4UELA

Uch-l5 in complex with ubiquitin-propargyl bound to the rpn13 deubad domain
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
Knots found
sequence length
315
structure length
302
Chain Sequence
GEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEENSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE ISOZYME L5
publication title Mechanism of Uch-L5 Activation and Inhibition by Deubad Domains in Rpn13 and Ino80G.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 302
sequence length 315
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
A PF18031 UCH_C Ubiquitin carboxyl-terminal hydrolases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.860 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4uelA02
3.40.532.10 Alpha Beta 3-Layer(aba) Sandwich Ubiquitin C-terminal Hydrolase UCH-l3 Peptidase C12, ubiquitin carboxyl-terminal hydrolase 4uelA01
4IG7A 3IHRA 4UEMA 3RISA 1UCHA 2ETLA 3RIIA 2LENA 3A7SA 3IRTA 4UELA 1CMXA 4JKJA 3IFWA 4I6NA 3KW5A 1XD3A 4DM9A 3KVFA 3TB3A
chains in the Genus database with same CATH superfamily
3RIAA 3U78A 3NRXA 3ZEFB 2WCAA 3MACA 2EHOD 4GK0E 4Z91A 5L3EB 3RH3A 3VRBA 4IE4A 3IF8B 3HL6A 3BQIA 5AQTB 5JREA 3KV9A 4DBRA 3AEBA 4ILCA 3VHLA 2LSKA 1B7TA 2W63A 5JDMA 4DNDA 2HPJA 4IL9A 2XQ9A 3T1YT 2ZLYA 3WAKA 4WW0A 4H9OC 3P4PA 4ZI2D 5ADXL 2EHOB 4DR1T 2XM2A 5JVDE 4UXNB 2CMRA 3ZLIA 3ANWA 3PUWF 3VKHA 5IUXA 2PBIA 2C5IT 4DR2T 4DMWA 4JI2T 4A97A 3ZMVB 3R84B 3DJBA 3U3IA 2CBIA 4G63A 3TLUA 4JI4T 4UELA 5JDFA 1XZYA 1T98A 5JR9A 3HI2A 4QXCB 1ZEEA 4EYYR 3P4WA 3I9YA 1E7PA 2W61A 3AE1A 1V9DA 4DR4T 5HEGA 2ZMAA 5FL1A 2XJ7A 4EIWA 2W00A 2L3LA 3UQ7A 2IDOB 4J2CA 3AE2A 5LA6E 2YK0A 2BS4A 2LRKA 1Z0PA 5J2TE 3NZPA 3FZLB 4HWHA 4DV0T 4ZS3A 4YTNA 2R6GF 1MMNA 3F31A 2VKJA 3EABA 3JADA 2H89A 3I1AA 4A5XA 1CMXA 1T8BA 4LMLA 2VASA 3LBXB 1MIYA 3ZPOA 2FJDA 2W66A 3KVFA 4U2YA 3A7MA 4FJOA 2Q9QA 1SHZC 3AXJB 3ONXA 2BVMA 5FP3A 4X20E 5IHYA 3RI5A 5JR9C 4PJLA 3F2EA 4UV9B 2PTFA 3KBTA 5HWYA 4KBMB 4LMKA 1FIOA 5HAXA 3JCFA 4ILUA 3PUGA 4OX9T 5J1GA 5DQVA 4DV1T 2WM9A 2KNDA 4IHJE 4U31A 2X0YA 1J1JA 1IAPA 2DHRA 4CXYA 2SPCA 4U7IA 2XAGB 4QHOA 4HEAA 4BA9A 3LJCA 5AQGB 1OWAA 3CQCB 2PFVA 2MTQA 3AE4A 2X0HA 2XSAA 1HF8A 4X66T 2WSSV 4YHJA 1N36T 1WR0A 3Q2MA 5L3FB 4YTPA 3N9PA 1W9RA 4JI8T 1UCUA 2LKHA 3F57A 1KK7A 2LSIA 5FKYA 2I0MA 1HFAA 3ZMUB 3VKGA 2YEVC 2JMHA 5LHGB 2UUAT 1YQ3A 2VVSA 2LT3A 4OHFA 1BR1A 2VK9A 3IHRA 1XNRT 4O2BE 5FXZA 4I4TE 2KLQA 2CE7A 3O1JA 3ZCIA 3RIUA 2XQ7A 5F8PA 3JC6D 3AE8A 2XQ5A 1MMAA 1NWMX 1W09A 3TLWA 1HG2A 3ETVA 3H37A 3V5UA 3UTKA 3RYFE 2HPLA 2JQ9A 3FXDB 2CCQA 4A56A 4AQYT 2E8IA 5CA1E 2K48A 5KX5E 3AA0B 3PJAJ 2KWIB 1GQEA 4WZXA 4YSYA 4PJMA 4ERRA 4YJ2E 5JDHA 2NTYA 3CKDA 2IHR1 5ABGA 2WZHA 4TWFA 2D0UA 3RGLA 5AQJB 1UX4A 4ASKA 5AQOB 2ETLA 3RIFA 5JDQA 3UT5E 3PUQA 3PV0F 4ZHQE 2OLTA 2V7LA 3RIUC 4EEBA 3S4UA 1HX1B 4GKKT 1U5PA 2M6IA 2WMNA 2J62A 2YOEA 1XWMA 4ZI3C 5LHHB 2CLYC 1YXRA 3A5XA 2WU5A 4WNKA 3VR8A 2XAQB 3KDSE 2XSBA 3OPCA 2A9UA 2E9XC 3RRCA 2BKPA 3EVYA 3QUJA 3P50A 4IDZA 4X1IE 3BQLA 4HFBA 3K3OA 2QRXA 4KX6A 3E22E 5E0OA 2FBWA 3AVSA 1N33T 4LF5T 2NOXA 4U72A 2BG9B 4DR6T 3CMLA 5A1LA 4UVBB 4H63V 4KMCA 3FZMB 2YU1A 3Q5XA 3K8PC 4YLHA 3MKDA 5FXXA 4GK5E 3FZFB 2GK9A 3LFMA 1BR2A 4X5TA 2C0SA 5HXCA 3HR0A 3C50A 2J1DG 4UVCB 2LE8A 2W4XA 5LYJE 2W0GA 5LJMA 1G8XA 1UUSA 4F8HA 5F3JA 1XMOT 1HTJF 1R8IA 2XQAA 4WBOA 2XASB 4EOZB 3RIIA 4HFHA 3ZT7A 3RHWA 2NTXA 1WRDA 4U2ZA 2W62A 4AKRB 5HCMA 3EAMA 2IAKA 2JQQA 5AQRB 2BDEA 2G0UA 4ANJA 2VB6A 4CN1A 2CEAA 4HFCA 5LHIB 4P0BA 3KV6A 4IG7A 2X9YA 1QLBA 4BJNA 5C2TA 2A72A 3K3NA 1I94T 3WAJA 4X62T 1H7CA 2D9DA 2WS3A 2X51A 4AI6A 3SFEA 5ABEA 2KXPB 2ZM6T 2H7VC 2I6HA 1ZP0A 4HWIB 4GYSA 4HFDA 4JV5T 3L39A 3NRYA 1VOMA 3K3QC 2PG8A 4TWHA 5AQNB 4TV9E 3AAAB 2HHHT 3ESLA 4AQFA 4AKGA 3RQWA 4LF7T 5L47A 3CX8B 2LKGA 4H9NC 3D0TA 4DR3T 3AAIA 2DCFA 4LFBT 3BQKA 4KI0F 4AXPA 2PJQA 3ONLC 4JLEA 5AQVB 1DU2A 4YFSA 3WI3A 4LF9T 4XBFB 1LVFA 3N9LA 4JKJA 3C4WA 2V8SV 3UULA 2N9DA 5HWXA 2JQHA 1XMQT 1HG5A 5IYZE 3O9XA 4H63H 3UU5A 3J9X1 3ABVA 4XAXB 3GN5A 4EB6E 1HR0T 5AQMB 1XNQT 4HWFA 3LG7A 5HXRA 3T8OA 3EDVA 2YKSA 4CXXA 4AQFC 3A7SA 1S94A 2NW9A 1S35A 3LK42 4B3TT 2VL8A 2WDQA 4DV7T 2D5UA 2A2FX 2X66A 1UX5A 5LGNB 4DO0A 3P4RA 3B13A 1W0BA 4P1NA 4CN4A 1D0YA 5FY7A 2XAHB 5JDNA 1O3XA 2MAWA 3ANWB 1I6ZA 5AQIB 2K5BB 4E7ZA 5CA0E 4OYJA 3LDQB 3ZYKA 2WMOA 3RLFF 1U4QA 5JQGE 4ZOLE 5TAOA 1N34T 3E08A 4DV4T 