4RH1A

Spore photoproduct lyase c140a/s76c mutant with bound adomet and dinucleoside spore photoproduct
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
340
structure length
340
Chain Sequence
KPFVPKLVYFEPEALSYPLGKELYEKFTQMGIKIRETTSHNQVRGIPGETELARYRNAKSTLVVGVRRTLKFDSCKPSAEYAIPLATGCMGHCHYCYLQTTLGSKPYIRVYVNLDDIFAQAQKYINERAPEITRFEAAATSDIVGIDHLTHSLKKAIEFIGATDYGRLRFVTKYEHVDHLLDARHNGKTRFRFSINSRYVINHFEPGTSSFDGRLAAARKVAGAGYKLGFVVAPIYRHEGWERGYFELFQELARQLEGMDLSDLTFELIQHRFTKPAKRVIEQRYPKTRLDLDETKRKYKWGRYGIGKYVYRDEEAKELEDTMRRYIEQFFPGAYVQYFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Spore photoproduct lyase
publication title Rescuing DNA repair activity by rewiring the H-atom transfer pathway in the radical SAM enzyme, spore photoproduct lyase.
pubmed doi rcsb
source organism Geobacillus thermodenitrificans ng80-2
total genus 121
structure length 340
sequence length 340
ec nomenclature ec 4.1.99.14: Spore photoproduct lyase.
pdb deposition date 2014-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rh1A01
3.80.30.30 Alpha Beta Alpha-Beta Horseshoe pyruvate-formate lyase- activating enzyme pyruvate-formate lyase- activating enzyme 4rh1A02
4RH0A 4FHFA 4FHGA 4K9RA 4FHEA 4RH1A 4FHDA 4FHCA
chains in the Genus database with same CATH superfamily
4MCJA 1A69A 2WICA 4TXLA 2I22A 1NURA 2HIMA 4NCHA 5B1EA 1SD5A 4KQCA 4GL2A 4JU8A 1NRIA 2O3QA 4P36A 5FA5A 4LN1A 5DWDA 1ZP6A 5AH0A 4BZZA 1RPAA 3SHVA 4Z1MA 2BFAA 3LLVA 5KDOA 5EWLB 1PHRA 1YASA 4HGRA 2B78A 1JDSA 1VGVA 2V9PA 2YXEA 2ZWIA 3HUFA 4JLKA 4QJBA 3ESQA 1IEVA 3HFJA 4U7HA 3V1TC 1W4CA 3V33A 1VCOA 2YVLA 1FFWA 2VRBA 1JI0A 3B3AA 1EINA 3JQGB 4A1FA 1W5FA 3JWGA 1KKUA 1U3WA 3PDHA 4WVFA 2RBGA 1SXJC 3W5AA 1IBRA 2YTZA 3VM6A 3ETEA 1SUWA 5EESA 3D59A 2VWQA 3UW1A 4LDRA 3E7FA 2W2MA 1PUJA 4I9NA 4NZYA 4TSRA 1TFUA 1B26A 3C6QA 1PQYA 3H3JA 3HL4A 5CXSA 3ZDBA 4L4XA 2P2NA 1T5IA 2VPYA 3L0SA 3EAQA 4PX5A 1VL5A 1XCJA 2A1UA 3EZNA 3MT9A 1U0BB 3Q5DA 3TK1A 2QX9A 4LGVA 4QUIA 4EVSA 3AESA 3KKMA 4PSCA 4D4JA 1CJCA 1PE0A 1OTYA 4JQSA 1XO1A 3D3JA 2XCIA 2Z4SA 1U7OA 3TZHA 1P9LA 1P1BA 1YOBA 3WL4A 1O2DA 3BH7A 1RXIA 4DT1A 1DEXA 1ZJ4A 3AHEA 2E6UX 3ILVA 2H4YA 2A14A 3H42B 1NP7A 3TOSA 3WOVA 1N34B 2P27A 3NC0C 2MCFA 3T6KA 1KOJA 1DC7A 4YFYA 3UB3A 4EVQA 4YV1A 2I4TA 4EEKA 2VTDA 1TTTA 4BP1A 2ZSDA 5BV0A 3OPQA 5JZBA 1R2QA 2OGUA 4ND4A 1T1IA 1TT7A 4NYMQ 5IJWA 5JEEA 4EUEA 4X44A 4TKMA 4A5OA 2WSYB 4UULA 4FMDB 2OHJA 1J1IA 4MVJH 3H4TA 3WWCA 3LTNC 4CM7A 3D8TA 5DYGA 1HNNA 2AKAB 1RBMA 2Q1TA 3RAFC 4LK2A 4W7SA 2ZSEA 5B3JC 1A9YA 3PRJA 2C5HA 1EK2A 3CLRC 3ZK7A 4X61A 2GJ9A 3BE6A 4DNQA 3E9CA 3AVWA 2QGNA 3OQJA 2YVAA 3BDAA 4MW7A 4G09A 1GGVA 1A9XA 1C3JA 4KPUA 4P3YA 4MUFA 3MF4A 1ADJA 2CVQA 4I3GA 2JGDA 1OLUA 2N46A 2IVFA 2OCDA 3C14C 4D0SA 2RH8A 2XLBA 3MBOA 2VPTA 1KJ9A 4NE9A 5E9JA 4WK6A 4C7KA 3Q3EA 3NH6A 3HM9A 4HT3B 1KHTA 3EGDA 4E08A 4Z5XA 2Z2JA 3K92A 5JHGB 2RONA 1QYDA 2OFWA 2BZSA 4FTWA 3N74A 4L0CA 4P7JA 4L9RA 1Y0BA 4KXFB 7MDHA 4F3YA 2EIHA 3E05A 1UIMA 3KB1A 1ZH2A 5K99A 1OBOA 3MRVA 7REQA 3D2LA 4Q4HB 2RAFA 3EPKA 2FX5A 3W8DA 5J58A 4PNZA 5J4LA 3LLCA 3PTLA 2IU0A 3PU6A 2PRKA 3M6IA 3LQ4A 4QASA 3G02A 3JALA 4R83A 3SYKA 3EPRA 2O8EA 2X7JA 4ER0A 4UHBA 1W19A 5KTKA 2HF8A 5JO9A 1GCIA 4CN8A 1EP1B 1FMJA 2Q3LA 3QFRA 4H1TA 3TW6A 1BYUA 1OILA 2VJPA 5JUWA 4KOAA 1C9MA 2GJAA 4ESEA 1WDTA 3FRHA 3RJ9A 1K7EB 1ZJYA 2ZRQA 4JZYA 4XFJA 3V4VB 3CVXA 3GRRA 3C3AA 1EYZA 4HEJA 4H7IA 1YJAA 4HNHA 3MEQA 2V7VA 4CLDA 3V1UA 1CR4A 1R15A 3UFBA 1TLTA 2J46A 3HWWA 4KYVA 2IXAA 3TB6A 3RK4A 2ARKA 1KYXA 3PNYA 3T9CA 4A26A 3B5JA 4BN5A 1XELA 2QMQA 4BU0A 3SX2A 3A1DA 3A10A 4CL8A 4EHDA 2EP8A 1FTQA 3O82A 1ULTA 4HMOA 1CUAA 1NF9A 1KAGA 3RTEA 5LSAA 1ORRA 1A5TA 3H84A 2BZ1A 3T7IA 1UJBA 4EY5A 5ALSA 4MB6A 1SJ9A 2BUAA 5KYUA 4DA7A 3BFXA 1XMJA 3O8OA 4TLAA 4YMHA 3IUSA 1LPBB 3LBYA 5IJZA 4KQ2A 2A1IA 4CCAA 5E1DA 3WQRA 3UCFA 5TJHA 2C7OA 4ZO6A 5DGXA 4BVBA 3PK0A 1E9BA 2F1RA 2OHGA 1VYUA 3D3WB 1K0UA 2AQKA 4GGPA 4GKAA 4MV3A 4IXNA 5DBOA 3WLKX 1AQJA 4QFMA 2H54A 1PWXA 1CY1A 1Q0LA 1L4EA 1S96A 1Z4LA 2OO5C 1LA2A 3H11A 3QJYA 4K6FA 1FYXA 1ESZA 2GCNA 1DJOA 3FTFA 4B3HA 1YWGO 4DFDA 4DDTA 3PITA 1HC7A 2WF5A 3CW9A 2PNFA 4HDNB 2XKAA 3TMAA 1OT3A 4FS3A 5ISMA 2JIZD 1O6ZA 2XNHA 2FB9A 4MJLA 5CJ2A 2OQVA 1WVMA 3VPHA 3WIBA 2Y1XA 1AD2A 5IKEA 3ENQA 2DVMA 3GUYA 4XFKA 4WD3A 1KDOA 3JARB 4S1VA 1IN8A 2MYPA 2FSVC 2VDLB 1DPFA 3QEJA 1DAFA 2YC4C 3NUZA 4EECA 5FTKA 5KYXA 4YRJA 3RT7A 3X1JA 3B5IA 2QVGA 4XGNA 1HDYA 3VI3B 3PNOA 4V0KA 5KDDA 3G0CA 2FQQA 3FOWA 3SYNA 4NCIA 4RHTA 1RMQA 3WX0A 1ONOA 3CTMA 2RBEA 3IMEA 4RPJA 2AK3A 3SS9X 1GZ7A 3DUFA 3FPEA 2AXEA 4FLEA 1SU7A 3HFGA 1JIIA 3X1XA 3S2UA 1M2WA 3F3SA 4LAFA 4U5XA 3G0BA 3ANNA 5GV7A 3K0AB 5FPTA 3MGCA 5F9FA 1KRWA 1SBCA 4BGEA 4GI3A 4B2IA 2GFHA 4XTRA 1AZTA 5CBPB 4P08A 3AF6A 4YJ3B 2A84A 1PD0A 1ZLXA 1Z4KA 2W48A 1TUEA 2ZJOA 4KUGA 5EZYB 1W59A 2OZLA 2H3HA 3RTCA 2ZT6A 1XD9A 1ZH6A 3HCFA 4R3UC 5JSKA 4HS4A 4D1YA 1Z12A 3NH9A 1YTLA 3EEOA 4V1CA 1QIEA 2Z6QA 3O3OB 2FHSA 2VA9A 2IHJA 4WLUA 4EHAA 2LKDA 4NZNA 2PLNA 4UTRA 3Q7IA 4PG5A 2HMUA 2QTGA 4CG0A 1Q1NA 3D3EA 1UF9A 3W2IA 2XUGA 1X7XA 2FRDA 4JL5A 1ZN7A 1D07A 3K1AA 4KYIB 4EHFA 3VU0A 2E5FA 