The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
6
|
sequence length |
44
|
structure length |
44
|
Chain Sequence |
NVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQAN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
How the HIV-1 nucleocapsid protein binds and destabilises the (-)primer binding site during reverse transcription.
pubmed doi rcsb |
molecule tags |
Viral protein/dna
|
molecule keywords |
5'-D(*GP*TP*CP*CP*CP*TP*GP*TP*TP*CP*GP*GP*GP*C)-3'
|
total genus |
6
|
structure length |
44
|
sequence length |
44
|
ec nomenclature |
ec
2.7.7.49: RNA-directed DNA polymerase. |
pdb deposition date | 2005-11-08 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00098 | zf-CCHC | Zinc knuckle |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Few Secondary Structures | Irregular | HIV-1 Nucleocapsid Protein | Zinc finger, CCHC-type |
#chains in the Genus database with same CATH superfamily 2CQF A; 1WWE A; 1Q3Y A; 1WWG A; 3NYB B; 2L4L A; 2IHX A; 1ESK A; 2EC7 A; 2M3Z A; 1WWD A; 1WWF A; 2YSA A; 1U6P A; 1AAF A; 2EXF A; 1BJ6 A; 1A6B B; 2JZW A; 1MFS A; 3TS2 A; 1Q3Z A; 1A1T A; 3TRZ A; 2LI8 A; 1F6U A; 3TS0 A; #chains in the Genus database with same CATH topology 2CQF A; 1WWE A; 1Q3Y A; 1WWG A; 3NYB B; 2L4L A; 2IHX A; 1ESK A; 2EC7 A; 2M3Z A; 1WWD A; 1WWF A; 2YSA A; 1U6P A; 1AAF A; 2EXF A; 1BJ6 A; 1A6B B; 2JZW A; 1MFS A; 3TS2 A; 1Q3Z A; 1A1T A; 3TRZ A; 2LI8 A; 1F6U A; 3TS0 A; #chains in the Genus database with same CATH homology 2CQF A; 1WWE A; 1Q3Y A; 1WWG A; 3NYB B; 2L4L A; 2IHX A; 1ESK A; 2EC7 A; 2M3Z A; 1WWD A; 1WWF A; 2YSA A; 1U6P A; 1AAF A; 2EXF A; 1BJ6 A; 1A6B B; 2JZW A; 1MFS A; 3TS2 A; 1Q3Z A; 1A1T A; 3TRZ A; 2LI8 A; 1F6U A; 3TS0 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...