4K9RA

Spore photoproduct lyase y98f mutant
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
340
structure length
340
Chain Sequence
KPFVPKLVYFEPEALSYPLGKELYEKFTQMGIKIRETTSHNQVRGIPGETELARYRNAKSTLVVGVRRTLKFDSSKPSAEYAIPLATGCMGHCHYCFLQTTLGSKPYIRVYVNLDDIFAQAQKYINERAPEITRFEAACTSDIVGIDHLTHSLKKAIEFIGATDYGRLRFVTKYEHVDHLLDARHNGKTRFRFSINSRYVINHFEPGTSSFDGRLAAARKVAGAGYKLGFVVAPIYRHEGWERGYFELFQELARQLEGMDLSDLTFELIQHRFTKPAKRVIEQRYPKTRLDLDETKRKYKWGRYGIGKYVYRDEEAKELEDTMRRYIEQFFPGAYVQYFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A radical transfer pathway in spore photoproduct lyase.
pubmed doi rcsb
source organism Geobacillus thermodenitrificans
molecule tags Lyase
molecule keywords Spore photoproduct lyase
total genus 124
structure length 340
sequence length 340
ec nomenclature ec 4.1.99.14: Spore photoproduct lyase.
pdb deposition date 2013-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4k9rA01
3.80.30.30 Alpha Beta Alpha-Beta Horseshoe pyruvate-formate lyase- activating enzyme pyruvate-formate lyase- activating enzyme 4k9rA02
4FHFA 4FHCA 4FHEA 4FHDA 4RH1A 4FHGA 4RH0A 4K9RA
chains in the Genus database with same CATH superfamily
1DRWA 1UXHA 3FYUC 1CRLA 2FX5A 4XVQA 4EGCB 3I09A 1OYVA 3CUYA 5LA6F 1KHTA 1W9HA 4B6PA 3A04A 3DCYA 1F3LA 2IFTA 1OLTA 5EUQB 1UBSB 1N6KA 1AIPA 1WSAA 4J2TA 2AN9A 4O3FA 1CYDA 2WG0A 1LJUA 1ZU4A 2GAJA 1S7CA 2XAAA 5IVDA 1XMIA 4CIYA 4RWZA 5C5CA 1CFJA 4ED9A 3HDGA 4IRXA 2OHGA 2YWXA 2AF4C 3A9SA 3R3SA 2GBIA 1D2CA 1BYUA 1AS0A 1TAHA 1DE0A 4X1KA 4ZANA 2BI7A 2HJ9A 2X2FA 4PYRA 1JA9A 2MSLA 2PIAA 2YWGA 1DXHA 4GMFA 4JXKA 4YJKA 4GSYA 4ZVUA 1DAHA 2WSSD 3H1GA 1QTNA 2BI8A 5EFOA 1J2YA 1JEEA 1QWSA 2CLFB 3HH8A 4TYNA 5K6AC 2UVDA 4U7PB 4EYGA 2J09A 1OIVA 