3QMWA 5GM2A 2RHLA 1PR6A 1ORHA 4IUDS 3VRHA 4DRZA 1P7ZA 3MS2A 3HH8A 2QROA 5CDSA 5AKYA 2XNSA 3NWOA 3MWLA 5M34A 1NVVQ 4GOMD 5KHAA 1D7OA 4YAEA 1P2GA 2A8YA 2AQ8A 2FUG1 2RCNA 3TLAA 4EY8A 4HUTA 4RC9A 4P7GA 1L4KA 2ZLBA 2FPGA 2CHQA 1BU8A 3I1FA 2PV0A 1L7VC 5D7NA 4HN9A 3BERA 5F21A 1DZIA 1IZ0A 5CCDA 4OHMA 3EH1A 1JU3A 4J43A 4RGYA 5T6MA 3FPLA 4JVMA 3RYTC 6Q21A 4C4ZA 1QRRA 1J5XA 1LLUA 1XDGA 2ZJAA 2PXCA 1J4AA 2PM8A 1KY5A 4ML3A 1M34B 1IDOA 1ODLA 3Q15C 4G0WA 3R3WA 4NOLA 2UYQA 4JK3A 4D8WA 1R5OA 3OTHA 1ZUWA 3KYDB 2ANCA 5M04A 3JQ7A 2FCAA 1EQUA 2BGMA 1E7WA 1K92A 1UZLA 3G2IA 2AEFA 4HZGA 2ZPTX 1LBSA 2IU6A 3GNLA 1XCMA 3OU2A 4N7RA 1E6CA 4MGEA 2V3VA 2XUDA 3G0HA 3HUDA 5LYJA 1R5JA 4F1KA 5BT8A 3L1JA 2PO7A 2A78A 2PGJA 3B36A 3IQHX 2R1TA 4DARA 1OGJA 2A30A 2A5GA 5L3QA 4PLGA 1UBLS 2VXYA 4LDJA 3WGUA 4DDMA 1GPLA 3HI6A 4G8BA 4HXEB 2XQJA 4EEXA 1RIFA 3I3SR 3JQQA 3KEMA 2DUUA 5C7YA 3DT9A 3ZG6A 4Q9NA 3UT0A 4KIUA 2GCGA 2FF7A 1M72A 4D45A 1DX6A 5CB4A 4MV0A 4CV3A 1OIWA 5AJWA 4O02B 2PGLA 2O4UX 2QT0A 3E61A 1DOZA 2FKAA 4QDJA 1TF5A 3EJWA 4JQCA 1GUBA 1BQ4A 1GPH1 1Y7IA 2X40A 2FLKA 3LBHA 1WCWA 4XA8A 1QOPB 3EXAA 3NV7A 4B44A 4EB6B 1VIAA 1Z6TA 3OY2A 3I92A 3R1IA 4C03A 3M1AA 1ETUA 2BTQA 2QY6A 4LYHA 4QG7A 4TVBA 2JCXA 3BT7A 2GSDA 3PIDA 3QPUA 1OW3B 2JJ2A 2ZVPX 5TVKA 4CEHB 1MJFA 4PYKA 1MNAA 3V8BA 2XAUA 1Y9EA 3FTCA 4FLFA 5CYGA 1PNVA 3P0RA 1OBFO 4MVCA 4UNNA 3WK8A 4AO7A 3AZOA 2B94A 2DE0X 3GPCA 2FN4A 5LOVF 1WJGA 3M9XA 3WR5A 3I61A 4HLNA 2IV3A 3ZR4B 4O8ZA 2Z95A 3KDSE 2R6HA 2VHTA 1EFPA 2CXTA 2BEJA 3ICWA 3IUBA 3RYIA 3S7ZA 3TVTA 2R85A 3ZE9A 2GXQA 2O7QA 4N03A 5C5DA 1RKBA 2YINC 1P60A 4FGLA 1BU5A 1ILWA 1Y3IA 4E32A 4FNGA 3SSNA 2B36A 5EERA 2XUJA 1F7UA 3S99A 1AKRA 3L7MA 2FN3A 1WF6A 2JI6A 3KEGA 5B53A 3GGCA 2BP7A 4N82A 3T4UA 4KK4A 2W6QA 3R5FA 3HJUA 2GK6A 3K96A 5DNDA 3R7SA 2Q5QA 4GMKA 5CVCA 5AVWA 1RFGE 1UBKS 1X80A 1YE3A 4HDKA 5BSUA 1YS9A 4R2HA 1G42A 3KWJA 4PQFA 4KR0A 3E9QA 1NFRA 3B48A 4OJQA 1NBAA 4MWZA 4BE4A 4C04A 2WB4A 4KXYA 5KPDA 1GSIA 3I23A 3HXOA 4JB0A 2WIGA 4PYRA 4EGCB 3C7DB 4WLEA 3KYJB 1T34A 1LZKA 3BTOA 1M34E 3HLTA 3LCMA 1M1ZA 4DJFC 1CX9B 4QXAA 1Z6PA 3F71A 1CUZA 3N2KB 5NULA 2CSXA 4I66A 1ZBQA 4Z9YA 2QE7A 1C4KA 2HA7A 2WINI 1BS9A 3F8SA 3H5RA 2ZE5A 3WKCA 2X4LA 2JZOA 3PTAA 2QGZA 1E4OA 4TL7A 5FJIA 4ENVA 2VJBA 4KPEC 1E9FA 2XQKA 4TMYA 5AW1A 1K6MA 2W0SA 2ROQA 4Q34A 1KEVA 5JI3E 4KBFA 1I2BA 3C7CB 2EJWA 4IG9A 4Y9UA 2WJ3A 2WJIA 3KWFA 3K4QA 1W7AA 4PGAA 3SM3A 1P33A 4GLBA 4DR6B 4KMOA 4FU0A 1Z13A 4QPPA 3DO5A 4CF4A 5EFOA 3IMGA 2W6JA 1LPAB 4CCWA 4Z0HO 4YNBA 3HU1A 1G8SA 3ICCA 2D7CA 3X1YA 3S68A 1SZCA 1XLTA 1PQUA 2DH6A 3QKSB 3PLNA 3RIXA 4F92B 2JJYA 5BR1A 1NLFA 3BXGA 3HXPA 1MHTA 4JOSA 1CUBA 5K3OA 2BCGY 1JALA 1M5UA 4LHSA 1TM1E 4PBTA 4Y2JA 1JJVA 4RF3A 3WWEA 1RJ9A 2K7FA 5FWAA 2CFOA 2PE5A 3L7JA 4OSEA 3T0IA 1N2OA 4DUYB 3TDKA 4HFRA 3F6PA 4UDYX 5LFAA 3IS3A 3D6JA 1GQYA 2QLMA 4GWLA 3VQTA 3NKLA 3IOCA 4YX9A 2V45A 2X76A 4Q5IA 3IDSA 4J49A 4QYTA 1GAQA 4MKHA 3CUSA 3N8NA 2QTTA 4LXXA 1JLMA 2PJDA 1QFXA 1VJRA 1VMAA 3A3PA 2ZWOA 2E1RA 1C9NA 5F64A 1ZD5A 1F2DA 2FUG6 3IYLW 4E4TA 1JR3E 2RGGA 2OD7A 3DVLA 3ETLA 3GA7A 2P35A 4JYMA 5A9TA 5C18A 3HPRA 4B34A 1P6QA 2MYUA 1OFUX 4CI9A 1Q50A 5M29A 1JPNA 4RZIA 3QLEA 3T8YA 4CKCA 3KQOA 3AUSA 5B37A 3RC2A 2HMAA 2ZG6A 4HD8A 1F4PA 2W90A 5FO1A 4GL4A 5A62A 3VDQA 1N9KA 5EPEA 2F43B 1P2TA 2NNLD 3LQKA 2CE2X 4ATNA 4HWGA 3O4HA 4TV9F 1VECA 4OF4A 2CJXA 4WBSA 4A6DA 2BKAA 4JNCA 4DXHA 2IFTA 4HGNA 5IASA 2WVAA 1WMDA 5BSRA 1YBAA 3PT9A 3MJFA 3QYPA 1PFWA 1QC5A 1EXMA 2GT1A 2J6BA 1LV8A 2WJWA 4OI1A 2Q2VA 2HMWA 4HB3A 1H2FA 5ALIA 2F1IA 1QVAA 4WKBA 4C4XA 4D7AA 1Y8CA 4HMQA 5CIYA 3OPMA 3EARA 4GZLA 1GN8A 3UA3A 3CX4A 3OOEA 4DNOA 4R7GA 5KBYA 4J0CA 4ZJZA 2I4OA 1V16B 1C3OB 3KVRA 2BKXA 3C45A 1WVIA 4YRTA 4UNRA 3VDNB 4GLJA 5DEIA 1A8UA 4JJ4A 4GPAA 3KKZA 2G63A 3ND6A 3UKOA 2PLFA 2XD9A 1B93A 3AGQA 3WRWA 1LPPA 3BJIC 3H16A 1NQVA 3ISTA 4WEOA 4ZHSA 3CZ5A 4NBLA 2VSFA 3TTWA 3RUIA 1D4FA 2HA5A 3H13A 4D9KA 1DX9A 1ZA1A 2PGOA 4FNOA 2X0NA 3CRVA 1H2YA 3UW3A 4BNHA 3OJWA 3RAEC 4OO3A 4U7JA 1ZLYA 4JSTA 1E2BA 4DHEA 4FD3A 2C98A 3KIPA 2YYSA 5EJGA 4FGJA 2PWBA 1N7HA 5HQTA 3BDVA 1SBNE 2Q29A 3A3OA 3DL4A 1SVWA 3HJCA 3KPVA 3PC3A 1KSGA 3OP1A 2B2CA 2DTDA 1PV2A 2XVYA 4LSGA 1AN0A 1W6UA 2GFIA 1Y4ZA 3MUOA 5DNEA 4DJDC 3R2JA 3M6LA 3I72A 4FOOA 5AIBA 2RGWA 1USVA 3S28A 2FEMA 3OFVA 1X7ZB 2NVOA 1EMDA 2HN9A 2QRPA 3TSZA 4OHKA 4RKFA 3FNGA 3DEAA 1K06A 3A6KA 1BHQ1 3K8YA 4CTNA 1T0BA 2XNDD 4B3IA 3AL0C 2O3TA 4MAAA 5B2ZA 4Z8XA 1D1SA 1VSQA 1SWWA 2D2XA 5DIZA 3ZS9A 4EHHA 3K9HA 2EOAA 4GLOA 1YIDA 1C8BA 4IZHA 3DBIA 2WEKA 1L5RA 2PCJA 3E8SA 2KBFA 2CNNA 4OGLA 4V0OA 2R6GA 2RHTA 4WINA 3TOVA 5EZQA 3VTAA 3LS2A 2IZ1A 5BRJA 1E64A 1Z6AA 3NQ41 5HOQA 3FZNA 1M6EX 3U3ZA 1XYVA 4ON9A 1BTOA 1NY5A 1GR0A 4M8SA 4CMGA 2QR2A 2P7HA 2RAUA 1O6GA 1UMCA 3D5QA 4AP6A 3U6KA 4QLOA 3RUEA 4ZYZA 4KLAA 4F8EA 3FYUC 4DR7B 2WG0A 1CIJA 1HQDA 3JQDA 3NC4A 3PGXA 1FSSA 1P5ZB 2FZLA 2JLSA 4K03A 4ZALA 2OCBA 1EZ4A 1EFAA 2GEBA 2GUWA 2RHWA 3ICOA 4MGYR 3X1KA 1YZKA 4WBNB 3CUWA 5H83A 5JH7A 1PR5A 1RBZA 2WHEA 1PFGA 1VBNA 1Z34A 2GZ1A 3SKXA 3VR6D 4AJEA 4DEYA 3TXYA 3JZMA 4II3A 5K8LA 1GPUA 1P9RA 1QU3A 4KAJA 4LJ5A 2RHJA 3AEKB 4XH9B 1M54A 3OQIB 