;  1SR3 A;  3JC6 6;  3PO2 H;  2HIX A;  1JE5 A;  4EX5 A;  4QY7 A;  2ES2 A;  3CCQ A;  1HNZ Q;  3ICE A;  3W1G A;  1VQF A;  5IY0 A;  2GN5 A;  2UXB Q;  2Q2I A;  2AHO B;  4DNI A;  4X66 Q;  1Y1W H;  2JEB I;  4P73 A;  4JI7 L;  2JA8 G;  3PF4 A;  4RMF A;  2E2I H;  3KJP A;  3CCE A;  1IBM L;  4K0K L;  1TWA H;  1AE3 A;  4JI1 L;  3GTO H;  4JI0 Q;  2I5L X;  4DV2 L;  1FJG L;  4J15 A;  4C2M H;  5IP7 H;  4DV3 Q;  2E5L Q;  2Q2T A;  3L0O A;  2B63 H;  2WFW A;  1T9H A;  4X62 L;  3UDX A;  2VZA A;  4UP8 A;  3PCO B;  3UDF A;  4A75 A;  4IFD I;  3RZD H;  2UUA Q;  4X62 Q;  1UE1 A;  4DUY Q;  4R4I A;  1N32 L;  4DAY B;  1QVC A;  5IYB G;  1SFO H;  2NVQ H;  3S16 H;  4R4C A;  1E1O A;  4OXP A;  4X6A H;  4DR5 L;  1W2B A;  2PQA B;  4IPC A;  3AFP A;  1Q8K A;  1LTL A;  4FDB A;  1EIY B;  1WWD A;  4LUV A;  3H0G H;  3NEM A;  1PV4 A;  1PH9 A;  1CUK A;  1IL2 A;  1YEZ A;  1X55 A;  1Q86 C;  2R93 H;  1N8R C;  2LXJ A;  3U50 C;  5M3F H;  3M7N A;  2KHJ A;  2KCT A;  1OXT A;  1UWV A;  2CCZ A;  2AWO A;  2IHE A;  2WAQ G;  2ZM6 L;  1EQQ A;  4K0K Q;  1VQP A;  1IXR A;  1BKB A;  1SLJ A;  3OTO L;  1OTC A;  3BZK A;  1JT8 A;  5C0X J;  2R93 G;  2VQE Q;  4JOI C;  3TRZ A;  4O0A A;  1SRO A;  1YHB A;  2IHX A;  4OWX B;  3TQY A;  2VS1 A;  3RLF A;  3G4S A;  1PH6 A;  3CF5 A;  1H95 A;  1YBY A;  1XPO A;  4B3R L;  1VQJ A;  4LF8 L;  2Q2H A;  4O2D A;  3GTJ H;  1EFW A;  1HZ9 A;  2VNU D;  1JJ2 A;  1M90 C;  3A5U A;  1Y14 B;  3CQZ H;  2CWP A;  4YY3 L;  4DR6 L;  1SN8 A;  1U6P A;  2K75 A;  4LF7 L;  3ULL A;  2JA9 A;  1V9P A;  3SGI A;  4DV0 L;  1EQR A;  3STB C;  4DV5 Q;  2JA6 H;  3S24 A;  4GKJ L;  4A3I H;  3LGJ A;  2EC7 A;  1BJ6 A;  1JB7 A;  3T1Y Q;  1KHI A;  1P8L A;  4X65 L;  1VQ4 A;  4LFC Q;  4DV1 Q;  2WAQ E;  4Y52 H;  1LYL A;  1TWG H;  1EUJ A;  2CQF A;  3VDY A;  5FJ8 H;  2PI2 A;  3I4M H;  2JA6 G;  3RLN A;  3S1M H;  4A3I G;  1SRU A;  1KAW A;  3K7U C;  4X64 Q;  3W5O A;  3GTM H;  4LF4 Q;  5IP9 H;  3CXC A;  1XMQ Q;  2A19 A;  1FVI A;  3UE1 A;  1HR0 L;  2OWO A;  4A3K H;  2CWA A;  5FJ8 G;  5M3M H;  3T1H Q;  3HFZ B;  3ZJY C;  3PSI A;  4GNX B;  2K14 A;  1K0R A;  2XTI A;  4A3M G;  4UPA A;  2YU9 H;  5C0X I;  1N33 L;  1XNR Q;  4GOP A;  3W1B A;  1VQO A;  3E9I A;  1VQG A;  1EWI A;  3J81 i;  2A1A A;  4QL5 A;  2YTV A;  4JI1 Q;  1EYG A;  4A3F H;  2EQS A;  3I4O A;  4A3G H;  5IWA Q;  3NYB B;  1PH1 A;  1FL0 A;  1ESK A;  1Q82 C;  1Q3Z A;  3I4N H;  3KF6 A;  4A3J H;  1X56 A;  4DKA C;  1VCI A;  3ULJ A;  3Q8D A;  1L1O A;  3RLO A;  2NN6 I;  3D31 A;  3M4O H;  1X54 A;  2HIV A;  4A3C G;  4A3F G;  4R4Q A;  2UU9 L;  2YSA A;  4A76 A;  3CCV A;  