4L9IA 3N2KE 3C98B 4IDNA 2MOZA 3PUXF 1HS7A 2VURA 3HKCE 4TWDA 2ZM2A 4ILBA 5FL0A 2Q9QD 2D0TA 3BK9A 3QNUA 1ZHCA 4NIQA 2D2SA 2JRKA 2UXNB 2NWBA 3KVAA 3OYZA 2JQKA 3RF1A 4P09A 3UUMA 2E5VA 3SRZA 5L3BB 4O8SA 2IC6A 3EI0A 1IJ6A 1T72A 4PK5A 4UEMA 2MBGA 2W2UA 3N9OA 2UXXB 2X9XA 5CJ5A 1YW0A 5HXHA 2NW8A 4NPPA 4CI1B 1MMGA 3FZKB 5KDMC 2NP9A 4DV3T 2IIUA 5J0ZA 3AE5A 2WWVA 2Q9QB 2XZEA 2C5JA 2EHOC 2OA5A 2XAJB 2BZBA 4G2AA 3QB5K 4LF8T 3T1HT 2CWOA 4TUYE 4M1PA 5LG4A 2H88A 4NUUA 4JUYA 2LOPA 4QX8B 1WLXA 5L4EA 4EZ4A 5HEUA 3FZHB 1XDPA 3AEAA 3L8RA 5JRCA 1X79A 2HN1A 3B57A 4PFOA 4ZI2C 2V5CA 3X1DA 3N9MA 1SUMB 2M6BA 2XTLA 5FY0A 2CRBA 2LEHA 5H6QB 2BS3A 1VRBA 1Z8UA 1D1CA 3Q5WA 3IEEA 1KNRA 5JTGA 3QC9A 5AQHB 3W15B 2K3WA 1JNZA 1QSDA 3I0OA 4JI6T 5EK2A 4TX5A 3SFDA 3JAEA 4EGWA 4DR5T 3SOLA 2FJAA 3N5LA 3OJAA 2E2AA 4OFZA 3ZMSB 2ACXA 2CHOA 2XQ8A 2AE9A 4HWDA 4CI3B 4KP3C 5LMUT 3LK2B 3ZCJA 3ZT6A 4JYAT 1KF6A 2RP4A 3EDUA 5FNVE 5ABFA 2YU2A 2DWKA 2DL1A 4HKAA 3PJAA 4GIWA 4O4LE 4UV8B 4HFEA 4HGAA 2B76A 5HYAA 3SWHA 4C91A 3CQGB 3NKZA 3CPZA 4DBQA 1NEKA 2XQ4A 3MXZA 1CHUA 5DQWA 3LK3B 2MPKA 2CLYB 1M62A 4BJMA 1UURA 1MNEA 4WBNE 4UIGA 5L3CB 1KFYA 2HN2A 4DV6T 2E9XA 4LF6T 5L2LA 3KINB 1IZNB 2UUBT 4YSXA 2VQET 2WBLA 3TLTA 4O2AE 4TNWA 1IJ5A 2XHEB 4DUZT 4HWCA 3UU4A 4O4IE 1D0ZA 1ZOYA 3AAEB 4CZZB 5FMNA 2JIWA 2VKOA 4NXNT 3CK6A 4HFIA 1OXZA 2YINA 3L3PA 5AQUB 5LGUB 3UU3A 4JBWF 5L3GB 5CGMA 2DWGA 4UR9A 3FHNA 3CQXC 3O1HA 4QH1A 3UFGA 2QVAA 1KEYA 1WFDA 3GA8A 4KUMB 4LMJA 5LCYA 1XDOA 4XZCA 4HFVA 4IE5A 4EYUA 2WY2A 3PU3A 1Y64B 3IA3A 2QGSA 4LFAT 2N2NA 2XM1A 4YSZA 4KHZF 3ZMTB 4YJ3E 2L9QA 1OEDB 2L8KA 5F5WA 3ZJ1A 4HE8A 2WQYA 2LM2A 2I59A 2WP9A 2ES0A 1LVKA 1UCHA 5FXVA 4DV2T 4ZZBA 4KHPT 3P7IA 3M3ZB 2LOSA 2NW7A 3CWZB 4H9RC 3EUHA 4I55E 4YHHT 3PUVF 4E7SA 3VU7H 4ISTA 4Z90A 2UXCT 2VKDA 3FB2A 5EK3A 4AISA 1HCIA 1HNZT 2LSJA 4TNVA 2KZ7B 3ZSTA 5HEJA 1CUNA 3JC6C 2ZM0A 3CX7B 2DLRA 2B1EA 4LF4T 2X9WA 2V5DA 2LSYA 3HKDE 2YDRA 2V7KA 2K9AA 2ZM8A 2X0LB 3G06A 5DJQC 4F6RC 2C5KT 2BVLA 4TN7B 5ETWA 4CI2B 1FMVA 2V6YA 3PDYA 3O1IA 4N78D 4U7YA 3UFEA 1ZKEA 4TZ4C 4U3CA 3AVRA 4DR7T 3KV4A 1WR6A 2Y6XA 3AE3A 4FI5A 1X9BA 2IW5B 3KFWX 1IBLT 3OVUA 5LBMA 4MLKA 2YDQA 1BR4A 4DIDB 5BMVE 5DABA 3UUXB 4YXDA 4X65T 5LBQB 3UUBA 3KBUA 3GMIA 2VWAA 3E0ZA 4JI0T 5FYMA 3RKOA 2WAUA 4PNIA 4Q25A 3AECA 2CXFA 4IGUA 5FY1A 5JDLA 4GOUA 4QH5A 4QXBB 4ZZCA 3ZC0A 4O4JE 2X67A 3ZJ2A 5LB7B 3AE7A 2WDRA 4U74A 3KW5A 3ZT5A 3OBVE 3PUAA 4MBQA 4UF0A 4IREA 1E1HB 2H7OA 4IT4A 2Y48B 3GN5B 1VCTA 3V5SA 3Q9DA 5AQFB 2QYWA 4PK6A 4CQIA 5AQSB 3N2GE 2IC9A 3TLVA 4P0AA 3MA9A 3MZKB 4DM9A 2F4VT 4PAGA 2CM0A 2LJLA 2XQ3A 3C4ZA 5ABHA 2LENA 4CXWA 4QH4A 1IBKT 2WZIA 3A8YC 2VL0A 2J47A 1UK5A 2A3DA 2DNXA 3MJXA 4HN9A 1SE7A 3KV5A 5CB4E 2UU9T 3DP7A 3HKEE 3FXEB 1MIVA 2ODVA 4NUVA 3AEFA 4LFCT 3C64A 2JMKA 4IDQA 4AKLA 3OTOT 4H9PC 2BKNA 4JI7T 4PW8A 2EHOA 4H9QC 5HEHA 5JR9B 3L09A 3QOFA 1L0VA 2E5LT 2WWUA 4QWNB 3DTOA 3N2OA 2UXBT 5JH7E 4AKIA 4COFA 3RYCE 4IE6A 4H9SE 2CXLA 1JNRA 2FUPA 3CVRA 4IDPA 4O4HE 5HCJA 2WDVA 4ILAA 2XY8B 4DVDA 4PJNA 2Y8DA 5LP6E 2H3RA 1N32T 3PE0A 4Z8XA 5LNKA 3ZYMA 2CA5A 2P9BA 4TV8E 4MFRA 4B3ST 4NXMT 5H6RB 1MNDA 1D0XA 1LRZA 1W0AA 2UXDT 1KNPA 2VKHA 3C51A 1J5WA 1E2AA 5C3JA 4IDOA 4L0RA 3QB5A 3AE9A 5LGTB 5JRCB 3LBXA 4UVAB 3VR9A 3TB3A 5AQKB 3TLSA 1IBMT 2V7MA 1MMDA 2X9HA 1FJGT 1HX8A 2LM9A 3AXJA 2RPAA 2YDSA 5LG3A 2KMFA 2X68A 4OK0A 3AEDA 1YKHB 4BAYB 4IE0A 3ONJA 2XPKA 4B3RT 3AA6B 2J4GA 2KSRA 1T7SA 4A98A 2NR4A 4MHCA 3PUYF 5L3DB 3HKBE 1QUUA 2KINB 3K1SA 3QK6A 1D1BA 3Q5EA 2CWYA 5LJNA 1EZ3A 5HXEA 3ZN1B 2XUEA 3AEEA 2V1DB 2CXDA 4QKNA 5KMGP 4QXHB 1D1AA 4ZI3D 2Q9QC 1AJ3A 3RC8A 4IL4A 3HA4A 4X1KE 5ABFB 2E9XD 4EXTA 1BR0A 2LLYA 3C4XA 5AFUL 3P8CD 5JDGA 3FBLA 3ZN0B 3H3MA 3AEGA 1J5ET 3UU8A 2V7JA 2BBJA 4DUYT 3NVOA 2XQ6A 5L4HA 4ADZA 2OV9A 5EZYE 5IWAT 5AQPB 3O4XE 3IFWA 2E9XB 3ZC1A 4AIUA 3RPUA 3ZYLA 3LSVA 2JJ9A 3MK7C 5EK4A 1WYBA 5FXWA 3JAFA 3J7Yq 2N1GA 3AB3B 2QA7A 3FBZA 3N9NA 3RYIE 2UUCT 1XD3A 4YT0A 4K0UA 3RISA 1US7B 4EEDA 4K0KT 4YY3T 3TKLB 4X64T 4YTMA 4EV6A 3ZSSA 2KT9A 4PFPA 4PJJA 4L5GA 3IBPA 4I0UA 4AKHA 3AA7B 3RKGA 2XAFB 3NWIA 4ZI7E 3OYXA 5HXSA 5BR8T 2BKOA 2MYSA 2K24A 2LSGA 3UQ4A 1VCSA 5M4YA 3GWHA 3P4SA 2Z6EA 2AXDS 3AA1B 1YQ4A 1NENA 3UU6A 3NBXX 4MALA 5CFBA 4C90A 5HEOA 2BBHA 3PUZF 2V6XA 5LMNT 4ISSA 3I0QA 3RRWA 1Y01A 1OEDA 3AE6A 3H3AA 2CHNA 2LHNA 3PUSA 4U33A 3CX6B 3CIRA 4JI1T 3PTRB 1HNWT 2JPFA 4X1YE 2W67A 2YN6A 4WYVA 2BG9A 