4HEA1 2WA1A 3ZZ0A 4JKIA 4BNJA 2BI4A 1X94A 2JIPA 4ZQGA 4XD7A 4R9RA 3DMFA 2ZREA 3WKAA 4IXWA 3NX4A 3HRHA 4IQ4A 5DBIA 3V34A 4F86A 4UU7A 1G5IA 2W2KA 4XAQA 3W3AD 1RHMA 2ATCA 1DFHA 4L57A 2CNWA 2BMJA 5EPOA 4BQFA 1CD5A 1IULA 4KH0A 3P0EA 4LX8A 3TLYA 1DG1G 3NHAA 2O8NA 2V59A 1E1LA 2GTHA 4YV7A 4DNXA 5E1OA 1VI2A 5T4FA 1ETHA 1D1TA 5FOTA 3UUGA 3AFMA 4ALLA 1HI9A 1XJQA 4LYDA 4A73A 1LSUA 1YR8A 1I7SB 3B51X 4IRUB 2WMDA 3L07A 2WTMA 5KI6A 3F73A 1M1YB 3GRPA 1E5TA 1ZO8A 5GONF 5HXAA 1EM8B 3NU1A 4HOYA 2JBAB 5FNVF 1KMNA 5DBHX 2WSSD 5AUOB 5EKTA 5D3KA 3HKBA 5ITZA 2NT3A 4C0SA 1R6BX 5BV2P 1K6EA 2AS0A 4RXUA 1OKKD 1J99A 2D1SA 3KALA 2VF2A 4K0RA 4QXQA 4NJEA 3A04A 2RSLA 2FKNA 1O5IA 3B1VA 2DFNA 1CIVA 1UMBA 3K9WA 1ZD9A 1KTIA 2IBMA 3EVEA 3K2BA 2GCOB 3COZA 3ZVRA 1Q1BA 1RXSA 2C9OA 4AYWA 2O06A 3TS1A 3CVJA 4KWHA 3REQA 4YPFA 2X5XA 3IAUA 5LU8A 1TCVA 3N07A 3AF0A 3SD7A 4GKKB 1KRXA 2KYRA 2NACA 3RUHA 3S8YA 3TW8A 3EOBI 3W0LB 1PLJA 4TYWA 3KT8A 2JD2A 5EINA 2BJHA 4D6YA 4F6LA 1HDXA 2WNIA 2C2BA 5DOVA 2OYRA 5HYVA 1O77A 2B99A 2FPPA 3CIOA 3EXEB 4FNAA 1UBFA 5CD1A 4Z4IA 4YQEA 2AYZA 1V1RB 2GXSA 4A6EA 2QIPA 1F0NA 4OKNA 4K86A 1C1HA 1IJEA 1J09A 3C6KA 2CCKA 2X2PA 3RC1A 4BFVA 1WU7A 3KSUA 5IK2D 4C7OB 1VYHA 3HKEA 1TW3A 1YDHA 3H9EO 4B5KA 4NJOA 4JUDX 4BC1A 2X5JO 2LUOA 4UEJA 3PKIA 4QPNA 4EVRA 4YMUA 2JHPA 1O08A 4KSCA 4WVLA 5KTSA 2J09A 1V6SA 2JFNA 1RYBA 4UE6A 3PE6A 3TXAA 2VDMB 1FUUA 1S8AA 2ZS7A 4XVQA 4WA8A 1T9GR 5A4KA 3DONA 1R0LA 4DLRA 4ZAFA 1GEEA 3JRWA 2INGX 5AVKA 4DLSA 3PJDA 4MV6A 1EEXB 2PKEA 3D5TA 3EVDA 4MWSA 3ONDA 1BFDA 1SCAA 4MQEB 5D1NA 3T95A 1U2QA 2BMAA 2IJGX 2XUQA 3OCCA 5ECWA 3SM9A 2I4NA 3P2IA 1SFRA 2XSZA 4YROA 3K6JA 1X1CA 1W0JD 1OH8A 3GVCA 1E18A 3M89A 3UK7A 1QO9A 1NF2A 2KM1A 3L93A 3T7SA 5G4KA 1B15A 1JJBA 4NONA 1VBMA 2NO1A 5C0OE 3KCQA 5JR3A 3AI1A 4Z4FA 1HRKA 4HGPA 4ABTA 5KCZA 1ZX1A 2AOTB 5HIMA 5A2GA 5F9HA 4MVJP 4UVDA 3VNSA 5BYJA 3SQWA 4GVXA 1WNFA 2ODNA 2QRUA 3VZCA 2P62A 3L6DA 4AY6A 2QV0A 1NM5A 3X1MA 1KI1A 1W0KD 3O1IC 4IKEA 4FFDA 4D44A 1SBIA 1NBOA 3AF4A 1APBA 2W6OA 3KQNA 1NQUA 4IH9A 4WPGA 4X8HA 3UHFA 4F2GA 1Y4SA 2OLEA 2H52A 4EY4A 3E5NA 1UBNA 1A7KA 1KAHA 3FDFA 3HK2A 3UAOA 4NH0A 1EEHA 1S8NA 4ZVKA 1H6BA 3P2JA 1KVUA 1LK5A 3FTDA 4PV7A 5K0LA 1E6KA 1FDUA 3EXFB 4PW0A 1II8B 3TFOA 4YMSA 2CLIB 2J85A 1TQ2A 2NZUG 3O83A 5I47A 1RAAA 2BGRA 1UADA 3GT0A 3R40A 4H0NA 1R1DA 2WKRA 4I50A 4U2FA 3H9JA 3AERB 5ER9A 2VJQA 4FK8A 3CE6A 3E9YA 4YT8A 2P9ZA 1NN0A 2VXOA 4NICA 5G0TA 5MDHA 4NXNB 3OH8A 2WHPB 3AUYA 1TE2A 3AP2A 2BEUB 1HE3A 4WADA 4ZDWA 4I4LA 1RRFA 3RK1A 4AX4A 5DN6A 4HLQB 2ECFA 3D8BA 1JRLA 4DHWA 1DQZA 2JBHA 2JHGA 2OAQ1 3D43A 3OAAD 2ZRKA 3WXBA 2Y0EA 1THTA 4A0GA 5A1JA 5HIKA 5KYWB 5BP7A 4H3SA 5IXYA 2Z3ZA 4AU1A 1XK6A 4IMJB 4Q9LA 3T3MB 4H35A 1NMZA 2N1MA 3FW1A 3OOYA 3B7PA 1E9VA 1YS4A 5CVUA 3JVVA 4WCDA 3KWMA 2YQ4A 4Y6QA 2C0QA 2IZ6A 4QXPA 4BFWA 3CEMA 2AA3A 3VHXB 3ZCUA 2VK4A 5ALVA 2PSSA 4IQ8A 1TRKA 4J0EA 4K5QA 5F1KA 1GJRA 3LQFA 3LA8A 3SLKA 1NU6A 2H06A 1UWKA 2ZJBA 5KYYB 3RNOA 3PSHA 1KO1A 2PA0A 3EWSA 4HLUC 2ZUWA 3ZJ4A 1FSZA 4Y6GB 5ABPA 2C03A 4HEA6 2GYUA 5LNK1 1QGUB 5LQNA 4RL4A 1SHJA 2QSYA 2WAOA 2J7PD 2VDVE 1QHEA 3BCRA 3KOWA 4FYMA 4L5CA 3KT6A 4J1NA 4W82A 3PHCA 1H8HA 5DF1A 5AK6A 2OENG 5EJMA 4C14A 3TRIA 2OTCA 2NMVA 2VUIB 3DW1X 1P5RA 3H1TA 3ZKAA 1UOQA 3H2ZA 5DWVA 2H1VA 4AX8A 3CHYA 4FFBB 2X9QA 1RHRA 5JSFA 2FZ4A 3MVEA 2VDWB 3T3IA 1EBBA 3AP1A 1YO6A 3D7SA 3ML1A 5CG2A 2ADOA 4JEIA 5CVVA 3EQ8A 1V11B 4IDCA 1UZMA 2H5JA 5AKZA 2ZUEA 4FDTA 3W5UA 2NAPA 1XVVA 4FOLA 3SBEA 1E2PA 3QYAA 3PG5A 4RGVA 5AO9A 2J59A 4J0IA 1QUFA 3O90A 4NARA 4M37A 4UREA 2QWXA 3VU3A 4C6TA 3K16A 2E37A 1U7HA 4HAVA 5HKAA 3HXKA 4MGKR 3TLJA 2B4AA 1K63A 3AR4A 4OBXA 1KSHA 4PVDA 1SG9A 2NZWA 3A4TA 5L7YA 5BXYA 2FI1A 2HWUA 4A36A 2GZDA 4DLAA 4HWPA 5HILA 1CP3A 3AJ8A 3ZH9B 4Q05A 2G1JA 1YOVA 1A2KC 3QSYA 5FR2A 2MOKA 5DCWA 4JJAA 1VXRA 3WHLA 4RJIA 3STUA 2DUWA 2QYHA 1OYWA 4P2BA 4NV0A 2JIOA 2P9JA 4X41A 1E94E 3MYRA 1N8NA 3KFVA 3H99A 4LJ7A 5DT9A 2VDPB 3U7QA 2R751 2B1QA 4IW3B 5CLHA 4JLSA 4D4KA 3EZ9A 3GG9A 4A8JA 3C4QA 3EYWA 4FBMA 2IIVA 3OQMA 3E9DA 2I55A 3U44B 5IC5A 5LPNA 3DT6A 1IMJA 3D64A 3AKEA 1X0XA 4BP3A 2WQZA 3CLRD 1ZRNA 4IXMA 1PJRA 3MLEA 4JNKA 5HKLA 1OGIA 4INZA 1XFAA 3PUJA 4TQGA 4ABYA 5KC8A 1ZVKA 4G0PA 3K2EA 5EIBC 4C4PA 3EAGA 4DJAA 4F91B 3VSAA 4JDUA 2Z0MA 5HJEA 5TSDA 1NUSA 1P1FA 4YPVA 3O4FA 4KZKA 2VQSA 3E9ZA 1AK2A 3VC2A 1NTOA 4E11A 2CXHA 1BD4A 5CAEA 2VQ6A 1UCFA 3V2GA 2C3YA 5IJXA 4RDIA 3BCSA 3P0HA 3E5MA 3DMDA 4NCJA 1I01A 3QFSA 5KOYA 5LOVB 1ZIYA 2BWJA 2VIIA 2ZSKA 4MCHA 3Q98A 4XGQA 3ZLTA 4RDXA 1IHPA 1M5TA 3WGQA 4IVRA 2ORYA 1E5VA 3QPBA 3TXXA 5I7FA 4NQRA 1U1GA 2UZ4A 1UFOA 2CJWA 1E4EA 4QEKA 4JI6B 1B3BA 3K20A 3TBFA 1XD2B 1KKLA 4Q00A 5FEUA 3MINA 1Q21A 3DC7A 3TPFA 3EIEA 2NWQA 1GUZA 2VH1A 2E4ZA 3GJ7A 5EAIA 2HI0A 1CIPA 2PYDA 3MTJA 2W00A 2FCRA 4GPBA 5HF5A 3CFYA 4LZZA 2PK3A 1N78A 3P9PA 4OTZA 1GFSA 3F5MA 3UAWA 1GVNB 5K8IA 2B98A 2FOLA 2GMWA 3OBBA 4HVLA 3IBYA 4ZEWA 3I2YX 5H3LA 4M1TA 1BHO1 1FA9A 4JC4A 4C20A 4EJMA 5DM0A 1I4WA 3PQ5A 4B75A 1CRWG 2J0SA 1ZUD1 2CE7A 1T5TA 1X9IA 2JLYA 1W76A 3AM1A 4LFAB 3FA2A 4Z4HA 1OXVA 3GLFB 1YK0A 4Y1EA 2FN7A 3JQAB 4PLVA 1BXZA 1JIQA 2WBLC 3GIDA 1WY5A 1DUIA 3MFYA 