3I4N G;  1EOV A;  4JI6 Q;  1MKH A;  3HKZ G;  5K36 G;  2N8N A;  3J80 i;  1O7I A;  2DUD A;  2OTL A;  1IBK L;  1KD1 C;  3M4P A;  2GVB A;  5FLM H;  2XGT A;  4IPG A;  4LF5 L;  1A0I A;  1IBK Q;  2VW9 A;  1KC8 C;  3A5Z B;  3H3V I;  1WCM H;  4YCW A;  1E3P A;  4DR7 L;  4YHH L;  1NE3 A;  1NMG A;  4JYA Q;  4P71 A;  5FLM G;  1V43 A;  1KRS A;  2HT1 A;  1MJE A;  5JJK A;  1QUQ A;  2K5H A;  3HKS A;  1KQS A;  3J81 j;  1Q81 C;  1WCM G;  1QVG A;  3OYY A;  4HIO A;  4GN3 B;  2PMZ E;  5GAE C;  4PZ8 A;  1CKN B;  1X3F A;  4LWC A;  2JQO A;  3HOU G;  1VQM A;  2BA0 A;  5C44 H;  1L2F A;  2QEX A;  1I94 Q;  1GO3 E;  1HNZ L;  5GAG C;  3KDF B;  5HGQ A;  2UXB L;  1VQH A;  2MO0 A;  1XMO Q;  4X66 L;  5E7N A;  1WWE A;  5C4X H;  4HID A;  3HOX H;  1Q3Y A;  5LMU Q;  4LUZ A;  4H02 A;  2PI2 E;  1KIX A;  1VQ7 A;  4JI0 L;  1WYD A;  4DV3 L;  4BY1 G;  3MXN B;  4HJ5 A;  3K7A H;  1PH8 A;  2E5L L;  4JBK A;  3PO2 G;  4OO1 I;  5C4X G;  1PA6 A;  2PNH A;  3HOX G;  3A0J A;  2L4L A;  1X3E A;  4JBM A;  4DV6 Q;  4POG A;  1N34 L;  1K9M C;  4JI3 Q;  1Y1W G;  1KRT A;  2UUA L;  1J6Q A;  3F1Z A;  4DUY L;  3TS0 A;  3EBE A;  3G48 A;  1N36 Q;  4LFA Q;  1N34 Q;  1C9O A;  2VY3 A;  3U4Z A;  4JI8 Q;  4GKK Q;  5IP7 G;  3E0E A;  1ASZ A;  3MEF A;  2PQA A;  2VQF Q;  2B63 G;  1OXV A;  1PYB A;  2IY5 B;  2F52 A;  1YZ6 A;  1VQ9 A;  4IOC A;  1G29 1;  3GD7 A;  1MJC A;  2GVA A;  4UP9 A;  5IE8 A;  3HOZ H;  3KF8 B;  2R6G A;  3I7F A;  4HIK A;  2ALY B;  3DM3 A;  3JAM c;  3PUV A;  2JA7 H;  1YIT A;  5LMN W;  4DR3 Q;  1A6B B;  5M5W H;  4A3E H;  4JOI A;  1WWF A;  1U5K A;  4PG3 A;  4B3T Q;  3FHW A;  1B70 B;  5ELO A;  4NXN Q;  1CSQ A;  3S1N H;  1K8A C;  2R92 H;  4R4T A;  2Z6K C;  4C3I H;  2VQE L;  2A8V A;  2JA7 G;  3H0G G;  4AYB E;  4JI2 L;  3I56 A;  1G6P A;  1I50 H;  1WOC A;  3EIV A;  4L5R C;  3NEL A;  4AQY Q;  3CPW A;  5M3F G;  4UP7 A;  5IYD H;  1PHJ A;  4JV5 L;  2UUC Q;  4JI2 Q;  1K3R A;  1UE5 A;  4B3M Q;  2R92 G;  1QZH A;  4P74 A;  2N78 A;  3E9H A;  4KLK A;  3FKI H;  4LFB Q;  3B6Y A;  2L15 A;  4JV5 Q;  4DV5 L;  5IYD G;  5C4J H;  1VQK A;  1IZ6 A;  3T1Y L;  4P75 A;  1AE2 A;  4TQU S;  4LF9 Q;  2UXD Q;  2NVX H;  4LFC L;  5AJ3 L;  4DV1 L;  5LMN Q;  2ATW A;  1HH2 P;  3FKI G;  3RNU A;  3NEN A;  3F2D A;  1D7Q A;  4PZ6 A;  4JI4 Q;  3AQQ A;  5AJ3 Q;  2NZH A;  1S40 A;  3S1Q H;  4X64 L;  1KXL A;  2YTX A;  3S15 H;  4LF4 L;  2I0Q A;  3AFQ A;  1RL2 A;  2JE6 I;  3UE0 A;  1K83 H;  4ALP A;  1XMQ L;  1TWC H;  5M5X H;  3PIO A;  4OX9 Q;  1IBL Q;  1GD7 A;  4NPS A;  2WP8 J;  3T1H L;  1E1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...