The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
60
|
sequence length |
179
|
structure length |
161
|
Chain Sequence |
GGGVTFCGGEPLLHPEFLIDILKRCGQQGIHRAVDTTLLARKETVDEVMRNCELLLIDLKSMDSTVHQTFCDVPNELILKNIRRVAEADFPYYIRIPLIEGVNADEKNIKLSAEFLASLPRHPEIINLLPYHDKMQTPSEEVQQQCIQILTDYGLKATIGG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of a domain of pyruvate-formate lyase-activating enzyme from Bacteroides vulgatus ATCC 8482.
rcsb |
| molecule keywords |
Pyruvate-formate lyase-activating enzyme
|
| molecule tags |
Lyase activator
|
| source organism |
Bacteroides vulgatus atcc 8482
|
| total genus |
60
|
| structure length |
161
|
| sequence length |
179
|
| ec nomenclature | |
| pdb deposition date | 2008-02-20 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Horseshoe | pyruvate-formate lyase- activating enzyme | pyruvate-formate lyase- activating enzyme |
#chains in the Genus database with same CATH superfamily 3CAN A; #chains in the Genus database with same CATH topology 2QGQ A; 4FHC A; 4RH1 A; 4FHE A; 4FHD A; 4K9R A; 4FHF A; 4RH0 A; 4FHG A; 3CAN A; 1OLT A; #chains in the Genus database with same CATH homology 4FHC A; 4RH1 A; 4FHE A; 4FHD A; 4K9R A; 4FHF A; 4RH0 A; 4FHG A; 3CAN A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...