4EG1A 3I0MA 3SE7A 5K6AA 2WWXA 5LUBA 2CDAA 1VLHA 2FRDC 2HF7A 2R8OA 1VHJA 1ZPDA 1Y5MA 2GHTA 2C2YA 2NZYA 3MILA 3OWXA 4OEHA 4RD0A 2OA0A 4BLVA 3EEBA 1FXSA 5E8JA 4E31A 2H00A 2DERA 3Q1KA 1G8AA 1K88A 1NC1A 2D0IA 4DIBA 4PLFA 1S2LA 1NP3A 3PPWA 4Z6KA 1Q95A 1M6VB 2R5FA 1I1NA 3F2VA 3WL7A 4Q19A 1GZ6A 3A9RA 3OD5A 4L9SA 4L9WA 2BGJA 3TG2A 5HFJA 3EISA 1PX2A 3MJTA 4XM0A 1IUNA 1V48A 1TJ5A 3T7TA 3O8DA 2H65A 4LNUA 2PZBA 4P4GA 4JENA 1K7CA 4Y2XA 1ACJA 2HLDA 3MWEB 5EUMA 4C21A 5C53B 1UC4B 5AVXA 1NYTA 2A9OA 1EBUA 2Z56A 3C7TA 3HMQA 4QXMA 3EPPA 3QVVA 1QIHA 1NN5A 1SVNA 3IEMA 3VJRA 2V97A 2CNDA 5C7LO 2RKBA 4YLYA 1BCSB 1K7SN 1ZOOA 4HN2A 2CT8A 2BI7A 2AC4A 5D51S 1IXKA 5TQVA 4DUGA 4C3ZA 5HRAA 3AHDA 3AHIA 3OECA 1H6CA 3KZCA 4KRYA 2XDAA 1KI4A 4RVNA 2OPHA 4BNTA 5ELXA 1PT9A 3ICPA 2I3ZA 1RLUA 5F3WB 1XAJA 2X4IA 3KL4A 5LNK6 3TNFA 1JI3A 1VXOA 3SFZA 1PNRA 1MJGA 3ISVA 1PEAA 1Z0UA 4PG8A 8LDHA 1LPMA 2BF7A 4HRVA 4RH3A 4WGFA 3C3XA 4WZBB 3UV7A 1CQJA 2QJOA 3CRNA 1W88A 3T9DA 4ASUD 3KVNA 13PKA 3QUSA 1N5IA 2VHUA 4NBTA 2IYWA 4GX0A 4RF5A 1R6UA 1U9ZA 5CXXA 3NM6B 1BOFA 4QUEA 4JX8A 1QAQA 4KREA 4LRXA 1E1KA 3CH6A 4WOBA 5A5EA 3IBCA 4J16C 1TCAA 2XMCA 4KPYA 4IJQA 1F0YA 4KQJA 4C05A 5I7OA 3S1LA 1RWVA 5JISA 4ZQCB 3EGXB 5KVAA 1QORA 1NJ5A 2FUEA 1HT3A 4JXZA 1DV2A 3ZIAA 3STXA 1K7YA 1JQLB 2WJAA 3VNAA 2VCYA 2LNDA 1MW9X 3LL4A 1R0KA 2SKEA 1JFLA 2H07A 4I08A 4XPIA 3ROEA 4C87A 4GW3A 1Q44A 2QY9A 4DUPA 4OH7A 5GGYA 1TIKA 2Z4TA 4I1SA 4W1QA 5CM8B 3LQ1A 2FVYA 4WECA 5I6DA 3U48A 4BNKA 1B8PA 3R7DA 3WLSA 5BNIA 4H16A 3QX8A 3KO8A 1JU9A 1ZONA 4DWJA 5HS6A 4J0FA 3A0UA 2F59A 5HQ3B 3F3MA 3IH5A 5ANRB 5IBRA 4JBIA 1L4NA 1JIUA 4BNMA 5LWHA 1BDJA 1YZLA 4IJVA 1FX0B 1R16A 4E30A 4IIJB 4F12A 4LXIA 4Z4QA 5FA8A 5CDHA 1O5OA 3MS7A 4LBVA 4F4FA 3T4XA 1WCIB 2VDRB 1ZGCA 1YNSA 2E4VA 2IP1A 1Z25A 3Q6MA 2OG2A 4W5JA 5EXPA 1THGA 4UAVA 3P7MA 5GIOE 5BR8B 4OB6A 3CR7A 4UASA 2WWVD 1NNSA 3K6SA 2J3JA 2EJBA 3DULA 3LNTA 4L0QA 4QWWA 4IIBA 5BSKA 4P5DA 1DJMA 4GMDA 3DWGA 1SCUB 3CINA 2ETXA 1WZCA 2O8CB 1G6KA 5FI0B 4BLQA 4YCSA 3H1AA 1M73E 3MYYA 2RHCA 3N75A 4GPD1 4J0KA 4U2GA 5AIAA 5EOVA 1HQKA 2GFQA 2XW6A 3FOBA 5HJ7A 4ZAWA 1GZ4A 4TTRA 4UCFA 3AHCA 2HBZA 1JJ7A 1CJSA 1IJBA 2W37A 3RIMA 4BXOB 4P5PA 2C4TA 4ND2A 1NXVA 1KMHA 3T52A 3HZZA 3E84A 3JASA 4YAFA 4DB2A 1XCBA 1Z38A 3UXYA 2O8BB 4B73A 5G1PA 5KJFA 2VSNA 1P91A 4PZ0A 4UNQA 1W5SA 3GRAA 4LWPA 2XHZA 3L77A 4IDGA 5LP6F 4AJ1A 5F78A 1J20A 4X24A 1Z16A 3N5KA 2FX3A 2R62A 4MO2A 2BFEA 3ISJA 3KXLA 2QG6A 3HV0A 3CPJB 3LC0A 3B2EA 4YCLA 5I4CA 5JAZA 3FB4A 1XTZA 3SC2B 2EZ8A 2O7SA 3U49A 4BQSA 2Z6AA 4TLCA 1QLHA 1XTTA 5CMLA 1LRLA 3NOQA 1N8KA 4L72A 2J9ZB 1Z37A 1YBFA 1Z4MA 221PA 4PU0A 4L16A 3L43A 3BM5A 1AF4A 1GKIA 4UHHA 4BNDA 4YAKA 1UKCA 3U9LA 1CFJA 1JQ5A 1OAAA 1PR4A 2DYKA 2XUOA 4KR9A 3MSCA 1CUXA 2C4VA 2HHJA 1F2UA 2XDWA 3LYUA 3NXKA 4G6ZA 4Y0AA 3TX2A 2C94A 2GD2A 3IURA 1CUFA 2C58A 3JS5A 3NVMB 1Z74A 2VUTA 3QU5A 4NK4A 1T4CA 4GMXA 4L78A 9GPBA 3DKIA 1VL0A 1DP4A 3WC4A 3VZPA 2IBTA 2JARA 3G5MA 4DR2B 5BUSA 2EZ9A 2V54A 4EFMA 1SRRA 4KMMA 3VH4A 4B32A 1WQ1R 3I9JA 2AC2A 2AOVA 4I36A 3HLYA 3NP7A 4S1OA 4B79A 2W6ID 3ENWA 1JLSA 4W63A 1RC8A 3TSOA 2IYUA 1RWOA 5GONB 1NZJA 4F4IA 5K01A 1ZD8A 2B6NA 2BBWA 2DFKB 3EVFA 3LMKA 3L6UA 2EDCA 3UXEA 5HW0A 1J0EA 5E6SB 4QXRA 5IVHA 2Y9MB 3SZLA 1NU8A 1CHDA 2BMEA 2X77A 2XUFA 3MFQA 5EC8A 5IAEA 5BNTA 5HFAA 4DM7A 5A6VA 5C1DA 2Z2XA 4Z49A 3AUUA 4DCOA 2IEYA 1T3ZA 3OEHD 2BPOA 1MD9A 2G07A 4NFSA 1ZIOA 2FPIB 3CA8A 2XXBA 4JBLA 4JT8A 5DULA 5AXDA 1V25A 3K72B 3EODA 2O3SA 3SYLA 3NHJA 4ZI7F 2QOEA 2QYTA 4L2IA 4TRJA 2ATEA 2E3JA 3BSYA 4KLZA 3W2HA 1GKLA 1B4DA 5HUHA 4Q9HA 1WU8A 2F9FA 3L6EA 4HDAA 5ERYA 2AJ8A 1ZM4A 1HETA 4EW2A 4JLPA 2PU7A 3A06A 1DAPA 1WZUA 3H1FA 5F5NA 5DNVA 3SJZA 3NHKA 4PINA 3DVSX 1I4LD 5FYDA 4PQEA 1DOHA 3FETA 3EF3A 2LP4Y 1FUYB 3K4HA 1T1GA 2QL5A 5JVDA 4R0NA 4OHYA 5AJHA 3RAPR 1G6Q1 3KT0A 4PX9A 4P0QB 1FP6A 4BO3A 4QHYA 1SCNE 3AF5A 5KAPA 3WLJA 4CLOB 5AVVA 4ZOAA 2E4UA 1DBWA 1D2CA 4N5NA 2GZAA 3LZCA 5E8RA 3U37A 4TYMA 1OB5A 5CYPA 1JXAA 2QBYB 4KE9A 3IXMA 1LTKA 1ZL0A 3V4PB 1KJ8A 2F8LA 4H77A 4ZREA 3I9LA 4P3OA 5DEOA 4D0RA 5I5GA 2OFPA 1B1CA 3EC1A 3H7AA 4CF5A 1E2HA 3F7OA 5CFPA 3ABZA 4ZFNA 3VPDA 1TXGA 1XVUA 2VCEA 5M7EA 5CFOA 4M6WB 2F1KA 3ROZA 3K31A 5GP1A 3RARA 3UMGA 3W04A 4XGKA 1CV2A 1GL9B 2YXPX 4QT0A 2QPAA 2IH4A 2G71A 1BWQA 1CQWA 3B20A 4B80A 4CEIB 3W5SA 3UAXA 3FBWA 3LNCA 2VAPA 3U9SA 1V6CA 1BG6A 5K8VA 4P34A 1YGYA 1WEKA 3G6KA 5G1OA 1JA0A 3Q9SA 4LHXA 1JHXA 2CFTA 1L3IA 1DIRA 2FFAA 2GLTA 4ZOLF 1OF1A 2QTNA 2ZT7A 1DPGA 4IIXA 2DGDA 1TUGA 1L4GA 4JD5A 5H3HA 1D2AA 1MV5A 5FOSA 5LMNB 2XMDA 1N0HA 1NTRA 3WNZA 4AO8A 1RTKA 3ZJTA 2G3YA 4A2WA 1J21A 4MVYA 3EF1A 3CRMA 1T13A 3BWVA 4IEIA 2HIGA 2Z1NA 3LUJA 3MJDA 4G1VA 1U0HC 1OTHA 4Z9FA 3OWOA 1S2DA 3C3PA 1ZM9A 2VR1A 3HYCA 4WJKB 3BE4A 2QVXX 1YS7A 5EMNA 5JMPA 4E12A 4AXXA 5AK3A 4JHLA 1NG9A 2EEPA 2QP3A 3H9GA 5DLQC 2KJQA 3X2EA 1ECJA 3UPUA 3PFIA 1GP2A 4L0MA 2G9VA 1OD6A 4KI0A 3IXQA 4D6XA 2OL4A 3HBNA 3KTOA 2PBRA 4DADA 3L0BA 1EXWA 4HB0A 5ALDA 1X19A 1WMAA 1EBFA 1SCDA 3U5TA 5IHXA 3L82B 4GM1A 1NXSA 4MP3A 4YGXB 5HK8A 4CI0B 1KH1A 2CNOA 4EEZA 4ARCA 2JHCA 3PR1A 2UXBB 2VI5A 1G63A 1X1DA 1GNLA 1KP2A 1RQLA 2ID4A 4BVAA 3LCVB 