The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
3
|
sequence length |
45
|
structure length |
45
|
Chain Sequence |
KNVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQAN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural insights into the cTAR DNA recognition by the HIV-1 nucleocapsid protein: role of sugar deoxyriboses in the binding polarity of NC.
pubmed doi rcsb |
molecule tags |
Viral protein/dna
|
source organism |
Human immunodeficiency virus 1
|
molecule keywords |
HIV-1 nucleocapsid protein NCp7
|
total genus |
3
|
structure length |
45
|
sequence length |
45
|
ec nomenclature |
ec
2.7.7.49: RNA-directed DNA polymerase. |
pdb deposition date | 2010-10-08 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00098 | zf-CCHC | Zinc knuckle |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Few Secondary Structures | Irregular | HIV-1 Nucleocapsid Protein | Zinc finger, CCHC-type |
#chains in the Genus database with same CATH superfamily 1U6P A; 1MFS A; 1Q3Y A; 3TRZ A; 2JZW A; 1ESK A; 2EXF A; 1Q3Z A; 2M3Z A; 2CQF A; 2L4L A; 1WWF A; 3TS0 A; 2IHX A; 1F6U A; 2EC7 A; 3NYB B; 2LI8 A; 1WWE A; 2YSA A; 1A1T A; 1WWD A; 3TS2 A; 1AAF A; 1BJ6 A; 1A6B B; 1WWG A; #chains in the Genus database with same CATH topology 1U6P A; 1MFS A; 1Q3Y A; 3TRZ A; 2JZW A; 1ESK A; 2EXF A; 1Q3Z A; 2M3Z A; 2CQF A; 2L4L A; 1WWF A; 3TS0 A; 2IHX A; 1F6U A; 2EC7 A; 3NYB B; 2LI8 A; 1WWE A; 2YSA A; 1A1T A; 1WWD A; 3TS2 A; 1AAF A; 1BJ6 A; 1A6B B; 1WWG A; #chains in the Genus database with same CATH homology 1U6P A; 1MFS A; 1Q3Y A; 3TRZ A; 2JZW A; 1ESK A; 2EXF A; 1Q3Z A; 2M3Z A; 2CQF A; 2L4L A; 1WWF A; 3TS0 A; 2IHX A; 1F6U A; 2EC7 A; 3NYB B; 2LI8 A; 1WWE A; 2YSA A; 1A1T A; 1WWD A; 3TS2 A; 1AAF A; 1BJ6 A; 1A6B B; 1WWG A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...