3FVQA 4TRMA 1IY2A 2B4YA 2H17A 2Y0DA 4HZGA 4LNHA 3SKVA 3ZD6A 1J1UA 4G0ZA 1TKAA 5J47A 1E3LA 4LN1A 5CB6A 5DTEA 1UMDB 1G7RA 1X1CA 1EFPA 4FYVA 4GNKA 2GTIA 3QI2A 3RYTC 1ZESA 3TYXA 4RH1A 3LQ2A 4D6PA 3CXUA 1KY5A 3F2IA 3OESA 2IOFA 1M10A 3LZDA 4RHTA 1N2XA 4PHFA 4QPCA 2RJOA 3GVXA 4N0QA 2Z4TA 5A06A 3GN1A 4R31A 4MS1B 1ZJYA 5LQNA 4LF8B 4ZKEA 1JSXA 1HG0A 3TRJA 1T2AA 4RABA 3K6KA 9MHTA 2YWEA 1DAGA 2JBAA 3TW4A 1SURA 1N5DA 4ZU3A 2XA9A 3FPGA 3U4GA 1Z5ZA 5JSFA 2AL7A 1WUKS 2GA9A 3PQDA 4R7GA 4QOSA 4JIMA 1LX7A 3FOCA 2JL1A 4LV8B 1PD0A 3KAPA 3P71T 1R00A 3PL5A 3B3AA 4YDQA 1G6Q1 1JVBA 1R6TA 3PE3A 4X54A 5FBRB 3ZGLA 1NYTA 4AJLA 4GOLD 4L8VA 1WMSA 1P8JA 4LNAA 5I9SA 1I6WA 2Q50A 1UPCA 3OQ1A 3VZQA 3G5UA 4FMBB 5CLJA 3L0ZA 1CT9A 3NM6B 1PJLA 1S5PA 4N8SA 3NYRA 3UCEA 1ISFA 1SXJE 1DQNA 1USGA 4I4TF 2I2AA 3U7QB 1IJFA 2ZWPA 4HWOA 2D1SA 3OAAA 5AKIA 4GNRA 4AKEA 2QY9A 1GQRA 4LMRA 3LY7A 4V02A 3CX4A 3WDSA 4LZLA 3CUWA 4M88A 3ZEIA 4F6RA 2AR7A 2JASA 2Z08A 2GB4A 1PKXA 1XTQA 4EG0A 1QORA 4MWGA 1T3SA 2IH2A 2GD2A 2D2FA 2VJMA 2OV2A 3GLQA 2IDKA 4BGVA 5FWNA 3UGJA 3BKXA 2ACWA 4M7RA 2BKVA 5DTJA 2X9VA 1ESZA 4W5NA 1JIJA 2A9KA 1NL3A 2EGGA 3N86A 2HA7A 1V2GA 4MIOA 3LQYA 3WLRA 4AO6A 4ER5A 5AVSA 2WC1A 4TXJA 4XVUA 3VNRA 3NRJA 3F47A 2QGQA 1OV6A 2PBRA 1XRPA 2QWXA 3FAKA 4W82A 3WTBA 4DZRA 1XTJA 3BDIA 4PYKA 1WCIA 1CNMA 1H2XA 1L7BA 3MTEA 5DV9A 1WETA 2NYVA 3FKSA 1FQOA 4UE3S 5DGDA 3MJSA 5KVSA 5EIFA 4FCVA 1W36C 1E4OA 3ZDAA 2C4MA 1E6EA 2I1WA 3NEPX 4NU6A 3U31A 2X13A 4ZT3A 4ZCTA 4YT8A 5B1YA 3RFVA 4XJXA 3TW0A 2CXQA 5L40A 3SC6A 3EWIA 2FV8A 3GCGA 3I0MA 3JQQA 5EL0A 2X9GA 1WPXA 1X8XA 3U7GA 3JS5A 2QIPA 4BNDB 1H0KA 1OLXA 1PTJA 4DA7A 1T0HB 3RJMA 1SHKA 4YJFB 3STTA 3P32A 1U6KA 1CG6A 2DE0X 3PVSA 1JR6A 4JSTA 1SQ5A 4O2BB 3SP1A 5IVPA 1R12A 