4IDFA 5AVYA 1KF0A 5DTJA 4NK5A 4CQLB 2YN4A 3MUEA 1UDXA 3WNVA 4CPDA 3EB9A 3KJXA 2Z5GA 1L5MA 2QTAA 3DEZA 3QIAA 1RLOA 2W11A 4UTNA 2B1GA 2I62A 4AJPA 3EW9A 5J63A 4AP5A 4FE4A 4D74A 3BH6A 1CR2A 4IVPA 1ISPA 1YR7A 1TYZA 1W9MA 2VF7A 2VLIA 3AW9A 3EEIA 4G5RA 4OFBA 4YV2A 1IL0A 2VSYA 4U7WA 5IZCC 3SR3A 2B69A 4B4OA 4W6ZA 3LIIA 1N92A 1QR6A 1XCLA 2TYSB 1OFUA 3DFIA 4HAYA 4MYRA 3V3TA 4BRUA 4RA6A 2YC2C 2H7CA 2X5KO 3OLQA 1QHNA 4AJHA 1U7TA 4G0OA 5F2KA 3T15A 5AVUA 3V2UA 3VXKA 5CDUA 3FUCA 1SXJE 1PJBA 2R9VA 3ER6A 3N3AC 3OLWA 4P98A 2IOYA 4CMJA 1B0UA 3B6EA 3UT6A 1W4BA 1BYIA 5A6SB 1EDZA 2P4EA 2V6GA 1C1DB 2HW8A 1R8XA 5HUQA 1MIOB 2H9AA 2GBCA 4UFNA 1PQ4A 4V0SA 1VJ1A 3OI7A 4UUAA 5TPWB 3WWDA 2UVPA 4ZXPA 5KINB 4OI2A 3E27A 3HCCA 1DTWA 4LISA 3K1YA 2W4IA 3NCTA 2WM8A 3ZX5A 1R6TA 1IY9A 1YL7A 1SBHA 2CWWA 3D8NA 5ITVA 3VVLA 2WK1A 1NBIA 3R0QA 4KTVE 4NFYA 4ARBA 3ANTA 3U56A 1PFQA 2ZRCA 3INYA 3BL8A 2XADA 2Z2IA 4YJHA 5H4HA 4KQ6A 1FDSA 4J91A 5UKDA 1UOEA 2YJZA 4UUBA 4P84A 3FCXA 7GPBA 3I04M 5TIIA 1JA1A 1EFTA 3DMTA 3PL5A 5A03A 4FW9A 1DMRA 4B31A 1R66A 3UBMA 1R0RE 3KQTA 4RFLA 3FRIA 1D6MA 4K9OA 3ZUGA 1DT5A 2REQA 4FC6A 4Y9DA 3RS3A 1QLJA 1T8RA 2C00A 5KREA 1RW4A 3SEFA 1XKTA 1I4OA 2WKSA 4O2BB 4GZ3A 2DCUA 4GRDA 3DD5A 4YJ2A 1ORIA 4TN1A 3NNSA 4EMSA 1YNOA 1N9ZA 3NG1A 3BZWA 1T35A 2POCA 1MXFA 4JJGA 1F2VA 3M4NA 5IX8A 1VMIA 4QT4A 5KJEA 1TVKA 3GEPA 5J4HA 1Q19A 3OP4A 3LY8A 3SZRA 3OUTA 1EAYA 1NQ5A 2B25A 1FFAA 4KQXA 4EPWA 3LVBA 1LQTA 3OQNA 1QIKA 1UEIA 2W9XA 2D1QA 3TZQA 1PJ3A 2OHOA 3L6CA 1MOPA 3OCXA 2FPWA 4EQ6A 1JTVA 1YCDA 3TKLA 1HORA 2CF5A 1Q7CA 3ZWPA 3K8QA 3P19A 1F14A 1NUAA 4LZAA 4ND3A 5BSHA 5AXBA 5AJYA 4Z7QB 2XA9A 3F9CA 2H7VA 2Z8YA 2A86A 2JK1A 2OV3A 2Q27A 3K05A 3F97A 1G5QA 3CXUA 4QJ5A 3CEJA 3EIUA 1FX1A 3FCUB 4XWKA 1T1SA 4M1SA 1YR1A 2OOKA 4KB5A 3P2EA 1O1YA 2X9LA 4Q6WA 3KVOA 2C7GA 4NMMA 1XZAA 3WICA 4CMIB 3INNA 1UJMA 1P4HA 1STOA 3BVPA 4KE6A 2CLOB 2JEOA 3VUFA 1IZ7A 1SUFA 1J49A 4WZ6A 1TPZA 4XIJA 3N9IA 4IM7A 1VFNA 2DBYA 3VKHA 5BN4B 3RRNA 4GC9A 3NC1C 5LYYA 3GJRA 1V35A 4P4NA 4EYSA 5JDIC 4FHGA 1N57A 2B9EA 1JFFB 1WIWA 3LHDA 3CKKA 5IYZA 3RSHA 5INTA 1V3QE 4X7RA 5I9IA 5HMMA 1KI9A 3Q8MA 2ORVA 2OGSA 2PGAA 4LJ8A 5F73A 5GWXA 1RYEA 1YQ9A 2NXCA 3B13B 5HPYB 4TWAA 1UXHA 4I3FA 1C3VA 5AKXA 3ZZTA 1Y3BE 1ITZA 3AR6A 3O7MA 2KWIA 1O95A 3FXAA 3K9BA 3ZHOA 4NJMB 4NG5A 5TS2A 4NBKA 5C8XA 1UJCA 2P77A 1IY8A 1OX6A 2PRZA 1R6VA 3ELWA 5DCUA 1EUYA 4JSYA 2QPTA 3DBOB 2YJ3A 1JG1A 2NVUB 3HYTA 2H1RA 1LFDB 3LBAA 3H87A 1KFEB 2BF4A 3WHIA 1DAGA 3W34A 1I3NA 3GG2A 5GAJA 3NLLA 2WT8A 4XASA 4B82A 5I9TA 2ZR9A 5BVGB 3G79A 1U0NA 2OCXA 2QPLA 2YIVX 3EFHA 3I9V6 4LNHA 1ULHA 5E3JA 2Z2KA 3WIVA 4CV1A 3JD3A 4CIYA 2H2GA 4HVTA 3NANA 2A3NA 1KK0A 2FW9A 4LTNA 1LSSA 5DM4A 4BVFA 2DBQA 4QBGB 2CVOA 1D3AA 4GSLA 4WK2B 4GGMX 3RAGA 4H60A 2HRZA 4C1NA 4ILEA 2IGBA 1H3NA 1ZK1A 2AG6A 5ESWA 5AYVA 2CGEA 5IJ9B 3GBSA 1AQUA 3U31A 3UCXA 1NJGA 2JS7A 3C3DA 3IPLA 3FSGA 4CKWB 1ST3A 3KZ1E 3RRXA 4DG9A 2PUFA 1D2GA 3K15A 5ED0A 2XNKA 1Z6GA 3ABIA 1XHEA 3BFPA 4CV0A 4YHHB 2WWHA 1PFYA 2VRCD 4IQFA 3VPGA 1EFLA 3HNPA 4RLHA 5J23A 4UHKA 5KOHB 1AVTA 5EXSA 1YS6A 3U39A 3PDIB 1DG9A 1MOQA 3IV6A 5G0SA 3PIRA 2I3DA 3C7KA 3R6GA 1NPTO 3W06A 1F3LA 2M1XA 5EWLA 4C0LA 2XE4A 5JFGA 3CMCO 2HQRA 3QENA 3Q9NA 3QELB 2BJVA 4FWTA 4BFSA 4TVSA 1AZSC 3PGA1 2WE8A 5LB4A 2EC5A 2FOIA 2VJLA 5DK4A 3UJ8A 3JQGA 4JU9A 3IKTA 2VAWA 3D2BA 1P4AA 3F5SA 1K8XB 3OFSA 4E15A 3HTXA 3GX1A 1W2GA 4M98A 5HWSA 3A4LA 4N6GA 2FW0A 5K0BA 3NGMA 2V3WA 1WETA 2VPXA 3KUCA 2QZ4A 1MGPA 4JP5A 4KE8A 2HU7A 3G0IA 2PKQO 2P65A 4QUGA 3F4BA 3H5WA 2HZBA 2JD1A 2ZSBA 2DHRA 3AR3A 3OIGA 4OXNA 4UAJA 2C3OA 3V32A 1SQGA 3MJCA 1HT2E 1FS6A 4B9AA 4XQGA 4OQEA 1VKOA 1BHJA 5JZ9A 1BMTA 1G3UA 3I1YA 2OP0A 2QYOA 5KMGB 3IOYA 4Q01A 2G8LA 3MN1A 4MDHA 1B8UA 4CIAA 5ITWA 4TYYA 4GI5A 3T0FA 1L7QA 1XHLA 1Y6ZA 3K53A 4C2BA 4I7EA 3TTSA 3RG2A 4BEWA 4A8JC 1HT0A 1IOVA 2WU8A 5DI3B 3GNSA 4QPDA 2YIDA 3CM0A 3PX2A 1MVNA 4RSRA 5DP1A 4ZVVA 2PN1A 1II0A 2VSQA 1Q22A 3QOFA 4FHDA 2Y93A 2VOEA 2VHZA 1HL3A 3UIEA 5B4UA 1FXUA 1CR1A 3IVCA 3PDJA 3SSOA 2ERXA 2ZWAA 4KKXB 1MH1A 2ZJ2A 1USKA 1ECGA 1ZHHA 3FWPA 3VR2D 1H05A 4A7PA 3NBAA 2X19A 3NKVA 4O1HA 1BA3A 4BWFB 3J7AC 2XD4A 4LKRA 4EOGA 1TAGA 5HBGA 1GAWA 2CEKA 3DPSA 2ZZKA 2HMSA 4WJZA 3W6NA 3RADC 1AS2A 1TNDA 2W83A 3ZI0A 1YFKA 1XZ8A 3TQCA 1DTSA 4BATA 3QHQA 4TV8F 2ZAGA 1IJKA 2VBCA 3EZ7A 1FW8A 1Y6QA 2BCEA 1LF5A 1JMKC 2J9YB 3FI9A 4P4TA 1TTQB 3TPZA 3U26A 3UAYA 1FXWA 1BKYA 1WUIS 3FLMA 2N9UA 3UGKA 3H2JA 3WLMA 4LE0A 5LDHA 3AP3A 3VC1A 2GESA 3ADPA 3LSTA 1PUXA 3EVGA 3LXMA 4V02A 3VHQA 2QXYA 3SOPA 4PFQA 1HKHA 2ZUDA 4WWHA 4BL5A 4HZIA 1NBEA 1X1TA 2RGUA 2A92A 2QAJA 1BVHA 1W85B 3ZGXA 1GCUA 2WPDD 4D98A 1YE5A 1MDFA 3GN1A 4W1RA 5GJCA 2HO5A 2O5RA 2Q2NA 3MD9A 3QKRB 5HE8A 4L4SA 4QBIA 1U3VA 4R8KA 4ESHA 3GLHE 5CT8A 3WLAA 2ANBA 3RVLA 3IC5A 2KE5A 1YIAA 2RGCA 4Q4HA 5JNSA 3OJ0A 4NCXA 3OT4A 4XRRA 1T8TA 2XF2A 3ENZA 3WRYA 4DLTA 1J39A 1DB3A 2ZTHA 3JQBA 1NQOA 1OC2A 2PMDA 4X71A 1IZ8A 5I9LA 1CDDA 1EFVB 3I2GA 3IA2A 3I9KA 4D41A 2G1UA 2H57A 1T2UA 3E3MA 3FGZA 2H9IA 2NTVA 3P9KA 3H2BA 4EL5A 3WJ2A 5EMKA 3E4CA 5K7SA 3OPXA 1PZHA 4RF2A 2HC9A 2AJBA 4B8YA 2YBEA 3S1SA 2O23A 1XB2A 2VATA 5LBTA 2YKGA 5HZMA 