1XD3A

Crystal structure of uchl3-ubvme complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
Knots found
sequence length
229
structure length
229
Chain Sequence
EGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Ubiquitin Hydrolase UCH-L3 Complexed with a Suicide Substrate
pubmed doi rcsb
molecule keywords Ubiquitin Carboxyl-terminal esterase L3
molecule tags Hydrolase
source organism Homo sapiens
total genus 81
structure length 229
sequence length 229
chains with identical sequence C
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2004-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.532.10 Alpha Beta 3-Layer(aba) Sandwich Ubiquitin C-terminal Hydrolase UCH-l3 Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1xd3A00
3KVFA 3KW5A 2ETLA 3A7SA 4UELA 1UCHA 4DM9A 1CMXA 4UEMA 3IRTA 1XD3A 3RISA 3RIIA 4IG7A 2LENA 3TB3A 3IFWA 4I6NA 3IHRA 4JKJA
chains in the Genus database with same CATH superfamily
3KVFA 3KW5A 2ETLA 3A7SA 4UELA 1UCHA 4DM9A 1CMXA 4UEMA 3IRTA 1XD3A 3RISA 3RIIA 4IG7A 2LENA 3TB3A 3IFWA 4I6NA 3IHRA 4JKJA
chains in the Genus database with same CATH topology
3KVFA 3KW5A 2ETLA 3A7SA 4UELA 1UCHA 4DM9A 1CMXA 4UEMA 3IRTA 1XD3A 3RISA 3RIIA 4IG7A 2LENA 3TB3A 3IFWA 4I6NA 3IHRA 4JKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KVF A;  3KW5 A;  2ETL A;  3A7S A;  4UEL A;  1UCH A;  4DM9 A;  1CMX A;  4UEM A;  3IRT A;  1XD3 A;  3RIS A;  3RII A;  4IG7 A;  2LEN A;  3TB3 A;  3IFW A;  4I6N A;  3IHR A;  4JKJ A; 
#chains in the Genus database with same CATH topology
 3KVF A;  3KW5 A;  2ETL A;  3A7S A;  4UEL A;  1UCH A;  4DM9 A;  1CMX A;  4UEM A;  3IRT A;  1XD3 A;  3RIS A;  3RII A;  4IG7 A;  2LEN A;  3TB3 A;  3IFW A;  4I6N A;  3IHR A;  4JKJ A; 
#chains in the Genus database with same CATH homology
 3KVF A;  3KW5 A;  2ETL A;  3A7S A;  4UEL A;  1UCH A;  4DM9 A;  1CMX A;  4UEM A;  3IRT A;  1XD3 A;  3RIS A;  3RII A;  4IG7 A;  2LEN A;  3TB3 A;  3IFW A;  4I6N A;  3IHR A;  4JKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...