1XA4A 4QTZA 2XMCA 3R20A 3U80A 1QX4A 4PPGA 5EMJA 3A32A 4PX5A 3WKCA 4MUMA 4KGZA 1QBKC 3ORHA 3PQ8A 3ZDRA 5I7RA 4OU4A 5CD9A 1O6CA 1R6UA 2MSDB 4AJ1A 4BMZA 1QJ4A 3EXG2 1FFEA 4YUVA 2AE1A 5AVZA 2C83A 2Z6QA 1YA4A 3WYCA 1DEAA 1NZJA 2QZSA 1RRPA 3ZD9A 3LBYA 5B7NA 5JO0A 4LJAA 3F5QA 3IO5A 2VP3A 4GHWA 5AW7A 1OB5A 2PGLA 4V03A 1FDSA 1X9GA 1V5IA 4IKPA 4AN0A 3KOMA 3KOZA 5JMWA 3FMPB 2GD0A 2W6JD 1XU4A 5KBYA 3SHTA 2WD7A 3MWJA 4PYNA 3CVJA 5IASA 2CCJA 3TEFA 4NDAA 1Z12A 2YV4A 3RANA 4EZBA 4QPDA 5E1MA 4GQBA 3SJ7A 2VOJA 1GSIA 4BV8A 3ERCA 3GEDA 4ZT5A 4FYKA 5F23A 5EMNA 4KB5A 4ACAA 1S8AA 1CUGA 3GPBA 4WIAA 2DFLA 4EKYA 5TRTA 3NP9A 5EZYB 3Q7SA 3T9DA 1P2FA 1SVLA 4LHVA 4R1TA 3WQQA 2DBQA 5KTPA 4XGNA 1SA0A 4XQCA 3DAHA 2QTFA 4G81A 3L7NA 1P72A 3RASA 3WIEA 1ECPA 3W6OA 1W19A 4ENQA 4ZYYA 4A4DA 5L3SA 5M5BA 2XI4A 3A1CA 1E2IA 2I65A 1UM8A 2A30A 3IRVA 4E2YA 4FDUA 3SBDA 4C4RA 2XA2A 1E2FA 1X1TA 2AOTB 2LVBA 2PH7A 2PGOA 3P9YA 4LOLA 4TT3D 4PHTA 5JS2A 3V5NA 2PD3A 4PGFA 3C6XA 4I5IA 3USCS 2UXBB 1GCOA 3TMYA 2CXXA 2IS4A 5BO5A 5CDGA 2UUOA 3C5VA 1SG9A 3WVNA 4KYTA 2RH9B 1FXWF 4LXUA 3WGTA 3WLMA 2FW6A 1OC4A 3QFFA 1BZYA 3LCUA 3R9WA 1JI0A 2AH5A 2EYUA 2MTBA 3BG5A 1VA4A 5ER9A 3ZS8A 1F9AA 4XTCS 3DV2A 2YWDA 3JQRA 3ZV4A 4KFUA 4MHOA 4U2FA 1P4SA 3V32A 1Z33A 2YS6A 3ANLA 4LZZA 2QMOA 1NQWA 2WF7A 4RF2A 4REMA 2WE8A 3KC2A 3Q40A 3H2HA 4YGYA 1OC2A 4ZAXA 1THTA 1U65A 4O0MA 4X1YB 4P08A 1D7OA 4ZQHA 4R69A 4RV5A 5GJVC 1YRQA 3GJ3A 3BGSA 4JODA 5JAHA 1NFRA 4NXNB 4AUMA 5H80A 3GQBB 1AXRA 1SCQA 3KPUA 1M75A 4JR0A 4YHHB 2VQDA 2W4MA 4UTNA 4MO9A 2IY9A 1BOFA 1A50B 2CUKA 2XNDA 1ONNA 2CHEA 3ECAA 1UJNA 3JYLA 5KJFA 4FTWA 1FK8A 3LCRA 1M6VA 4BASA 3TCKA 4QLAA 3LY8A 3PKJA 4YJ2F 1EXWA 1KSFX 1U1EA 2VDKB 1O57A 4CCYA 1I4OA 1NE7A 3SZLA 5HRCA 2PWZA 4JJ8A 4JL6A 