The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
59
|
Knots found |
|
sequence length |
220
|
structure length |
204
|
Chain Sequence |
EWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNAAATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of the de-ubiquitinating enzyme UCH37 (human UCH-L5) catalytic domain
pubmed doi rcsb |
| molecule keywords |
Ubiquitin carboxyl-terminal hydrolase isozyme L5
|
| molecule tags |
Hydrolase
|
| source organism |
Homo sapiens
|
| total genus |
59
|
| structure length |
204
|
| sequence length |
220
|
| other databases |
|
| ec nomenclature |
ec
3.4.19.12: Ubiquitinyl hydrolase 1. |
| pdb deposition date | 2009-10-04 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01088 | Peptidase_C12 | Ubiquitin carboxyl-terminal hydrolase, family 1 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Ubiquitin C-terminal Hydrolase UCH-l3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase |
#chains in the Genus database with same CATH superfamily 3TB3 A; 2ETL A; 1UCH A; 4UEL A; 3IHR A; 4IG7 A; 2LEN A; 3IFW A; 3A7S A; 4UEM A; 4JKJ A; 4DM9 A; 4I6N A; 3RIS A; 1CMX A; 3RII A; 3IRT A; 3KVF A; 3KW5 A; 1XD3 A; #chains in the Genus database with same CATH topology 3TB3 A; 2ETL A; 1UCH A; 4UEL A; 3IHR A; 4IG7 A; 2LEN A; 3IFW A; 3A7S A; 4UEM A; 4JKJ A; 4DM9 A; 4I6N A; 3RIS A; 1CMX A; 3RII A; 3IRT A; 3KVF A; 3KW5 A; 1XD3 A; #chains in the Genus database with same CATH homology 3TB3 A; 2ETL A; 1UCH A; 4UEL A; 3IHR A; 4IG7 A; 2LEN A; 3IFW A; 3A7S A; 4UEM A; 4JKJ A; 4DM9 A; 4I6N A; 3RIS A; 1CMX A; 3RII A; 3IRT A; 3KVF A; 3KW5 A; 1XD3 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...