1ZV4X 5FVKA 1MIWA 4ZXLA 2WU2A 4EAHA 2M67A 3EHZA 2ODUA 1YKEB 3KVBA 4GYRA 1M7KA 2CPTA 4EZHA 5KXJA 4PK4A 3OKQA 2FJBA 5GONE 2VQFT 3RYHE 4DMVA 1OEDE 4GKJT 2V6YB 4ZEYA 4I43B 2RA1A 4IIJE 4B6XA 5LXTE 1SA0E 4JI3T 2LHRA 1LKXA 2BG9E 3PU8A 2BS2A 2LRLA 3NZQA 3SS1A 1OEDC 2HH7A 3VRAA 5AQLB 3M65A 5C8YE 4QX7B 2XQYA 1WCRA 2BG9C 2DI4A 3N9QA 3RC3A 4I50E 2IMLA 2ACZA 3PURA 4HTEA 3ZMZB 3B5MA 2WB5A 3ZKRA 4ZS2A 2V26A 4JEUB 3RQUA 3IRTA 4V1Av 2VVNA 4JI5T 3Q5DA 1HNXT 3R6NA 4B3MT 4UF0B 5J2UE 4DV5T 1UGOA 2KWHA 1KNZA 3UUNA 5AQQB 1FEWA 4CN6A 4JEHB 4AQGA 5LOVE 4IE7A 4OYKA 3P4QA 1YD8G 2FJEA 2CBJA 1NAFA 5FVLA 1WYCA 1G73A 3I9WA 2V7IA 2IUBA 3RX6A 4I6NA 1FMWA 3ETUA
chains in the Genus database with same CATH topology
3U78A 5DQWA 2GK9A 3LK3B 3NRXA 3ZEFB 2CLYB 3LFMA 4BJMA 2VKHA 1BR2A 3C51A 2C0SA 5HXCA 3HR0A 1MNEA 3MACA 3C50A 2EHOD 4GK0E 4WBNE 5L3EB 3RH3A 2J1DG 4UVCB 2LE8A 4UIGA 4IE4A 5L3CB 3IF8B 3HL6A 4L0RA 5LYJE 3BQIA 2W0GA 5LGTB 5JREA 2E9XA 3KV9A 5LJMA 4DBRA 5JRCB 5L2LA 3LBXA 1G8XA 4UVAB 3TB3A 5F3JA 3KINB 1IZNB 1HTJF 2V7MA 1MMDA 2X9HA 4WBOA 3VHLA 2WBLA 2LSKA 1B7TA 2W63A 1HX8A 2XASB 2LM9A 4O2AE 4EOZB 3RIIA 5JDMA 4DNDA 2HPJA 2NTXA 1WRDA 2W62A 4AKRB 1IJ5A 2XHEB 2IAKA 2JQQA 2ZLYA 2KMFA 2X68A 4OK0A 3WAKA 2BDEA 2G0UA 4ANJA 2VB6A 4WW0A 2CEAA 1YKHB 4H9OC 4O4IE 5LHIB 1D0ZA 4P0BA 3AAEB 3KV6A 4BAYB 4CZZB 4IE0A 4IG7A 5FMNA 4ZI2D 2X9YA 2VKOA 2EHOB 5ADXL 4BJNA 3AA6B 2A72A 1OXZA 2YINA 3K3NA 3L3PA 5JVDE 3WAJA 1H7CA 4UXNB 5LGUB 2CMRA 2X51A 3ZLIA 5L3GB 4MHCA 4AI6A 2DWGA 3ANWA 3FHNA 3CQXC 3VKHA 3O1HA 2KXPB 5L3DB 3HKBE 1QUUA 2H7VC 2KINB 3QK6A 2PBIA 3GA8A 2C5IT 1D1BA 4GYSA 4KUMB 4DMWA 2CWYA 5LCYA 5LJNA 3NRYA 1VOMA 4XZCA 1EZ3A 4HFVA 3ZMVB 5HXEA 3ZN1B 2XUEA 4IE5A 4EYUA 3K3QC 3R84B 2V1DB 2PG8A 2CXDA 3PU3A 1Y64B 3DJBA 4QKNA 5KMGP 4QXHB 3U3IA 2QGSA 4G63A 4TV9E 2N2NA 1D1AA 4UELA 3AAAB 5JDFA 3ESLA 4AQFA 4ZI3D 4AKGA 1T98A 3ZMTB 2Q9QC 1AJ3A 4YJ3E 5JR9A 2L9QA 3CX8B 3RC8A 3HI2A 4QXCB 4H9NC 1ZEEA 3HA4A 2L8KA 4EYYR 3ZJ1A 4X1KE 4HE8A 3D0TA 3I9YA 3AAIA 2DCFA 2E9XD 2I59A 4EXTA 2ES0A 3BQKA 2W61A 1BR0A 1LVKA 4AXPA 2PJQA 1UCHA 4JLEA 5FXVA 3C4XA 1V9DA 5AFUL 3P8CD 2ZMAA 3P7IA 4YFSA 5JDGA 3WI3A 4XBFB 2LOSA 3FBLA 1LVFA 3ZN0B 3N9LA 2NW7A 4JKJA 4EIWA 2W00A 3C4WA 2L3LA 3CWZB 4H9RC 3EUHA 3UULA 2N9DA 4I55E 5HWXA 2V7JA 4J2CA 5LA6E 2YK0A 4E7SA 3VU7H 1HG5A 4ISTA 5IYZE 4ADZA 3O9XA 1Z0PA 2VKDA 3FB2A 5J2TE 3NZPA 4H63H 5EK3A 1HCIA 4ZS3A 2LSJA 1MMNA 3J9X1 2KZ7B 3F31A 2VKJA 4XAXB 5EZYE 3GN5A 1CUNA 3JC6C 2ZM0A 4EB6E 3I1AA 1CMXA 3CX7B 2VASA 3O4XE 3IFWA 2E9XB 2DLRA 2B1EA 1MIYA 3LBXB 2X9WA 3ZC1A 3ZPOA 3LG7A 5HXRA 3RPUA 3ZYLA 3KVFA 2JJ9A 2LSYA 3HKDE 3T8OA 4FJOA 3MK7C 3EDVA 2Q9QA 4CXXA 5EK4A 2V7KA 1WYBA 5FXWA 1SHZC 2K9AA 3ONXA 2BVMA 4AQFC 3J7Yq 5FP3A 3A7SA 1S94A 2N1GA 4X20E 5IHYA 2ZM8A 5JR9C 3AB3B 4PJLA 2NW9A 1S35A 3F2EA 4UV9B 2X0LB 2QA7A 5DJQC 4F6RC 3KBTA 3LK42 3FBZA 2C5KT 5HWYA 2BVLA 4KBMB 3N9NA 1FIOA 2VL8A 4TN7B 2D5UA 3RYIE 2A2FX 1XD3A 2X66A 5HAXA 5ETWA 1UX5A 4CI2B 1FMVA 5LGNB 4DO0A 4ILUA 3B13A 3PDYA 3PUGA 3O1IA 4N78D 3UFEA 4K0UA 3RISA 1D0YA 5FY7A 2XAHB 5JDNA 1US7B 1ZKEA 4TZ4C 5J1GA 1O3XA 5DQVA 2WM9A 3AVRA 2KNDA 3ANWB 3TKLB 4IHJE 3KV4A 1WR6A 2K5BB 4E7ZA 2Y6XA 5CA0E 4FI5A 1IAPA 2KT9A 2IW5B 4OYJA 3KFWX 4PFPA 5LBMA 3ZYKA 4MLKA 4PJJA 2DHRA 4L5GA 4CXYA 2WMOA 3IBPA 2SPCA 4AKHA 3AA7B 2XAFB 4ZI7E 2XAGB 4QHOA 3OYXA 1BR4A 1U4QA 5HXSA 5JQGE 4HEAA 4ZOLE 5BMVE 5TAOA 3E08A 5DABA 4L9IA 3UUXB 4BA9A 3N2KE 3LJCA 2MYSA 3C98B 1OWAA 2K24A 2LSGA 3CQCB 5LBQB 2PFVA 3KBUA 3GMIA 2VWAA 2MOZA 2MTQA 3E0ZA 5M4YA 1HS7A 3GWHA 2Z6EA 5FYMA 3HKCE 1HF8A 2WAUA 3RKOA 2WSSV 4PNIA 4YHJA 3AA1B 2ZM2A 3Q2MA 2Q9QD 5L3FB 2CXFA 2D0TA 3NBXX 3BK9A 4MALA 4IGUA 3N9PA 5FY1A 1ZHCA 5JDLA 2D2SA 4GOUA 2JRKA 4C90A 4QXBB 1UCUA 3F57A 1KK7A 3ZC0A 4O4JE 2LSIA 2X67A 2UXNB 4ISSA 3I0QA 3ZJ2A 2NWBA 3KVAA 3OYZA 3RRWA 4U74A 3KW5A 4P09A 1HFAA 3OBVE 3ZMUB 3VKGA 2YEVC 3PUAA 4MBQA 3UUMA 4UF0A 2JMHA 5LHGB 3SRZA 3H3AA 5L3BB 4O8SA 1E1HB 2LHNA 3PUSA 2LT3A 3CX6B 1BR1A 2IC6A 2VK9A 1IJ6A 3IHRA 2H7OA 4OHFA 4PK5A 4UEMA 2MBGA 3N9OA 2UXXB 3PTRB 2X9XA 2Y48B 3GN5B 3V5SA 3Q9DA 4O2BE 1YW0A 2JPFA 4X1YE 5FXZA 5HXHA 2NW8A 4I4TE 2KLQA 4CI1B 1MMGA 5KDMC 2NP9A 1ZV4X 4PK6A 2CE7A 1MIWA 3O1JA 4CQIA 3N2GE 2IC9A 3ZCIA 4EAHA 4P0AA 3MA9A 3MZKB 4DM9A 2Q9QB 4PAGA 2M67A 2C5JA 2ODUA 2EHOC 2CM0A 2LJLA 2OA5A 1YKEB 3KVBA 5F8PA 3C4ZA 3JC6D 4GYRA 2XAJB 2BZBA 4G2AA 4EZHA 2LENA 4CXWA 1MMAA 2CWOA 4TUYE 4M1PA 1NWMX 