3JQ9C 4MHTA 3MSCA 2ZU0C 4YASA 4EDFA 2QAGC 1OF1A 1YIOA 3O4RA 3T9AA 4H4DA 3CF6R 1TVKA 4WV3A 2C1ZA 4D2IA 3ZHQA 3NGXA 4YP6A 2NAFA 1EFLA 4RK0A 2GLUA 3ZU3A 1NYRA 1LS1A 1L3IA 2O2XA 4DCGA 3UOAB 4DWVA 1FW8A 1WZ2A 5CP8A 4ZIRB 2XCIA 1C4WA 4HMOA 2OESA 4H0FA 2R6FA 3G2OA 2FSIA 1ULAA 3O31A 1XLTA 3OFJA 4X65B 2EX0A 3ZWWA 2GEBA 3AR3A 3R6GA 2VCHA 3WAGA 2ON6A 1P0PA 3C3EA 2BJHA 3L8ZA 4RKQA 3UXEA 4HZIA 4JR2A 4X71A 3HN6A 2RI1A 4QPNA 4P3YA 1QDUA 2BMEA 2GS9A 1K6MA 2W4IA 4C0LA 4HWPA 4DMRA 3L40A 4KQFA 3B1XA 1U0JA 4J6FA 4IH1A 1RWMA 1H3EA 3VSDA 1CZOA 4B2IA 3TIVA 4CMGA 1BX3A 2QDKA 1ABEA 3NDIA 2QMEA 2EHDA 5CH5A 1E2BA 2NG1A 2VIIA 4V3BA 3DOEA 5CB4A 4KRFA 4DYVA 1EKXA 3DKKA 1NVDA 3ER6A 3FWKA 3ZYZA 3K9WA 3GJ4A 5H5JA 3NTVA 4HDMB 1DLJA 1WMBA 5BQ3A 4BRZA 1B1CA 3RT7A 2WHPB 4BS9A 4UU8A 4RU1A 2X4DA 4A0FA 2LV8A 5ALIA 3K09C 3ROFA 1P1KA 2QN7A 4EI9A 2BE9A 3ANYB 3RBXA 4FZ5A 3DKIA 1TUIA 2PDAA 3GEHA 4TYPA 3S5UA 3CX6A 3GLTA 3S1LA 4PZDA 1HI9A 5ILGA 4ZOBA 3KOWA 3ZXYA 2IE8A 3KQOA 1DP4A 2YRFA 3ELDA 3ESXA 3FOWA 4DY6A 5HUQA 3G0HA 3N2GA 4RYDA 5FPYA 3TSZA 2EV9A 3KAKA 1NR1A 4UMFA 1CIPA 2FWMX 4ZVPA 1JFSA 3H4VA 2P4SA 2CXUA 3M4JA 4P31A 1S4QA 1YRYE 4GLLA 4YDSA 4MMYB 5KTMA 1QG2A 3DZHA 2WIBA 5KSPA 2I22A 1K98A 1N9ZA 4G97A 2BW0A 4GMHA 2PYIA 4EW1A 4K5QA 2AJLI 4BYMA 5LC1A 4EJ0A 4LE1A 3P8ZA 4GOKA 4B09A 3L92A 1KJIA 1D07A 1Z39A 5FX2A 3SE7A 5YASA 2ORED 3ZVMA 1E4EB 1YJ8A 5K3FB 1XDZA 3COJA 2FK7A 4RJLA 2VDPB 2QT0A 4EB6A 3HA7A 3V7FA 5E7MA 4KXUA 3DV0B 3R3UA 4DILA 1I2AA 5JJCA 1H1LA 3DLIA 4GR4A 4PPQA 2FR0A 2PMBA 4FGKA 3VVCA 1J2TA 1I94B 4O5OA 5FFFA 1SH7A 5K0EA 2JIDA 5H7XA 4I14A 3W7BA 1YVDA 2I7CA 4L0DA 2OHIA 2HK7A 2IHBA 2IZ7A 3GDHA 3FGOA 4BPBA 1U2EA 1ZJ5A 2O0HA 4X90A 4D3FA 3GEEA 1Y4DE 5EZYA 2O5RA 3BTUA 2HADA 5DSXA 1NUTA 1Y6RA 1DIOB 