5CPBA 4FB5A 1Z08A 2GK4A 3K2QA 4ER7A 3H4MA 1Q74A 4CDNA 1YFJA 4LMRA 5LP6B 3A70A 3RJMA 4EX7A 2D0OB 1G66A 1SQFA 1GTJ1 1V39A 4H3VA 3GMSA 4DB4A 4BTLA 2A9FA 2Q2OA 3CN9A 4LJ4A 3LFHA 4EPXA 3IR6A 4RZUA 5ALHA 1IN6A 2O3UA 3IPYA 4ETIA 2V9CA 3CNNA 1I1QB 2O07A 2ZRPA 1XZMA 2C2XA 3IBFA 4S0ZA 3RVBA 3EY9A 2PWAA 1ZNQO 1J8FA 4NLLA 1XVTA 3AHJA 4CKZA 4QD3A 2G4LA 3AIKA 3IQDB 1A0OA 3HWX1 1UPCA 2GKGA 5C3MA 4DG5A 4JQOA 1GAJA 5CR9A 1QHHB 3T7EA 2O5VA 3WNDA 3X1DA 1COWA 4XLZA 1M6HA 3D3WA 2YY5A 3GFRA 5ALMA 4E94A 5CA0B 1ZAKA 2VHVA 1ZI8A 3IOMA 4HXYA 3JYLA 4X0EA 3IA7A 3SZOA 2OBNA 4FHFA 2YVUA 5CFRA 4YCAA 1I6LA 1CUVA 1XVLA 4HDNA 5TQ2B 3BEDA 2VCHA 4X6YA 4ZDIA 3RH0A 4CQJA 1NYLA 2DPMA 2YS7A 4YACA 1TX4B 4QU8A 4DJJA 1ZSYA 1MF7A 3AB3A 1AA9A 2I2AA 4CV2A 2G9NA 3S5UA 1IUKA 3SQDA 3BFVA 4ES6A 1H93A 3RC8A 2GNPA 3CQ9A 3LY7A 3FMPB 4ZT5A 4Z3OA 4IBOA 2WAYA 4EHJA 3NEPX 4ESVA 3JARA 1UC5B 1FOEB 3NHUA 3NUGA 1H0KA 4Q4JB 1NI4B 3V8QA 3E2IA 2V58A 2ECQA 3B3GA 4PTYA 4RVCA 4HNUA 3TDMA 1ANKA 3QQ5A 5ERGB 1FMCA 4ETWA 4BPBA 4NBRA 3OIFA 1VE7A 2FSPA 4TKUB 5KDLA 3BTVA 3EGOA 3RBVA 4URVR 3P0JA 3D4BA 3BQMB 4G4SP 2GPBA 2P4UA 1KO7A 4LV8B 4XIGS 1LBHA 2BN4A 6ABPA 3GJ0A 3V4FA 2IYAA 1G7CA 3F6RA 4ZICA 1SKQA 4MMXB 1Y8QB 3ESBA 5FXMA 1JWBB 1L7OA 5LZ8A 4D9GA 4INOA 2X0RA 4GPIB 3CXRA 1IH8A 2FU5C 2ZUSA 1XEAA 4ZRNA 4MZXA 4HH3C 1QGOA 5H02A 3AG5A 1WZ2A 1CZLA 1N3LA 1N2CB 3WP0A 2YZ7A 3CH4B 3AY7A 4OXRA 1Z6XA 4RAQA 2P9HA 1HTTA 2WYIA 4XRGA 4Q1VA 2NO0A 1R12A 3K0AA 5M2QA 3I8OA 4ARVA 5BWOA 1SEVA 2RI0A 1DJNA 4QGFA 3L84A 1E2GA 5T4HA 3CWCA 5DYWA 5CBPA 3Q72A 4YJ3A 2Z9DA 1SCJA 3C0KA 3D8RA 4ZGGA 3L8FA 5EZYA 2ZIWB 3Q11A 2OC4A 2W5UA 2KLBA 3USES 1H9AA 2ATIA 1QJ4A 2JNWA 4MVJE 3PGVA 2QMYA 4ZVQA 2WZDA 4CDMA 2ZBFA 2IPXA 4D8UA 1HR0B 4JGBA 1XTJA 4FP9A 1CJTC 4BO0A 3WGTA 1FUKA 5THKA 1KZ7B 2Q7XA 4BWGA 2ZJFA 1JT9A 3X1WA 2ERCA 2WF7A 3QBJA 4RZ3A 4IEEA 4MR7B 1KFJB 1BJTA 2CMKA 2HSEA 1N2IA 4AVYA 2JJ1A 3FUXA 4REQB 3PFCA 1QLWA 1IU9A 1XQVA 3KTDA 3DHEA 4GXNA 3TCNA 2X1LA 1KZ4A 2Y0CA 2I2CA 2VWPA 3SSAA 1DC6A 1PN3A 1M8PA 1N7JA 2JKVA 3VYUB 3R9XB 5FL7D 2IUEA 3H2KA 2J3EA 2ACEA 3FFBA 2BH9A 2PL9A 4ZU6X 5K1ZA 3FYUB 2JI4A 1ZFNA 2G5CA 2DH5A 5H5JA 3JQEA 4ZOLB 3I3OA 5BQPA 4BLOA 2CV0A 3EUWA 2FG7C 4HUJA 5AKLA 1M34A 1DUSA 3DFUA 3RK0A 3TUZC 2FHPA 3IHKA 1L4FA 1KVTA 3UXMA 3CBQA 4I5DA 4IJMA 4JYPA 3J81k 3FNQA 2JASA 2O48X 3KYDA 1E0DA 3MCUA 4R9NA 3WBFA 4EG7A 5JAIA 2ORED 3VGJA 1T2NA 1Z4OA 4RLFA 2XTZA 5LQKA 3EZYA 3QSGA 1QHGA 3D81A 5ALLA 2R96A 1L7RA 1GDDA 2CL6X 3AVYA 1WXXA 2UDPA 3A2NA 3RU2A 2QG4A 1GUAA 2OK8A 3GVPA 1XQYA 3JY6A 4K88A 4HBZA 4B4VA 4RIHA 4IGFA 1DQYA 4U9IS 3QNUA 2XWJI 3A4YA 5AM3A 4F6RB 5ADWA 3KELA 4JY7A 1J33A 2WUDA 2R66A 1QZZA 2ZIVB 4DPLA 2QQ0A 1VRCA 1FYEA 1UZUA 3BK7A 3L8YA 2WJHA 1N6LA 4DQDA 1CXZA 3EIHA 5FKJA 4DY6A 1PG5A 4NXMB 5TQJA 1FSFA 1IQRA 3CZ4A 3RRFA 4ADSG 1G5FA 1MPXA 1A7UA 4BDTA 2VT2A 4IF6A 1QYVA 2QRNA 3IKVA 3WIDA 4WNAB 2UYHA 1MKYA 3O93A 2I1WA 4M86A 1BHSA 3HYLA 4NNOA 5MHTA 2I4RA 3AVPA 4E5VA 5K5EA 4HRAA 5EKSA 4EB6A 3HGMA 2HHLA 4CRWB 4P4LA 2A5LA 5TXGA 2XKJE 3F6EX 1NW3A 4OOFA 4R1SA 3ZWDA 3ZWNA 4OP3A 1F1BA 1MGOA 2V7EA 3UUWA 1LPNA 1N1DA 4IJWA 1NATA 3C8DA 3O5AA 4U2CA 5AXCA 2M1ZA 4BO7A 1VJGA 1JR3A 1JQ3A 3DE1X 3GT4A 4C4AA 3CISA 3G17A 2FA9A 2FR0A 3CLUD 4TROA 4TQUS 4YUVA 4OQQA 2XCTB 4CTJA 3ZIUA 1PNTA 2Q3BA 3OO1A 2Z4RA 4AG6A 3WZLA 2J0QA 3GAMA 1YZNA 2HGSA 2WJGA 1O94A 4DSAA 4FC7A 5F76A 5BW6B 1XA4A 2YV4A 1GGFA 3LH5A 1VFPA 4RD6A 4ROTA 2V96A 3RS8A 3NEAA 2V98A 4RV9A 4ZOBA 2HBRA 3X43A 1ICIA 3GXBA 4PX2A 4IYJA 1N8SA 3LF2A 3RJZA 4MWEA 4ZP1A 4JI3B 4PFSA 1UOOA 2FFRA 2LCQA 5EVJA 4BPRA 5AVQA 2XGOA 4K8OA 3WMXA 3EGCA 2ES4A 4LY6A 5E7JA 4COOA 4EGAA 5A3QA 1LS1A 2Q3JA 3I6IA 1SUCA 2PSJA 2QUAA 1RXEA 5H81A 5TJ9A 3W5IA 2QSZA 4JV5B 3NM5A 3B1KA 3V97A 3IPAA 1PL7A 3UNXA 2I0FA 3UQYS 1R10A 2B92A 4GHWA 4BVGA 2HNKA 1RADA 2OMKA 3IMCA 3KOOA 2JBWA 4DA8A 1KR5A 1YRLA 4KN5A 1YB2A 3NYQA 2QG9A 3R77A 4XOIA 3N2KA 2BR5A 3N76A 4MV9A 4BFZA 5GZ1A 4D92A 1IN1A 3B7WA 1GY8A 4CXMA 3E18A 1KJZA 3NYWA 3PR2B 1R4AA 2I54A 1SURA 1QK4A 2ZAMA 2PKXA 4EABA 3DDNA 2F7SA 2CB9A 3M5CA 2BM1A 3TJZA 3ZBPA 1LNSA 1N3BA 1CHNA 4HH1A 4CMEC 4WXPA 1EH5A 3BICA 4HS9A 1GQRA 3RS2A 2V0GA 4EPRA 1W96A 3DAFA 1I8TA 5L3ZA 5I7RA 2IS6A 1CP2A 1C30B 3ROPA 1Y6GA 4LA4A 5ENVA 3VOTA 2I7VA 2I2XB 2OFXA 2FSIA 1R0XA 4IJUA 4ZYVA 1L9KA 1X87A 3TINA 1CZKA 1E69A 1GG2A 1H3EA 1U8FO 4M8NE 4QGBA 5CUQA 4URXR 3UJHA 1TM7E 3H1GA 4QYIB 5GTDA 3QKSA 5JNRA 1J23A 1W48A 5A71A 1JEOA 1YVDA 2VKTA 2WLTA 3AU9A 5KWVA 5ARDA 4LOJA 3DQPA 3DFFA 4G1EB 1L7AA 2G08A 2WE7A 4QBHA 2BVNA 1EDOA 3G8AA 3TG8A 4AZSA 3W9BA 4UUOA 2AOUB 1LK0A 3CKYA 3CLKA 4KUEA 5IDVA 5CLIA 3SJBA 3THOA 5KTYA 1LLQA 3LRTA 5ALUA 2VEOA 3CZRA 3FWNA 1MT0A 4WH0A 3V1KA 4RE5A 1OA1A 2I7CA 5KOJB 4BKQA 2XNCA 4UDNA 1QO7A 1ISMA 4RV4A 1SUBA 1GPMA 3LD9A 2WD7B 3R8CA 3GH1A 4YWHA 3UK6A 2JFOA 2CEAA 3OM8A 4GX5A 4J7AA 2PUBA 3TKYA 5IM4F 1TDJA 3IPRA 2Q7OE 2IH2A 1UXOA 3INTA 5JFTA 1YK1A 2JF0A 2XB8A 1IY2A 2JI8A 2ZRJA 3EMDA 3H5VA 2XYGA 4JDPA 4KXQA 4AJ2A 2HMYB 4PZDA 4QAJA 4I55B 1LTHR 4OK6A 1M83A 4FGUA 2BT4A 4D57A 4UM7A 3N0XA 5DHRA 3U5ZB 4DDHA 2DBRA 1NQTA 1XC7A 3D6MA 3TZBA 3A58B 4DQKA 3CN7A 1J2TA 2QMHA 2DJIA 2WTAA 2YZMA 3OIWA 2F43A 4DVGA 