4PK4A 5LG4A 4NUUA 1HG2A 4JUYA 3ETVA 2LOPA 3H37A 3OKQA 4QX8B 3V5UA 3UTKA 5GONE 2A3DA 3RYHE 1WLXA 2DNXA 3RYFE 2HPLA 4DMVA 3MJXA 4HN9A 4EZ4A 3FXDB 4I43B 2CCQA 3KV5A 4A56A 5CB4E 5JRCA 1X79A 2E8IA 3DP7A 2RA1A 5CA1E 2K48A 3HKEE 5KX5E 4IIJE 4B6XA 3AA0B 5LXTE 1SA0E 2KWIB 3FXEB 2LHRA 1LKXA 1MIVA 3B57A 2ODVA 3PU8A 4NUVA 4PFOA 4ZI2C 4PJMA 3C64A 3NZQA 3SS1A 3N9MA 2HH7A 4ERRA 4YJ2E 5JDHA 2JMKA 2XTLA 2NTYA 5FY0A 2LEHA 5H6QB 4AKLA 3CKDA 4H9PC 1VRBA 2D0UA 1D1CA 3Q5WA 3M65A 5C8YE 3IEEA 1UX4A 4QX7B 2XQYA 4ASKA 2DI4A 2ETLA 4PW8A 3N9QA 3QC9A 5JDQA 2EHOA 3W15B 3UT5E 4H9QC 3PUQA 1QSDA 3I0OA 3RC3A 4I50E 4ZHQE 5EK2A 3L09A 5JR9B 2V7LA 4TX5A 3S4UA 3PURA 4HTEA 2WWUA 1U5PA 3ZMZB 3SOLA 2WMNA 4QWNB 3DTOA 3N5LA 3OJAA 4ZI3C 5LHHB 2CLYC 4OFZA 3A5XA 3N2OA 4WNKA 4ZS2A 2V26A 5JH7E 3ZMSB 2ACXA 4JEUB 2XAQB 3KDSE 4AKIA 3RYCE 3IRTA 4V1Av 4IE6A 2E9XC 4H9SE 2CXLA 3RRCA 3R6NA 3EVYA 4CI3B 3CVRA 4KP3C 4UF0B 5J2UE 3LK2B 4O4HE 3QUJA 3ZCJA 4IDZA 2KWHA 4X1IE 1KNZA 2RP4A 3UUNA 3BQLA 4DVDA 3K3OA 4PJNA 1FEWA 3EDUA 3E22E 4JEHB 5E0OA 3AVSA 4AQGA 5FNVE 2Y8DA 5LOVE 5LP6E 4IE7A 2YU2A 2H3RA 4OYKA 2DWKA 2NOXA 4U72A 1YD8G 4HKAA 3CMLA 1NAFA 5A1LA 4GIWA 4UVBB 4O4LE 3PE0A 4H63V 4Z8XA 5LNKA 1WYCA 1G73A 3I9WA 4KMCA 4UV8B 2V7IA 3ZYMA 4HGAA 2CA5A 2P9BA 3RX6A 5HYAA 4TV8E 4MFRA 4I6NA 3SWHA 4C91A 2YU1A 1FMWA 3CQGB 3ETUA 3CPZA 3Q5XA 5H6RB 4DBQA 1MNDA 1D0XA 3K8PC 3MKDA 4YLHA 4GK5E 5FXXA 1LRZA 3MXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IG7 A;  3IHR A;  4UEM A;  3RIS A;  1UCH A;  2ETL A;  3RII A;  2LEN A;  3A7S A;  3IRT A;  4UEL A;  1CMX A;  4JKJ A;  3IFW A;  4I6N A;  3KW5 A;  1XD3 A;  4DM9 A;  3KVF A;  3TB3 A; 
#chains in the Genus database with same CATH topology
 3RIA A;  3U78 A;  3NRX A;  3ZEF B;  2WCA A;  3MAC A;  2EHO D;  4GK0 E;  4Z91 A;  5L3E B;  3RH3 A;  3VRB A;  4IE4 A;  3IF8 B;  3HL6 A;  3BQI A;  5AQT B;  5JRE A;  3KV9 A;  4DBR A;  3AEB A;  4ILC A;  3VHL A;  2LSK A;  1B7T A;  2W63 A;  5JDM A;  4DND A;  2HPJ A;  4IL9 A;  2XQ9 A;  3T1Y T;  2ZLY A;  3WAK A;  4WW0 A;  4H9O C;  3P4P A;  4ZI2 D;  5ADX L;  2EHO B;  4DR1 T;  2XM2 A;  5JVD E;  4UXN B;  2CMR A;  3ZLI A;  3ANW A;  3PUW F;  3VKH A;  5IUX A;  2PBI A;  2C5I T;  4DR2 T;  4DMW A;  4JI2 T;  4A97 A;  3ZMV B;  3R84 B;  3DJB A;  3U3I A;  2CBI A;  4G63 A;  3TLU A;  4JI4 T;  4UEL A;  5JDF A;  1XZY A;  1T98 A;  5JR9 A;  3HI2 A;  4QXC B;  1ZEE A;  4EYY R;  3P4W A;  3I9Y A;  1E7P A;  2W61 A;  3AE1 A;  1V9D A;  4DR4 T;  5HEG A;  2ZMA A;  5FL1 A;  2XJ7 A;  4EIW A;  2W00 A;  2L3L A;  3UQ7 A;  2IDO B;  4J2C A;  3AE2 A;  5LA6 E;  2YK0 A;  2BS4 A;  2LRK A;  1Z0P A;  5J2T E;  3NZP A;  3FZL B;  4HWH A;  4DV0 T;  4ZS3 A;  4YTN A;  2R6G F;  1MMN A;  3F31 A;  2VKJ A;  3EAB A;  3JAD A;  2H89 A;  3I1A A;  4A5X A;  1CMX A;  1T8B A;  4LML A;  2VAS A;  3LBX B;  1MIY A;  3ZPO A;  2FJD A;  2W66 A;  3KVF A;  4U2Y A;  3A7M A;  4FJO A;  2Q9Q A;  1SHZ C;  3AXJ B;  3ONX A;  2BVM A;  5FP3 A;  4X20 E;  5IHY A;  3RI5 A;  5JR9 C;  4PJL A;  3F2E A;  4UV9 B;  2PTF A;  3KBT A;  5HWY A;  4KBM B;  4LMK A;  1FIO A;  5HAX A;  3JCF A;  4ILU A;  3PUG A;  4OX9 T;  5J1G A;  5DQV A;  4DV1 T;  2WM9 A;  2KND A;  4IHJ E;  4U31 A;  2X0Y A;  1J1J A;  1IAP A;  2DHR A;  4CXY A;  2SPC A;  4U7I A;  2XAG B;  4QHO A;  4HEA A;  4BA9 A;  3LJC A;  5AQG B;  1OWA A;  3CQC B;  2PFV A;  2MTQ A;  3AE4 A;  2X0H A;  2XSA A;  1HF8 A;  4X66 T;  2WSS V;  4YHJ A;  1N36 T;  1WR0 A;  3Q2M A;  5L3F B;  4YTP A;  3N9P A;  1W9R A;  4JI8 T;  1UCU A;  2LKH A;  3F57 A;  1KK7 A;  2LSI A;  5FKY A;  2I0M A;  1HFA A;  3ZMU B;  3VKG A;  2YEV C;  2JMH A;  5LHG B;  2UUA T;  1YQ3 A;  2VVS A;  2LT3 A;  4OHF A;  1BR1 A;  2VK9 A;  3IHR A;  1XNR T;  4O2B E;  5FXZ A;  4I4T E;  2KLQ A;  2CE7 A;  3O1J A;  3ZCI A;  3RIU A;  2XQ7 A;  5F8P A;  3JC6 D;  3AE8 A;  2XQ5 A;  1MMA A;  1NWM X;  1W09 A;  3TLW A;  1HG2 A;  3ETV A;  3H37 A;  3V5U A;  3UTK A;  3RYF E;  2HPL A;  2JQ9 A;  3FXD B;  2CCQ A;  4A56 A;  4AQY T;  2E8I A;  5CA1 E;  2K48 A;  5KX5 E;  3AA0 B;  3PJA J;  2KWI B;  1GQE A;  4WZX A;  4YSY A;  4PJM A;  4ERR A;  4YJ2 E;  5JDH A;  2NTY A;  3CKD A;  2IHR 1;  5ABG A;  2WZH A;  4TWF A;  2D0U A;  3RGL A;  5AQJ B;  1UX4 A;  4ASK A;  5AQO B;  2ETL A;  3RIF A;  5JDQ A;  3UT5 E;  3PUQ A;  3PV0 F;  4ZHQ E;  2OLT A;  2V7L A;  3RIU C;  4EEB A;  3S4U A;  1HX1 B;  4GKK T;  1U5P A;  2M6I A;  2WMN A;  2J62 A;  2YOE A;  