3TTYA 2I8LA 3OPXA 1Q57A 1G291 3I05A 4L15A 4Z7JA 4QO7A 1QKIA 3TVYA 2ZWAA 5HCNA 3TIXB 4CGYA 2AHRA 1I2ZA 1UFQA 5FI1B 4H7DA 4GAEA 2ZM6B 1MFZA 2N0SA 4N5LA 3TH5A 1GARA 4DQ0A 1RIIA 1H1TA 3H4IA 3AQ4A 1XYGA 3CC8A 5FULA 3SVZA 4C4YA 5CFNA 5F7XA 1N0HA 3FA2A 3DC7A 3OTWA 1JH9A 2Q1YA 2PJUA 5KJ1A 2XR1A 2GLXA 3QV1A 1VCIA 4MLZA 3E1GA 1LDBA 2Y0EA 1I2CA 1Y1TA 3TNYA 4PN3A 1JQ5A 2BUAA 1T5TA 3D6AA 1ZISA 3CX7A 5ALTA 2FFJA 3EEOA 1QV7A 4QUIA 1TECE 3N6XA 4M9QA 2ZXUA 1G42A 4GL2A 1RC8A 4X8MA 5KOHA 1H9BA 3GLGB 3A1EA 1SOUA 3EF0A 4JXJA 2AKYA 2GZSA 5JH7A 3KZKA 1OYOA 3W8DA 3W5BA 2C2YA 5CDHA 3OCCA 5LOVF 4LSMA 4M21A 1L5MA 1P29A 2WABA 1HY3A 5IKEA 4M8KA 5FT9A 4J0QA 5J59A 3NALA 3EUEA 1RJDA 3IOCA 3ZV5A 2WZBA 2H0QA 2PLRA 2IKQA 3EMVA 3F49S 1FXUA 5AM0A 1XXHA 3PHBE 1WCIB 3KQTA 4HUQB 5JNTA 1NI3A 4MWBA 4R5HA 4BJ3A 3DTNA 5FAKA 1A9OA 3LXRA 4IIUA 1DCFA 2I5PO 4G4SO 2FJUA 2FEKA 2QVBA 3OPNA 4MITA 2G25A 2JGRA 4OJYA 3CZ4A 4BZPA 2DBRA 3ETGA 3KXDA 4BQIA 3BXOA 1A69A 1XFDA 1DKLA 3IQIX 1Q0PA 3FDXA 4NZ9A 4AY4A 1QGZA 3EX7C 2HLDA 3NBYC 3NTXA 1P19A 4XUEA 4MRVA 7ADHA 3I4LA 4RKFA 2H7VA 3A9WA 3PNVA 4WK2B 5CT6A 3RRJA 2BEVA 4I0WB 4QDZA 2WINI 4H7EA 2YXDA 1JILA 3DOUA 5EXDA 3OLZA 5L3SB 4C1BA 4IH4A 5C81A 2FPPA 1VFPA 1XRSB 2I76A 3FYCA 1IJBA 1RKUA 3SDSA 3TVDA 3F78A 3BMOB 5C52B 2C4NA 2O8BB 3VH2A 2A1TR 4NYJQ 3OCZA 4J0DA 4WNAB 1FX1A 2HSGA 3AFGA 4YMLA 1KBOA 3ND5A 5JRJA 1J1ZA 1HQDA 4HRVA 4X00A 3CVWA 3AF0A 1UODA 2G4CA 3NORA 4BMPB 3AUSA 1A9XA 1UBOS 2G4VA 3B5IA 2L42A 4A6XA 3ZCUA 4YRMA 1GQ2A 1E7SA 2C2HA 3LHFA 1DEHA 4INJA 1Q7EA 1C8BA 3BE8A 1X87A 4NNJA 2A14A 3EXEA 1NVEA 3TVTA 1BN6A 4BIIA 1F1JA 4MQUA 1XTRA 2NIPA 3PUJA 1PFKA 2Z2JA 1XKQA 4PO9A 5EMKA 3WSVA 3JWIA 2OQRA 2XWJI 4B83A 1T0IA 4Z4CA 1EA7A 2CMDA 5INTA 1N5OX 1F14A 2QORA 4MVJM 