1QE5A 3LT4A 4DLPA 1DHRA 4FZJA 2EX4A 4UUNA 4E46A 3BSFA 1M75A 3G9QA 1FFDA 2V7GA 3SK0A 3K1JA 1JXQA 5TPZA 1NSFA 3CG0A 1J0CA 4F85A 4G85A 3TAXA 3V7FA 1RT9A 4PNHA 1ZR2A 2AW3A 3GGGA 2YFYA 2VL7A 1MDBA 2YN2A 4LMBA 1JWAB 2P8SA 3M1IA 4L02A 5CVJA 3NPMA 1KU0A 3MW8A 1N6KA 1XZDA 1KE1A 4P3NA 2C4WA 4DABA 1MLDA 1V16A 1C3OA 2ET6A 3EUEA 3S4YA 5L4LA 3HCWA 2AEEA 2AJTA 5KQLA 1WS6A 3B1XA 2E9SA 3I6BA 4YP5A 4PHCA 3TTUA 1BKDR 3CT6A 3DPUA 2VH5R 2AFIB 1AS3A 1J7KA 1A04A 1QVVA 2D1RA 4UDXX 4HQ6A 2DPYA 2QJRA 4QOFA 4UHJA 3VKGA 1PJ2A 2HPVA 1YDFA 4TSFD 2EBHX 3LT1A 3HP1A 2QGFA 1KFKB 1XFDA 4XUGB 4BO2A 1LPOA 4M99A 4N6OA 1KPGA 3WMRA 2A9VA 2Z8XA 1T2FA 1J22A 3ZUPA 4AC9A 3ZTYA 2SECE 4B09A 4F84A 5JECA 1TEHA 4X97A 3UKDA 4BB9A 2P9EA 2QDKA 5JC1A 2BCJQ 1QYRA 3V4SA 4IZOA 5D87A 5ARBA 4V0QA 4ND8B 2I3GA 2OXFA 3GK3A 3H04A 3RBXA 1CG6A 1X7ZA 1V8OA 2XMSA 1BEEA 5FUXA 2ZWVA 3K5PA 2IBSA 3CUTA 3JSXA 1IBSA 3R5XA 4WDQA 1U3UA 5BSVA 4WLNA 2VNKA 4BQOA 4JJKA 1TU0A 1RJFA 2J31A 2P8JA 1NXPA 3H5AA 2DUJA 4UM9B 1ND6A 1Y3AA 2IYOA 2O2GA 1X7YB 1YKGA 2PXXA 2W4MA 3ZQJA 1V8FA 4L1KA 3PWKA 3PFNA 2CC2A 5L4SA 5JS1A 1F0PA 1ZISA 4Q03A 1TKRA 4M76B 5FOWA 3SU8A 1KZYC 4KFTA 4KRXA 2ZYVX 5FJJA 5E0KB 3RLIA 4BIIA 1VYVA 2AE2A 3WISA 2E5WA 3TNDA 1KI8A 3QX9A 5GZ3A 1AKTA 3EIWA 4E0BA 1HQYE 3W4JA 5K4HA 3MTBA 2JA1A 1TADA 1H4VB 2J5BA 1OXUA 3C6ZA 2F8SA 3ENNA 4ZU1X 2X0FA 2RGNA 4A1OA 5AKHA 1RU3A 4MH0R 3SNHA 4B3JA 2PLAA 3DAPA 2EQAA 4CKYA 2HYIC 3UGQA 4AKSA 5C1OA 2NTEA 3GCDA 3OOWA 1E0JA 1FF9A 3DB2A 3W9YA 2NUTB 1XU4A 2O52A 1PDVA 1U11A 3KAJA 3AEKA 4LVOA 3OQIA 4Z9BA 1ZH4A 4YIKA 3SWWA 3RVDA 2JIZA 1E20A 3BK2A 4MKZA 3WLPA 2R25B 2TECE 4Q1EA 2ZXFA 2J4DA 1R00A 1NW5A 1P72A 3JPYA 5AJZA 2P0AA 3HI4A 2WUVA 3MNFA 4LZWA 5FX2A 1NVEA 2OECA 3ZVKA 1W1IA 4DSTA 3KPUA 3WLRA 3A1VA 1TZMA 3SC4A 2C9CA 1R0WA 5AW8A 1M67A 2WD9A 3CW8X 2XEXA 4OHRA 4KV7A 4RPCA 1AGXA 2HZ7A 4HMPA 4PO1A 4TS3A 2ISQA 1FNSA 1LJ8A 5CVDA 1WWKA 4GT1A 4HCJA 4IFBA 1JIXA 1M1YA 4L8GA 1ZQ9A 1AC5A 1S01A 1URPA 3G2JA 1EM8A 5JCJD 5A0VA 4EPTA 4AKHA 1BEUB 1ENOA 2JBAA 5F1OA 4ZZIA 3DF7A 4WESB 2FRVA 2IOFK 4FXPA 4MI6A 2Q1WA 2CMDA 5EJIA 2GPNA 4B3CA 2IEZA 2AFIE 3BGOS 3NHBA 3IQWA 1CULC 3EBLA 3WLTA 2BIFA 3DKRA 1V5IA 3G2PA 2XDQB 2VJCA 3AUKA 3VPAA 3WGKA 2QTVB 2YWXA 1QO0D 1V4BA 1XZJA 2H17A 1V3UA 2GCOA 4NR0A 1O95C 3HO6A 4F04A 4IH4A 4IS2A 4DCVA 5JNWA 1J0DA 4KXXA 4H6XA 2R79A 3IP7A 1VLZA 1RJWA 2GM5A 1N2SA 2LWIA 3TZCA 3OZSA 1G38A 3TTYA 3THSA 3F6CA 4BBJA 1OYOA 3NONA 4K28A 1MX3A 1ESMA 4QAQA 4CBVA 3M5DA 1NVXQ 3GGJA 4OHZA 1N2EA 3O74A 2CVPA 2XYHA 3EXEA 3NTLA 2O2IA 1O97D 3QEMB 2GWRA 1M8GA 1V1RA 1DI0A 3T9AA 4IRXA 4ZV4A 1CYEA 4WLFA 5CP8A 4DV6B 2D54A 3NDJA 3OLZA 4NABA 5LM3A 1NUPA 1YQUA 4LJRA 5IFLA 2JIBA 2X6TA 3LCCA 1C41A 1J8YF 2ZRGA 4CQNA 2OFOA 1TGVA 4N0MA 4KLCA 5FTWA 2N47A 3SHFA 4CN9A 1PGOA 1XKLA 2ZJ8A 3AR2A 1XZKA 1TECE 3A05A 3DEKA 1R8SA 1FFGA 4FFVA 4ZZ2A 3UH1A 2CHEA 4MW1A 3W2TA 1L1RA 2H7XA 4B4WA 5SYMA 1N33B 2I2BA 4KK3A 1RXYA 3MB8A 1UDAA 3LVQE 4OL9A 3L3BA 4BWYA 3PZRA 5BMVF 2OB2A 2AXQA 4MQEA 3G2NA 1OFIA 1T2DA 4HWTA 2EZUA 1WF3A 5A4FS 1L4YA 5JASA 1YTUA 3TI7A 4X91A 4GF5A 2H08A 4G3XA 4G89A 1Z0ZA 3I76A 1GNRA 1P75A 2H1LA 4IG4A 4LV6A 3TW4A 4EX6A 4AS1A 2ZYAA 4BE9A 4X85A 1BVRA 4QLAA 3NOXA 1MJ5A 1S02A 3GLTA 2A0XA 3K70D 2AOTA 4HTAA 3Q9UA 4FFRA 1Q84A 4WLOA 4EO7A 5E2IA 2I34A 1OPRA 5IN4A 4RETA 2WZBA 5DHUA 1CC1S 1TRHA 1XSEA 2WA2A 4RTOA 4LHEA 5FA6A 5B58C 2CL0X 4YDHB 4W9MC 1WPRA 3MM4A 4M9UA 1NQXA 3L7CA 1LBEA 4F4DA 4CCYB 1UBOS 3QE3A 3IVGA 3UVEA 3EA0A 2JLQA 2BAGA 3PPVA 4HR7A 4J0QA 4YA6A 5EJ9A 2Q2QA 2IW1A 1I7QB 1OAKA 1QPBA 3LXXA 3G7UA 3EXFA 4FX5A 1II8A 3ID6C 4D4LA 1GZ5A 4JYZA 1JJIA 1KIMA 3M2PA 3MBKA 4MP6A 4FFWA 3L8DA 3PJFA 4AJLA 2IYZA 2DY0A 3GCWA 3AERA 4B7CA 4BFXA 1LJLA 4U7DA 3QEBZ 1PEKE 2OBYA 3IP3A 2CFIA 3S27A 4HLCA 5JWOA 2O1WA 3FY4A 2GR9A 2AL7A 3HYNA 4A8TA 4DMCA 2WHPA 2BSQA 2ZRFA 3QXJA 2BEUA 2FUNB 4C4RA 5J2UF 1MEOA 4B7AA 3I6MA 3NASA 4EW6A 3WL3A 3NYIA 1D4OA 1B2LA 2C9YA 2I8LA 2QNIA 3BWYA 1Y8ZA 1SZJG 1WV1A 3DOCA 2YY6A 4OUKX 3S2YA 4IR7A 4IDHA 5IFKA 3O8QB 4C0XA 4DV4B 1PJ4A 1EDDA 1ZMTA 2H9YA 2LPMA 1U7ZA 1XDWA 4HTFB 5KYWA 1JG7A 3PC6A 2Y92A 1PDWA 3O47A 2MYNA 3QVGB 5T8KC 1YZFA 1NYRA 4OD0A 2I67A 2CWDA 2ILTA 3FPCA 2Z3VA 4KBYA 5ECDA 3TF5A 1ADFA 3BAFA 4S1PA 1J25A 4B3BA 3E2MA 3GMTA 3VHXA 3AEUB 1E1RD 4QARA 3A6FA 2ZAYA 5CHEA 4XQCA 4J76A 1XNRB 4II2A 5F2OA 1R6XA 5KYYA 4Z2AA 3ZHUA 4XE5A 1AXGA 2E89A 1GL3A 3EXHB 3RS0A 3FR7A 1FDRA 4N9WA 4ZPJA 2PAFA 5F5XA 3VR1A 4BEBA 5HX7A 1CY8A 4PYNA 2XZTA 1NV9A 2CUTA 1IN7A 1QGUA 3R6LA 1SCIA 2FDRA 2GN8A 1SCKA 2WU4A 3R3YA 4DLUA 1VIVA 3TR6A 3USZA 1NNUA 3HMKA 4WIAA 1W2WB 4C78A 4CLRA 5JAOA 1VKNA 5LMCA 1XMXA 5CT5A 4DMLA 1ZAYA 4L85A 1GSAA 2DETA 2PS9A 3HU2A 3O0TA 4UD6A 5KSWB 4FFBA 3BXEA 2JLZA 1USUA 4PQGA 3Q6IA 3WRYC 2VDWA 2APJA 1GG5A 3O8NA 5LU9A 2YCLA 3PE3A 2FTKE 1XJ5A 3NHWA 4OJKA 3RSSA 2X86A 1V11A 3F67A 4D5EA 3Q7TA 1FDIA 3AZPA 4JP8A 1B41A 4NVRA 3ONNA 4Q7QA 1WKBA 4DMFA 1R27A 3DBVO 3HCRA 2XTNA 4JJIA 4C7XA 1SO8A 2HDOA 4OXXA 4FZ5A 3UBTA 3BN3A 1GLGA 1MPTA 1F38A 3P27A 4IDAA 4UMVA 5IBPA 3UXHA 4L7VA 2B1RA 2P78A 1V5FA 3JZDA 4R3NA 5CH8A 3UAGA 4F21A 3AXTA 1XDZA 1WUHS 5JSYA 4TL8A 2YMMA 3T4EA 1E9RA 3FZGA 3TGWA 2EW8A 3M1YA 4MWTA 