1XWM A;  4ZI3 C;  5LHH B;  2CLY C;  1YXR A;  3A5X A;  2WU5 A;  4WNK A;  3VR8 A;  2XAQ B;  3KDS E;  2XSB A;  3OPC A;  2A9U A;  2E9X C;  3RRC A;  2BKP A;  3EVY A;  3QUJ A;  3P50 A;  4IDZ A;  4X1I E;  3BQL A;  4HFB A;  3K3O A;  2QRX A;  4KX6 A;  3E22 E;  5E0O A;  2FBW A;  3AVS A;  1N33 T;  4LF5 T;  2NOX A;  4U72 A;  2BG9 B;  4DR6 T;  3CML A;  5A1L A;  4UVB B;  4H63 V;  4KMC A;  3FZM B;  2YU1 A;  3Q5X A;  3K8P C;  4YLH A;  3MKD A;  5FXX A;  4GK5 E;  3FZF B;  2GK9 A;  3LFM A;  1BR2 A;  4X5T A;  2C0S A;  5HXC A;  3HR0 A;  3C50 A;  2J1D G;  4UVC B;  2LE8 A;  2W4X A;  5LYJ E;  2W0G A;  5LJM A;  1G8X A;  1UUS A;  4F8H A;  5F3J A;  1XMO T;  1HTJ F;  1R8I A;  2XQA A;  4WBO A;  2XAS B;  4EOZ B;  3RII A;  4HFH A;  3ZT7 A;  3RHW A;  2NTX A;  1WRD A;  4U2Z A;  2W62 A;  4AKR B;  5HCM A;  3EAM A;  2IAK A;  2JQQ A;  5AQR B;  2BDE A;  2G0U A;  4ANJ A;  2VB6 A;  4CN1 A;  2CEA A;  4HFC A;  5LHI B;  4P0B A;  3KV6 A;  4IG7 A;  2X9Y A;  1QLB A;  4BJN A;  5C2T A;  2A72 A;  3K3N A;  1I94 T;  3WAJ A;  4X62 T;  1H7C A;  2D9D A;  2WS3 A;  2X51 A;  4AI6 A;  3SFE A;  5ABE A;  2KXP B;  2ZM6 T;  2H7V C;  2I6H A;  1ZP0 A;  4HWI B;  4GYS A;  4HFD A;  4JV5 T;  3L39 A;  3NRY A;  1VOM A;  3K3Q C;  2PG8 A;  4TWH A;  5AQN B;  4TV9 E;  3AAA B;  2HHH T;  3ESL A;  4AQF A;  4AKG A;  3RQW A;  4LF7 T;  5L47 A;  3CX8 B;  2LKG A;  4H9N C;  3D0T A;  4DR3 T;  3AAI A;  2DCF A;  4LFB T;  3BQK A;  4KI0 F;  4AXP A;  2PJQ A;  3ONL C;  4JLE A;  5AQV B;  1DU2 A;  4YFS A;  3WI3 A;  4LF9 T;  4XBF B;  1LVF A;  3N9L A;  4JKJ A;  3C4W A;  2V8S V;  3UUL A;  2N9D A;  5HWX A;  2JQH A;  1XMQ T;  1HG5 A;  5IYZ E;  3O9X A;  4H63 H;  3UU5 A;  3J9X 1;  3ABV A;  4XAX B;  3GN5 A;  4EB6 E;  1HR0 T;  5AQM B;  1XNQ T;  4HWF A;  3LG7 A;  5HXR A;  3T8O A;  3EDV A;  2YKS A;  4CXX A;  4AQF C;  3A7S A;  1S94 A;  2NW9 A;  1S35 A;  3LK4 2;  4B3T T;  2VL8 A;  2WDQ A;  4DV7 T;  2D5U A;  2A2F X;  2X66 A;  1UX5 A;  5LGN B;  4DO0 A;  3P4R A;  3B13 A;  1W0B A;  4P1N A;  4CN4 A;  1D0Y A;  5FY7 A;  2XAH B;  5JDN A;  1O3X A;  2MAW A;  3ANW B;  1I6Z A;  5AQI B;  2K5B B;  4E7Z A;  5CA0 E;  4OYJ A;  3LDQ B;  3ZYK A;  2WMO A;  3RLF F;  1U4Q A;  5JQG E;  4ZOL E;  5TAO A;  1N34 T;  3E08 A;  4DV4 T;  4L9I A;  3N2K E;  3C98 B;  4IDN A;  2MOZ A;  3PUX F;  1HS7 A;  2VUR A;  3HKC E;  4TWD A;  2ZM2 A;  4ILB A;  5FL0 A;  2Q9Q D;  2D0T A;  3BK9 A;  3QNU A;  1ZHC A;  4NIQ A;  2D2S A;  2JRK A;  2UXN B;  2NWB A;  3KVA A;  3OYZ A;  2JQK A;  3RF1 A;  4P09 A;  3UUM A;  2E5V A;  3SRZ A;  5L3B B;  4O8S A;  2IC6 A;  3EI0 A;  1IJ6 A;  1T72 A;  4PK5 A;  4UEM A;  2MBG A;  2W2U A;  3N9O A;  2UXX B;  2X9X A;  5CJ5 A;  1YW0 A;  5HXH A;  2NW8 A;  4NPP A;  4CI1 B;  1MMG A;  3FZK B;  5KDM C;  2NP9 A;  4DV3 T;  2IIU A;  5J0Z A;  3AE5 A;  2WWV A;  2Q9Q B;  2XZE A;  2C5J A;  2EHO C;  2OA5 A;  2XAJ B;  2BZB A;  4G2A A;  3QB5 K;  4LF8 T;  3T1H T;  2CWO A;  4TUY E;  4M1P A;  5LG4 A;  2H88 A;  4NUU A;  4JUY A;  2LOP A;  4QX8 B;  1WLX A;  5L4E A;  4EZ4 A;  5HEU A;  3FZH B;  1XDP A;  3AEA A;  3L8R A;  5JRC A;  1X79 A;  2HN1 A;  3B57 A;  4PFO A;  4ZI2 C;  2V5C A;  3X1D A;  3N9M A;  1SUM B;  2M6B A;  2XTL A;  5FY0 A;  2CRB A;  2LEH A;  5H6Q B;  2BS3 A;  1VRB A;  1Z8U A;  1D1C A;  3Q5W A;  3IEE A;  1KNR A;  5JTG A;  3QC9 A;  5AQH B;  3W15 B;  2K3W A;  1JNZ A;  1QSD A;  3I0O A;  4JI6 T;  5EK2 A;  4TX5 A;  3SFD A;  3JAE A;  4EGW A;  4DR5 T;  3SOL A;  2FJA A;  3N5L A;  3OJA A;  2E2A A;  4OFZ A;  3ZMS B;  2ACX A;  2CHO A;  2XQ8 A;  2AE9 A;  4HWD A;  4CI3 B;  4KP3 C;  5LMU T;  3LK2 B;  3ZCJ A;  3ZT6 A;  4JYA T;  1KF6 A;  2RP4 A;  3EDU A;  5FNV E;  5ABF A;  2YU2 A;  2DWK A;  2DL1 A;  4HKA A;  3PJA A;  4GIW A;  4O4L E;  4UV8 B;  4HFE A;  4HGA A;  2B76 A;  5HYA A;  3SWH A;  4C91 A;  3CQG B;  3NKZ A;  3CPZ A;  4DBQ A;  1NEK A;  2XQ4 A;  3MXZ A;  1CHU A;  5DQW A;  3LK3 B;  2MPK A;  2CLY B;  1M62 A;  4BJM A;  1UUR A;  1MNE A;  4WBN E;  4UIG A;  5L3C B;  1KFY A;  2HN2 A;  4DV6 T;  2E9X A;  4LF6 T;  5L2L A;  3KIN B;  1IZN B;  2UUB T;  4YSX A;  2VQE T;  2WBL A;  3TLT A;  4O2A E;  4TNW A;  1IJ5 A;  2XHE B;  4DUZ T;  4HWC A;  3UU4 A;  4O4I E;  1D0Z A;  1ZOY A;  3AAE B;  4CZZ B;  5FMN A;  2JIW A;  2VKO A;  4NXN T;  3CK6 A;  4HFI A;  1OXZ A;  2YIN A;  3L3P A;  5AQU B;  5LGU B;  3UU3 A;  4JBW F;  5L3G B;  5CGM A;  2DWG A;  4UR9 A;  3FHN A;  3CQX C;  3O1H A;  