1CUSA 1GA1A 5C0OE 3NT4A 3O92A 4ICIA 2ZDQA 5HFNA 3TZQA 4D8UA 4YAIA 1Z2CA 3I04A 1YO6A 1I3LA 3KT3A 2A33A 3ZQ4A 4P84A 3T7SA 1CUHA 2ZZMA 2Q5JA 4JJKA 4D1YA 1FSZA 3WWOA 3U40A 1UJMA 1Z73A 1UCFA 1XEFA 1MOQA 4O4IB 4I1PA 1DEKA 2FSVC 3IAS1 1X13A 2HA5A 3OPYA 1ZD3A 1GTZA 4MUGA 4OK3A 3F4LA 4DIKA 2QZ4A 4UARA 8ATCA 5JASA 4C89A 1FNDA 3RLFA 3IIJA 3NFYA 5G0SA 4OQZA 2OHHA 1K8RA 4E46A 4Q4DA 1MA3A 1V8OA 2QN6A 3KKKA 4WOJA 1APBA 3SJAA 2J7KA 4EG8A 1REQB 1ZOIA 3P9RA 2Q3LA 4E13A 1ZQ9A 3KKPA 4E14A 2G70A 3JQFA 5JZOA 4QBIA 1NUAA 2QS9A 1CXZA 4ASUA 1FUIA 2OAEA 4AVYA 5LLTA 4YFVA 4BKUA 4I6GA 3EBPA 3ZU4A 1G4UR 1OR8A 4UVHA 1AKWA 1IPEA 2BMWA 1MORA 3V3TA 3ZVRA 2G04A 4KPGA 2IK8A 5IX8A 4ZVVA 2Z4SA 3INTA 5B53A 1BTOA 4ND8A 3UAYA 1IK6A 3V2GA 4EUNA 4K81B 4LF9B 3TIIA 3O26A 5KDDA 1TCAA 2PTHA 4TTJA 4ZI7B 2DGDA 2GCIA 4Q4LA 1IB6A 1SB9A 5GONA 4HVCA 5K8JB 1SBIA 3PFCA 2C9MA 4KFRA 1BMDA 1D9XA 4PZ0A 5A2QA 1RRFA 1QGUA 1RYMA 1VL2A 1M7HA 3DMNA 4CL8A 2BKAA 1SB8A 1U8FO 1G9TA 3Q0IA 1YE3A 3GLGE 1W5TA 1JBKA 3FSGD 3JQAB 5ALPA 4LEIA 3WB1A 4B0PA 3EISA 2OGSA 4BV2A 4DV4B 1XRRA 2PSDA 3U44A 3TSWA 1V41E 2ID4A 4J0IA 3DBIA 3E7FA 2WJYA 3X43A 1TYCA 4DXHA 1TO2E 2D8AA 1DHTA 1TK2A 5KOYA 1DCTA 2F3RA 1PFYA 1YIDA 1E2EA 3QPDA 5E6RA 4I1VA 4OK6A 1O4VA 2ZIXB 3GD7A 3MCTA 2RK4A 4WCVA 4CF3A 4DA0A 1Y8CA 3SG0A 4DLNA 1OWMA 3KLNA 5HXAA 2WFAA 5JV5A 3FFBA 2C00A 2N1BA 1E0JA 3HRHA 5HEKA 5CBPB 3GJ6A 1Z4KA 1JECA 1CDEA 3ISJA 1YS9A 2YJ5A 3PZBA 2C9YA 3IDZA 1XC7A 1V4NA 1SELA 1YS2X 2NQTA 3I3SR 3OSZA 3PDIA 5ALJA 4EQZA 1YFKA 2F48A 2I2BA 3HBFA 1WMDA 1PVDA 1CUDA 2SKDA 4M36A 3AEQA 4NCKA 4EW6A 3ZDEA 3HSKA 3JAWA 4ZP1A 5LA6A 3HXMA 2PS9A 4RD1A 1JT2A 1NC3A 1KJ8A 4KO3S 4PCAA 4DLYA 4ERXA 3FOFC 5TE9A 1KZGB 2VDQB 4QYIA 1XQ6A 2J59A 3MRXA 5M3BA 1QCDA 3CPJB 3OQ6A 4E03A 