1CBUA 5EVCA 1HG1A 1DQRA 2UV8A 4PWZA 3GP5A 1TTPB 4JLNA 3GBPA 2X9NA 4F5DA 2I9KA 1T15A 1E3JA 1D6SA 3FWHA 3IAXA 1YB4A 2AI2A 2ZU6A 3OHMA 2SHKA 5IMBA 1QZ3A 5IXSA 5C52B 1Q20A 3NDRA 3L1IA 3EA5A 4MAFA 4ZQIA 3EPLA 5B1DA 2PZFA 1FFEA 3PRHA 1SU4A 2H0AA 3L4BA 4BV9A 1BD3A 4NRDA 3U44A 4A91A 1A4XA 4YN3A 1H2BA 1TEVA 4WMLA 4LZOA 2C82A 1ZNYA 5DM1A 5EG5A 1A3CA 3ZK9A 1TCCA 2QHXA 4WXEA 2WT4A 5AM4A 3RIHA 3C87A 3OCJA 4EJSC 1JFVA 2NPOA 3W9UA 4KSBA 1DDOA 1UK7A 1QV6A 4RPLA 3KK0A 4OYRA 4ONEA 4MKRA 1EP2B 3GCZA 4J90A 3I0ZA 3U9TA 1NE2A 1EVKA 2HHAA 2Y76A 3ZOKA 5BNZA 3SEAA 1KI7A 1KBZA 1FRVA 1YB5A 4IV8A 3JQ9C 4YBRA 4GH5A 3ROXA 4EZBA 4WK4B 3I1IA 4EQZA 1J5PA 2D5IA 3KSDO 3TQHA 2X8BA 1L1QA 2ACVA 3ZDCA 2VDQB 3L01A 3UAVA 4QICA 1ODIA 1GCGA 2OCPA 5LOVA 2F90A 2GOYA 3IP8A 2HA6A 4H7PA 2AK2A 1WPQA 2I6UA 4G2TA 3MJVA 5DASA 1FNBA 2EKLA 1LDBA 3E4DA 3SLGA 3UK2A 3DMPA 3UGTA 2V0NA 3U4AA 1XD2A 3L1HA 3ERCA 3D4PA 4L3VA 5K8UA 5A4IS 3MQ2A 3RJ5A 4L28A 1PGNA 4C7VA 1YU6A 2QTBA 3GOHA 3IPXA 5ENZA 3CEAA 1I30A 2C2MA 1RBQA 1N9GB 3SSMA 3EZ2A 1N4AA 4A0RA 4QM6A 5JAUA 3JR7A 5H9VA 1V26A 3CVYA 1KAEA 3OA2A 1Z29A 4WV3A 3U3MA 3BRSA 2C8LA 4N8SA 3DW3X 3TYXA 5TY0A 5BWBA 1H2XA 1BH2A 1JIJA 3DV0B 4UW9A 2NZ8A 2GI4A 4QOIA 5BNWA 1U0OC 4Z86A 1RZ3A 4P5EA 4JB8A 5BOVA 2FPMA 4EA8A 3G8CA 1D1QA 1A4IA 1LEHA 4XCXA 3EQZA 1JEJA 4IX1A 5CW2A 5BPHA 3SVLA 3GLFA 5BV7A 3BTSA 5JYBA 3HJBA 3JQAA 3JQFA 3FDZB 1SH7A 1DXYA 3IDQA 2CF6A 1D5CA 4X9XA 1BA2A 4NPAA 1DUVG 3HBFA 4ENSA 3I45A 5DX8A 3AL3A 4R16A 2BDUA 4XZ3A 4OI0A 4R2JA 1RP1A 1C3EA 1RQXA 5FADA 5FFNA 1OTXA 1PKEA 4KNYA 1MB2A 3O2NA 1M6VA 3W5BA 4PYMA 3X3HA 1J2YA 1OYYA 2BBTA 2IDKA 5M5BA 1HE2A 1PR0A 2OQRA 2XNDA 4LJLA 1YA4A 1DAHA 4N5HX 5EXXA 1S9DA 2MTBA 3JAWB 4RGQA 4CM4B 4DCTA 1S8OA 2PT9A 3KYCB 2C2ZA 2EFDB 4PSDA 2JAXA 3MWEA 4KGDA 3A25A 2IYPA 4HV4A 2RG7A 1RWBA 4UC0A 4NCAA 1GLNA 2AJDA 2QD3A 1RR6A 3C2QA 3PZBA 5AJVB 5CXUA 1XNQB 5F5LA 1L6IA 1Q3KA 2BHLA 2R5WA 1BCSA 3SZUA 2Z8ZA 1L5VA 4G07A 4O59O 1ISHA 3VKWA 3IUEA 4O4IF 4CL0A 1IMOA 2EP5A 1XU9A 1SKBA 2JHFA 1DOAA 3N6XA 5B58T 4OK3A 5D3ZA 4NL4H 3BB3A 2ID7A 5IAAA 4XWYA 1SIOA 1VA4A 2EG9A 4BMSA 3LI2A 1SNYA 3FSEA 1U9IA 4GI2A 2AMLA 2IE0A 1C2YA 4TVKA 1I1HA 1DXQA 5DYNA 5EIFA 3VR6A 2AR0A 3DEIA 4WZBA 3HLKA 4ZO4A 4BHTA 1XRPA 2REBA 1FY2A 1XMVA 2QAIA 4FYWA 1SRQA 3V7NA 4DC0A 4HWRA 1D1PA 2JCBA 5BVHB 1I7LA 1J1UA 1G55A 2IYYA 1ZM3A 2PUCA 3A6LA 3JAKB 4QVIA 2IXBA 2ONKA 3BGWA 4L4RA 4R05A 2GAJA 4AF6A 4C0BA 4LJSA 3ZE8A 1KYWA 1ZGJA 3OURA 3OJEA 4UBNA 3K0CC 3QG1A 1Q57A 4X7BA 5JRDS 3K71B 4B4KA 4BMZA 2FETA 1P4SA 3GUUA 4FR2A 4OHPA 4CF3A 1E3TA 1AKYA 2J8ZA 1EUDB 1QS0B 3BHNA 2GPWA 4GYYA 4RM2A 3B9BA 2O8FB 4M21A 1LZLA 1SHUX 2EIXA 3QMVA 4PAWA 4GBJA 4PRZA 3FYHA 2OORA 2Q5FA 4YAWA 3U19A 3A1TA 4JBWA 3STVA 1EA7A 4U6NA 1QVRA 2OFFA 1Z2PX 3ZZ1A 5B4VA 4X45A 3VNRA 1MA3A 2VNJA 3P9YA 4G86A 4PCLA 4U4AA 4EZEA 4JI4B 1Z39A 4KX5A 4L4ZA 4N3NA 5LQRA 3HEBA 3IP5A 1CS0B 2ZDHA 3VYSB 4FS8A 1XG5A 1GADO 4P0TA 1VLQA 3C8ZA 3U4HA 1IATA 1E3DA 5EXEA 4CETA 5HQ3A 5C34B 4ZODA 1NPDA 3MTQA 3HKDB 2RH5A 3OEED 2IQIA 4OJNA 3I4CA 2QTCA 1ACLA 1A98A 2ZUVA 4MRSA 1FX0A 1O94C 5TDHA 4IIJA 2H92A 2WIDA 3AH8A 4PG7A 4EARA 4FJ2A 3VSBA 3ODPA 1WA5A 1PK9A 2E4XA 1WCIA 1VL6A 2R8PA 3INRA 1MAUA 3RUAA 3EDCA 3OFKA 3VAAA 3PUIA 1UBSB 2PL5A 2XBUA 5DWQA 1C9JA 2XUHA 4B6PA 1RI2A 3DZJA 4CFYA 1H4SA 4PXAA 2KW5A 4G4IA 1KYQA 1D8TA 1KIFA 5H68A 1M2EA 2VNSA 3AG6A 3FOFC 1THZA 5IT9A 1VCNA 5DHTA 1SCUA 2O8CA 4QDXA 3IAS1 3PXBA 3PUVA 5EIAA 2LCIA 3PE4A 3CF6R 3F1KA 1N2HA 2XWBF 4L5AA 1F2TB 2QN6A 1OQAA 4Z8YA 2QRJA 3F78A 1P1KA 1KP9A 1W46A 4BFYA 3IL2A 3ESAA 4JT9A 1E7QA 5J9FA 1WSWA 3A3KA 2RAPA 4BXOA 4GM4A 4BX8A 4FHEA 1EWVA 3S0JA 3GJ8A 1CTQA 2YXNA 1JZQA 5HIJA 2O8BA 3Q2IA 4C6SA 1U6IA 3FUTA 2V74B 3DP9A 3UYKA 4D3FA 5IUNC 2AEJA 3GJYA 1ZVQA 1DKLA 4ZOEA 1SKAA 1YRHA 1NXXA 2XE7A 3GZJA 1VYTA 2NSJA 2VUHB 3QNWA 2P30A 4LDNA 4EDFA 3PI7A 5HOEA 1JHVA 4YRGA 5DDIP 8GPBA 4JVSB 4H7FA 1KSFX 1SXQA 1E7YA 2VF4X 3VPXA 4C0QC 3SC2A 3EWNA 1V9LA 1W0JA 2I4MA 2TRSB 3U80A 3DEJA 4JBXA 2V7BA 3F8TA 1QV9A 1Z83A 2JA2A 3DXYA 5BT9A 1W6RA 4R8LA 5G53C 3TLZA 4B7XA 4A6PA 1M1UA 2B9VA 3E7WA 1MOSA 3VH1A 1I0LA 1T2AA 1NUQA 2QV7A 3IQXA 3MB5A 3QPDA 4YT2A 2NU6B 1PEDA 1T1RA 4X7PA 1QWOA 5AJXA 4ZZ0A 3K70B 4KOEC 3T5MA 2SCUB 2VNIA 3GJTA 3IBSA 3LCJA 2WG1A 2P9CA 4XGIA 2X8LA 5G41A 2WF9A 4JLDA 4OI4A 5A2QA 2IC5A 1UDCA 1KYVA 1E2MA 1B43A 4RAOA 5CGQB 4PO8A 3PA6A 4ZXFA 3VZSA 4BRZA 2ZS9A 4D2IA 3P4YA 4KWTA 3UA4A 5GOTA 4BZXA 1U1EA 3QUTA 1NZDA 3KKOA 5KSZA 4GOLD 1YONA 1PQPA 2ZBQA 3R3ZA 3U4IA 5E4TA 5GONA 3AU8A 5BO5A 2OZPA 1U8YA 3ILYA 3TFWA 3ZW8A 5CH5A 1FSPA 3HS3A 1QKJA 2OBMA 4EHBA 1TQ8A 1WPGA 2C4HA 5DNUA 1Z2AA 5E6SA 3JQCA 5G0WA 5T41A 1SK8A 3L6RA 3KTAB 3OZCA 3SOZA 5DGIA 1MRNA 2C88A 4PC6A 1HH4A 4LI0A 1X86B 3STTA 3NTRA 1GT91 1NC3A 1P0IA 3HE3A 3V1LA 2PCLA 2VYND 2FPIA 2RGDA 2W7TA 2II6A 1E2LA 5A7FA 1Z2CA 3LOPA 1M0SA 3A1CA 5BUCA 3KOZA 2X1VA 1ZUNB 3AB7A 4MS3B 5ICEA 1U9YA 3L1UA 1YGPA 3AWDA 4UTXA 3PGJA 3OAAA 1W4LA 1ZZEA 5CD9A 2IUFA 3AW8A 4O29A 4KDCA 3D2CA 1UEXC 5TR9A 1UBJS 1JHMA 1Z6ZA 3AUJB 1Y4UA 1AB6A 4FOSA 5K45A 3H8JA 4FD2A 3BD9A 3W8EA 1P45A 4ODIA 1WB4A 3FG9A 4A9AA 1EVQA 5AP9A 3WWPA 4DIKA 1K9SA 5KNCD 1NULA 3LUGA 3GLQA 3O75A