4QH1 A;  3UFG A;  2QVA A;  1KEY A;  1WFD A;  3GA8 A;  4KUM B;  4LMJ A;  5LCY A;  1XDO A;  4XZC A;  4HFV A;  4IE5 A;  4EYU A;  2WY2 A;  3PU3 A;  1Y64 B;  3IA3 A;  2QGS A;  4LFA T;  2N2N A;  2XM1 A;  4YSZ A;  4KHZ F;  3ZMT B;  4YJ3 E;  2L9Q A;  1OED B;  2L8K A;  5F5W A;  3ZJ1 A;  4HE8 A;  2WQY A;  2LM2 A;  2I59 A;  2WP9 A;  2ES0 A;  1LVK A;  1UCH A;  5FXV A;  4DV2 T;  4ZZB A;  4KHP T;  3P7I A;  3M3Z B;  2LOS A;  2NW7 A;  3CWZ B;  4H9R C;  3EUH A;  4I55 E;  4YHH T;  3PUV F;  4E7S A;  3VU7 H;  4IST A;  4Z90 A;  2UXC T;  2VKD A;  3FB2 A;  5EK3 A;  4AIS A;  1HCI A;  1HNZ T;  2LSJ A;  4TNV A;  2KZ7 B;  3ZST A;  5HEJ A;  1CUN A;  3JC6 C;  2ZM0 A;  3CX7 B;  2DLR A;  2B1E A;  4LF4 T;  2X9W A;  2V5D A;  2LSY A;  3HKD E;  2YDR A;  2V7K A;  2K9A A;  2ZM8 A;  2X0L B;  3G06 A;  5DJQ C;  4F6R C;  2C5K T;  2BVL A;  4TN7 B;  5ETW A;  4CI2 B;  1FMV A;  2V6Y A;  3PDY A;  3O1I A;  4N78 D;  4U7Y A;  3UFE A;  1ZKE A;  4TZ4 C;  4U3C A;  3AVR A;  4DR7 T;  3KV4 A;  1WR6 A;  2Y6X A;  3AE3 A;  4FI5 A;  1X9B A;  2IW5 B;  3KFW X;  1IBL T;  3OVU A;  5LBM A;  4MLK A;  2YDQ A;  1BR4 A;  4DID B;  5BMV E;  5DAB A;  3UUX B;  4YXD A;  4X65 T;  5LBQ B;  3UUB A;  3KBU A;  3GMI A;  2VWA A;  3E0Z A;  4JI0 T;  5FYM A;  3RKO A;  2WAU A;  4PNI A;  4Q25 A;  3AEC A;  2CXF A;  4IGU A;  5FY1 A;  5JDL A;  4GOU A;  4QH5 A;  4QXB B;  4ZZC A;  3ZC0 A;  4O4J E;  2X67 A;  3ZJ2 A;  5LB7 B;  3AE7 A;  2WDR A;  4U74 A;  3KW5 A;  3ZT5 A;  3OBV E;  3PUA A;  4MBQ A;  4UF0 A;  4IRE A;  1E1H B;  2H7O A;  4IT4 A;  2Y48 B;  3GN5 B;  1VCT A;  3V5S A;  3Q9D A;  5AQF B;  2QYW A;  4PK6 A;  4CQI A;  5AQS B;  3N2G E;  2IC9 A;  3TLV A;  4P0A A;  3MA9 A;  3MZK B;  4DM9 A;  2F4V T;  4PAG A;  2CM0 A;  2LJL A;  2XQ3 A;  3C4Z A;  5ABH A;  2LEN A;  4CXW A;  4QH4 A;  1IBK T;  2WZI A;  3A8Y C;  2VL0 A;  2J47 A;  1UK5 A;  2A3D A;  2DNX A;  3MJX A;  4HN9 A;  1SE7 A;  3KV5 A;  5CB4 E;  2UU9 T;  3DP7 A;  3HKE E;  3FXE B;  1MIV A;  2ODV A;  4NUV A;  3AEF A;  4LFC T;  3C64 A;  2JMK A;  4IDQ A;  4AKL A;  3OTO T;  4H9P C;  2BKN A;  4JI7 T;  4PW8 A;  2EHO A;  4H9Q C;  5HEH A;  5JR9 B;  3L09 A;  3QOF A;  1L0V A;  2E5L T;  2WWU A;  4QWN B;  3DTO A;  3N2O A;  2UXB T;  5JH7 E;  4AKI A;  4COF A;  3RYC E;  4IE6 A;  4H9S E;  2CXL A;  1JNR A;  2FUP A;  3CVR A;  4IDP A;  4O4H E;  5HCJ A;  2WDV A;  4ILA A;  2XY8 B;  4DVD A;  4PJN A;  2Y8D A;  5LP6 E;  2H3R A;  1N32 T;  3PE0 A;  4Z8X A;  5LNK A;  3ZYM A;  2CA5 A;  2P9B A;  4TV8 E;  4MFR A;  4B3S T;  4NXM T;  5H6R B;  1MND A;  1D0X A;  1LRZ A;  1W0A A;  2UXD T;  1KNP A;  2VKH A;  3C51 A;  1J5W A;  1E2A A;  5C3J A;  4IDO A;  4L0R A;  3QB5 A;  3AE9 A;  5LGT B;  5JRC B;  3LBX A;  4UVA B;  3VR9 A;  3TB3 A;  5AQK B;  3TLS A;  1IBM T;  2V7M A;  1MMD A;  2X9H A;  1FJG T;  1HX8 A;  2LM9 A;  3AXJ A;  2RPA A;  2YDS A;  5LG3 A;  2KMF A;  2X68 A;  4OK0 A;  3AED A;  1YKH B;  4BAY B;  4IE0 A;  3ONJ A;  2XPK A;  4B3R T;  3AA6 B;  2J4G A;  2KSR A;  1T7S A;  4A98 A;  2NR4 A;  4MHC A;  3PUY F;  5L3D B;  3HKB E;  1QUU A;  2KIN B;  3K1S A;  3QK6 A;  1D1B A;  3Q5E A;  2CWY A;  5LJN A;  1EZ3 A;  5HXE A;  3ZN1 B;  2XUE A;  3AEE A;  2V1D B;  2CXD A;  4QKN A;  5KMG P;  4QXH B;  1D1A A;  4ZI3 D;  2Q9Q C;  1AJ3 A;  3RC8 A;  4IL4 A;  3HA4 A;  4X1K E;  5ABF B;  2E9X D;  4EXT A;  1BR0 A;  2LLY A;  3C4X A;  5AFU L;  3P8C D;  5JDG A;  3FBL A;  3ZN0 B;  3H3M A;  3AEG A;  1J5E T;  3UU8 A;  2V7J A;  2BBJ A;  4DUY T;  3NVO A;  2XQ6 A;  5L4H A;  4ADZ A;  2OV9 A;  5EZY E;  5IWA T;  5AQP B;  3O4X E;  3IFW A;  2E9X B;  3ZC1 A;  4AIU A;  3RPU A;  3ZYL A;  3LSV A;  2JJ9 A;  3MK7 C;  5EK4 A;  1WYB A;  5FXW A;  3JAF A;  3J7Y q;  2N1G A;  3AB3 B;  2QA7 A;  3FBZ A;  3N9N A;  3RYI E;  2UUC T;  1XD3 A;  4YT0 A;  4K0U A;  3RIS A;  1US7 B;  4EED A;  4K0K T;  4YY3 T;  3TKL B;  4X64 T;  4YTM A;  4EV6 A;  3ZSS A;  2KT9 A;  4PFP A;  4PJJ A;  4L5G A;  3IBP A;  4I0U A;  4AKH A;  3AA7 B;  3RKG A;  2XAF B;  3NWI A;  4ZI7 E;  3OYX A;  5HXS A;  5BR8 T;  2BKO A;  2MYS A;  2K24 A;  2LSG A;  3UQ4 A;  1VCS A;  5M4Y A;  3GWH A;  3P4S A;  2Z6E A;  2AXD S;  3AA1 B;  1YQ4 A;  1NEN A;  3UU6 A;  3NBX X;  4MAL A;  5CFB A;  4C90 A;  5HEO A;  2BBH A;  3PUZ F;  2V6X A;  5LMN T;  4ISS A;  3I0Q A;  3RRW A;  1Y01 A;  1OED A;  3AE6 A;  3H3A A;  2CHN A;  2LHN A;  3PUS A;  4U33 A;  3CX6 B;  3CIR A;  4JI1 T;  3PTR B;  1HNW T;  2JPF A;  4X1Y E;  2W67 A;  2YN6 A;  4WYV A;  2BG9 A;  1ZV4 X;  5FVK A;  1MIW A;  4ZXL A;  2WU2 A;  4EAH A;  2M67 A;  3EHZ A;  2ODU A;  1YKE B;  3KVB A;  4GYR A;  1M7K A;  2CPT A;  4EZH A;  5KXJ A;  4PK4 A;  3OKQ A;  2FJB A;  5GON E;  2VQF T;  3RYH E;  4DMV A;  1OED E;  4GKJ T;  2V6Y B;  4ZEY A;  4I43 B;  2RA1 A;  4IIJ E;  4B6X A;  5LXT E;  1SA0 E;  4JI3 T;  2LHR A;  1LKX A;  2BG9 E;  3PU8 A;  2BS2 A;  2LRL A;  3NZQ A;  3SS1 A;  1OED C;  2HH7 A;  3VRA A;  5AQL B;  3M65 A;  5C8Y E;  4QX7 B;  2XQY A;  1WCR A;  2BG9 C;  2DI4 A;  3N9Q A;  3RC3 A;  4I50 E;  2IML A;  2ACZ A;  3PUR A;  4HTE A;  3ZMZ B;  3B5M A;  2WB5 A;  3ZKR A;  4ZS2 A;  2V26 A;  4JEU B;  3RQU A;  3IRT A;  4V1A v;  2VVN A;  4JI5 T;  3Q5D A;  1HNX T;  3R6N A;  4B3M T;  4UF0 B;  5J2U E;  4DV5 T;  1UGO A;  2KWH A;  1KNZ A;  3UUN A;  5AQQ B;  1FEW A;  4CN6 A;  4JEH B;  4AQG A;  5LOV E;  4IE7 A;  4OYK A;  3P4Q A;  1YD8 G;  2FJE A;  2CBJ A;  1NAF A;  5FVL A;  1WYC A;  1G73 A;  3I9W A;  2V7I A;  2IUB A;  3RX6 A;  4I6N A;  1FMW A;  3ETU A; 
#chains in the Genus database with same CATH homology
 3U78 A;  5DQW A;  2GK9 A;  3LK3 B;  3NRX A;  3ZEF B;  2CLY B;  3LFM A;  4BJM A;  2VKH A;  1BR2 A;  3C51 A;  2C0S A;  5HXC A;  3HR0 A;  1MNE A;  3MAC A;  3C50 A;  2EHO D;  4GK0 E;  4WBN E;  5L3E B;  3RH3 A;  2J1D G;  4UVC B;  2LE8 A;  4UIG A;  4IE4 A;  5L3C B;  3IF8 B;  3HL6 A;  4L0R A;  5LYJ E;  3BQI A;  2W0G A;  5LGT B;  5JRE A;  2E9X A;  3KV9 A;  5LJM A;  4DBR A;  5JRC B;  5L2L A;  3LBX A;  1G8X A;  4UVA B;  3TB3 A;  5F3J A;  3KIN B;  1IZN B;  1HTJ F;  2V7M A;  1MMD A;  2X9H A;  4WBO A;  3VHL A;  2WBL A;  2LSK A;  1B7T A;  2W63 A;  1HX8 A;  2XAS B;  2LM9 A;  4O2A E;  4EOZ B;  3RII A;  5JDM A;  4DND A;  2HPJ A;  2NTX A;  1WRD A;  2W62 A;  4AKR B;  1IJ5 A;  2XHE B;  2IAK A;  2JQQ A;  2ZLY A;  2KMF A;  2X68 A;  4OK0 A;  3WAK A;  2BDE A;  2G0U A;  4ANJ A;  2VB6 A;  4WW0 A;  2CEA A;  1YKH B;  4H9O C;  4O4I E;  5LHI B;  1D0Z A;  4P0B A;  3AAE B;  3KV6 A;  4BAY B;  4CZZ B;  4IE0 A;  4IG7 A;  5FMN A;  4ZI2 D;  2X9Y A;  2VKO A;  2EHO B;  5ADX L;  4BJN A;  3AA6 B;  2A72 A;  1OXZ A;  2YIN A;  3K3N A;  3L3P A;  5JVD E;  3WAJ A;  1H7C A;  4UXN B;  5LGU B;  2CMR A;  2X51 A;  3ZLI A;  5L3G B;  4MHC A;  4AI6 A;  2DWG A;  3ANW A;  3FHN A;  3CQX C;  3VKH A;  3O1H A;  2KXP B;  5L3D B;  3HKB E;  1QUU A;  2H7V C;  2KIN B;  3QK6 A;  2PBI A;  3GA8 A;  2C5I T;  1D1B A;  4GYS A;  4KUM B;  4DMW A;  2CWY A;  5LCY A;  5LJN A;  3NRY A;  1VOM A;  4XZC A;  1EZ3 A;  4HFV A;  3ZMV B;  5HXE A;  3ZN1 B;  2XUE A;  4IE5 A;  4EYU A;  3K3Q C;  3R84 B;  2V1D B;  2PG8 A;  2CXD A;  3PU3 A;  1Y64 B;  3DJB A;  4QKN A;  5KMG P;  4QXH B;  3U3I A;  2QGS A;  4G63 A;  4TV9 E;  2N2N A;  1D1A A;  4UEL A;  3AAA B;  5JDF A;  3ESL A;  4AQF A;  4ZI3 D;  4AKG A;  1T98 A;  3ZMT B;  2Q9Q C;  1AJ3 A;  4YJ3 E;  5JR9 A;  2L9Q A;  3CX8 B;  3RC8 A;  3HI2 A;  4QXC B;  4H9N C;  1ZEE A;  3HA4 A;  2L8K A;  4EYY R;  3ZJ1 A;  4X1K E;  4HE8 A;  3D0T A;  3I9Y A;  3AAI A;  2DCF A;  2E9X D;  2I59 A;  4EXT A;  2ES0 A;  3BQK A;  2W61 A;  1BR0 A;  1LVK A;  4AXP A;  2PJQ A;  1UCH A;  4JLE A;  5FXV A;  3C4X A;  1V9D A;  5AFU L;  3P8C D;  2ZMA A;  3P7I A;  4YFS A;  5JDG A;  3WI3 A;  4XBF B;  2LOS A;  3FBL A;  1LVF A;  3ZN0 B;  3N9L A;  2NW7 A;  4JKJ A;  4EIW A;  2W00 A;  3C4W A;  2L3L A;  3CWZ B;  4H9R C;  3EUH A;  3UUL A;  2N9D A;  4I55 E;  5HWX A;  2V7J A;  4J2C A;  5LA6 E;  2YK0 A;  4E7S A;  3VU7 H;  1HG5 A;  4IST A;  5IYZ E;  4ADZ A;  3O9X A;  1Z0P A;  2VKD A;  3FB2 A;  5J2T E;  3NZP A;  4H63 H;  5EK3 A;  1HCI A;  4ZS3 A;  2LSJ A;  1MMN A;  3J9X 1;  2KZ7 B;  3F31 A;  2VKJ A;  4XAX B;  5EZY E;  3GN5 A;  1CUN A;  3JC6 C;  2ZM0 A;  4EB6 E;  3I1A A;  1CMX A;  3CX7 B;  2VAS A;  3O4X E;  3IFW A;  2E9X B;  2DLR A;  2B1E A;  1MIY A;  3LBX B;  2X9W A;  3ZC1 A;  3ZPO A;  3LG7 A;  5HXR A;  3RPU A;  3ZYL A;  3KVF A;  2JJ9 A;  2LSY A;  3HKD E;  3T8O A;  4FJO A;  3MK7 C;  3EDV A;  2Q9Q A;  4CXX A;  5EK4 A;  2V7K A;  1WYB A;  5FXW A;  1SHZ C;  2K9A A;  3ONX A;  2BVM A;  4AQF C;  3J7Y q;  5FP3 A;  3A7S A;  1S94 A;  2N1G A;  4X20 E;  5IHY A;  2ZM8 A;  5JR9 C;  3AB3 B;  4PJL A;  2NW9 A;  1S35 A;  3F2E A;  4UV9 B;  2X0L B;  2QA7 A;  5DJQ C;  4F6R C;  3KBT A;  3LK4 2;  3FBZ A;  2C5K T;  5HWY A;  2BVL A;  4KBM B;  3N9N A;  1FIO A;  2VL8 A;  4TN7 B;  2D5U A;  3RYI E;  2A2F X;  1XD3 A;  2X66 A;  5HAX A;  5ETW A;  1UX5 A;  4CI2 B;  1FMV A;  5LGN B;  4DO0 A;  4ILU A;  3B13 A;  3PDY A;  3PUG A;  3O1I A;  4N78 D;  3UFE A;  4K0U A;  3RIS A;  1D0Y A;  5FY7 A;  2XAH B;  5JDN A;  1US7 B;  1ZKE A;  4TZ4 C;  5J1G A;  1O3X A;  5DQV A;  2WM9 A;  3AVR A;  2KND A;  3ANW B;  3TKL B;  4IHJ E;  3KV4 A;  1WR6 A;  2K5B B;  4E7Z A;  2Y6X A;  5CA0 E;  4FI5 A;  1IAP A;  2KT9 A;  2IW5 B;  4OYJ A;  3KFW X;  4PFP A;  5LBM A;  3ZYK A;  4MLK A;  4PJJ A;  2DHR A;  4L5G A;  4CXY A;  2WMO A;  3IBP A;  2SPC A;  4AKH A;  3AA7 B;  2XAF B;  4ZI7 E;  2XAG B;  4QHO A;  3OYX A;  1BR4 A;  1U4Q A;  5HXS A;  5JQG E;  4HEA A;  4ZOL E;  5BMV E;  5TAO A;  3E08 A;  5DAB A;  4L9I A;  3UUX B;  4BA9 A;  3N2K E;  3LJC A;  2MYS A;  3C98 B;  1OWA A;  2K24 A;  2LSG A;  3CQC B;  5LBQ B;  2PFV A;  3KBU A;  3GMI A;  2VWA A;  2MOZ A;  2MTQ A;  3E0Z A;  5M4Y A;  1HS7 A;  3GWH A;  2Z6E A;  5FYM A;  3HKC E;  1HF8 A;  2WAU A;  3RKO A;  2WSS V;  4PNI A;  4YHJ A;  3AA1 B;  2ZM2 A;  3Q2M A;  2Q9Q D;  5L3F B;  2CXF A;  2D0T A;  3NBX X;  3BK9 A;  4MAL A;  4IGU A;  3N9P A;  5FY1 A;  1ZHC A;  5JDL A;  2D2S A;  4GOU A;  2JRK A;  4C90 A;  4QXB B;  1UCU A;  3F57 A;  1KK7 A;  3ZC0 A;  4O4J E;  2LSI A;  2X67 A;  2UXN B;  4ISS A;  3I0Q A;  3ZJ2 A;  2NWB A;  3KVA A;  3OYZ A;  3RRW A;  4U74 A;  3KW5 A;  4P09 A;  1HFA A;  3OBV E;  3ZMU B;  3VKG A;  2YEV C;  3PUA A;  4MBQ A;  3UUM A;  4UF0 A;  2JMH A;  5LHG B;  3SRZ A;  3H3A A;  5L3B B;  4O8S A;  1E1H B;  2LHN A;  3PUS A;  2LT3 A;  3CX6 B;  1BR1 A;  2IC6 A;  2VK9 A;  1IJ6 A;  3IHR A;  2H7O A;  4OHF A;  4PK5 A;  4UEM A;  2MBG A;  3N9O A;  2UXX B;  3PTR B;  2X9X A;  2Y48 B;  3GN5 B;  3V5S A;  3Q9D A;  4O2B E;  1YW0 A;  2JPF A;  4X1Y E;  5FXZ A;  5HXH A;  2NW8 A;  4I4T E;  2KLQ A;  4CI1 B;  1MMG A;  5KDM C;  2NP9 A;  1ZV4 X;  4PK6 A;  2CE7 A;  1MIW A;  3O1J A;  4CQI A;  3N2G E;  2IC9 A;  3ZCI A;  4EAH A;  4P0A A;  3MA9 A;  3MZK B;  4DM9 A;  2Q9Q B;  4PAG A;  2M67 A;  2C5J A;  2ODU A;  2EHO C;  2CM0 A;  2LJL A;  2OA5 A;  1YKE B;  3KVB A;  5F8P A;  3C4Z A;  3JC6 D;  4GYR A;  2XAJ B;  2BZB A;  4G2A A;  4EZH A;  2LEN A;  4CXW A;  1MMA A;  2CWO A;  4TUY E;  4M1P A;  1NWM X;  4PK4 A;  5LG4 A;  4NUU A;  1HG2 A;  4JUY A;  3ETV A;  2LOP A;  3H37 A;  3OKQ A;  4QX8 B;  3V5U A;  3UTK A;  5GON E;  2A3D A;  3RYH E;  1WLX A;  2DNX A;  3RYF E;  2HPL A;  4DMV A;  3MJX A;  4HN9 A;  4EZ4 A;  3FXD B;  4I43 B;  2CCQ A;  3KV5 A;  4A56 A;  5CB4 E;  5JRC A;  1X79 A;  2E8I A;  3DP7 A;  2RA1 A;  5CA1 E;  2K48 A;  3HKE E;  5KX5 E;  4IIJ E;  4B6X A;  3AA0 B;  5LXT E;  1SA0 E;  2KWI B;  3FXE B;  2LHR A;  1LKX A;  1MIV A;  3B57 A;  2ODV A;  3PU8 A;  4NUV A;  4PFO A;  4ZI2 C;  4PJM A;  3C64 A;  3NZQ A;  3SS1 A;  3N9M A;  2HH7 A;  4ERR A;  4YJ2 E;  5JDH A;  2JMK A;  2XTL A;  2NTY A;  5FY0 A;  2LEH A;  5H6Q B;  4AKL A;  3CKD A;  4H9P C;  1VRB A;  2D0U A;  1D1C A;  3Q5W A;  3M65 A;  5C8Y E;  3IEE A;  1UX4 A;  4QX7 B;  2XQY A;  4ASK A;  2DI4 A;  2ETL A;  4PW8 A;  3N9Q A;  3QC9 A;  5JDQ A;  2EHO A;  3W15 B;  3UT5 E;  4H9Q C;  3PUQ A;  1QSD A;  3I0O A;  3RC3 A;  4I50 E;  4ZHQ E;  5EK2 A;  3L09 A;  5JR9 B;  2V7L A;  4TX5 A;  3S4U A;  3PUR A;  4HTE A;  2WWU A;  1U5P A;  3ZMZ B;  3SOL A;  2WMN A;  4QWN B;  3DTO A;  3N5L A;  3OJA A;  4ZI3 C;  5LHH B;  2CLY C;  4OFZ A;  3A5X A;  3N2O A;  4WNK A;  4ZS2 A;  2V26 A;  5JH7 E;  3ZMS B;  2ACX A;  4JEU B;  2XAQ B;  3KDS E;  4AKI A;  3RYC E;  3IRT A;  4V1A v;  4IE6 A;  2E9X C;  4H9S E;  2CXL A;  3RRC A;  3R6N A;  3EVY A;  4CI3 B;  3CVR A;  4KP3 C;  4UF0 B;  5J2U E;  3LK2 B;  4O4H E;  3QUJ A;  3ZCJ A;  4IDZ A;  2KWH A;  4X1I E;  1KNZ A;  2RP4 A;  3UUN A;  3BQL A;  4DVD A;  3K3O A;  4PJN A;  1FEW A;  3EDU A;  3E22 E;  4JEH B;  5E0O A;  3AVS A;  4AQG A;  5FNV E;  2Y8D A;  5LOV E;  5LP6 E;  4IE7 A;  2YU2 A;  2H3R A;  4OYK A;  2DWK A;  2NOX A;  4U72 A;  1YD8 G;  4HKA A;  3CML A;  1NAF A;  5A1L A;  4GIW A;  4UVB B;  4O4L E;  3PE0 A;  4H63 V;  4Z8X A;  5LNK A;  1WYC A;  1G73 A;  3I9W A;  4KMC A;  4UV8 B;  2V7I A;  3ZYM A;  4HGA A;  2CA5 A;  2P9B A;  3RX6 A;  5HYA A;  4TV8 E;  4MFR A;  4I6N A;  3SWH A;  4C91 A;  2YU1 A;  1FMW A;  3CQG B;  3ETU A;  3CPZ A;  3Q5X A;  5H6R B;  4DBQ A;  1MND A;  1D0X A;  3K8P C;  3MKD A;  4YLH A;  4GK5 E;  5FXX A;  1LRZ A;  3MXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...