2HV9A 2XTNA 2QAJA 4REQB 3T9CA 1PF7E 2XUKA 2BDEA 1RRGA 2B35A 2P2SA 1YD7A 3E4CA 1A9SA 2AK2A 1KO5A 4LXQA 4MVJF 1HO3A 3GFTA 3OU2A 3WLJA 5HK9A 2C4KA 5LXTB 4OI0A 1X7GA 4JFRA 3MTDA 1YL7A 2ZATA 1GHTA 3O9ZA 1S96A 3Q7IA 4P36A 1AUVA 5COQA 2QD1A 4DSTA 4EWLA 2RAPA 1E69A 5ALOA 4HB3A 2GSWA 2ZBVA 3ADOA 4JN6B 3ZWQA 2XNJA 3HY6A 4CM5A 2IYRA 2FPRA 4PTZA 1U7UA 4C7VA 1XZMA 3SC2B 2D00A 3IDQA 1XPOA 2UUPA 3Q6NA 3T7AA 5K51A 2WTMA 1UXGA 4R05A 1QS0A 4YCDA 1X19A 3NTQA 3C3KA 2N9UA 1QAQA 1VPTA 4OHBA 3VH3A 3Q7TA 4DXAA 2YXPX 3PGMA 5AMXA 4GMKA 1PVVA 3TJMA 4EVIA 4QA9A 3EVAA 3RT1A 4M1WA 3A3YA 2QJRA 1CETA 6YASA 4JI0B 4JITA 2Q5HA 3PJRA 5K20A 2DPMA 2VT2A 2WTBA 1NVGA 3IOBA 4YUZA 5IXJA 1YBMA 1LBHA 1ZKDA 2VTKA 1MNQA 4QOHA 1OIXA 3MJ4A 2QF7A 5H81A 4C7JA 3WQRA 1E60A 1JH8A 4DNOA 2Z8ZA 3HI6A 3RS4A 3OM1A 4ARZB 4AY6A 3AVWA 2ZTHA 5JBNA 1K92A 4R7ZA 1O77A 1ZBDA 3TXAA 3H8VA 4BO5A 1LW7A 4V0OA 3DFIA 5B3AA 3T5BA 3F3MA 3CUVA 3MN1A 2XUJA 1FP4B 5FBZA 4BFCA 1MCZA 3DS8A 4DCJA 2JBHA 1J5EB 4LDRA 4X6XA 4IHKA 2ZVDA 4RVFA 2ZUEA 4IDAA 2JHFA 3C5HA 4HLDA 3ETNA 4LRUA 4CFZA 1MX1A 1E18A 3FF1A 4E70A 3ND6A 3UKJA 3P0FA 2EBUA 1ZIPA 1GUZA 4UHEA 5LP6C 2DKNA 2QR2A 3FFXA 3IJ5A 3EXHC 1KYWA 1FQWA 1MU0A 4J3JA 2QTNA 2B8EA 2BHTA 2XMBA 5LQSA 2GZDA 3RVKA 3KLMX 4HLUC 2VJAA 5BWCA 4E94A 4LGMA 4NHOA 4O4HF 5TQ2B 1L7XA 1EI9A 2B61A 1V5WA 1X86B 4N49A 3HWRA 3T5TA 1BWQA 3A3KA 2QMZA 3KXLA 4BO8A 3JARB 4E12A 1EFVB 1Z45A 4AYWA 2W0MA 1N1DA 1RKQA 3GFVA 2ZE5A 3LUKA 1KU6A 1TQ2A 3P0EA 4HUQA 4WMLA 5DI9A 2HA3A 2WU1A 4O08A 3QKWA 5DK4A 1RRVA 3L46A 3L93A 3GL9A 3B51X 1HNZB 2WD9A 4YVFA 2BHLA 2R6R1 1NMQA 2ZW9A 3OE1A 5I9TA 2SKEA 4JHXA 1VJ1A 1VBNA 4M6WB 2YWRA 2PGIA 1KQNA 3TLCA 1PFWA 3O2QB 1DI0A 3OPQA 4KNVA 4TTAA 3O0TA 2VDJA 1U5BB 1ZO8A 2EJWA 3QJGA 1W94A 5DCYA 1Y8RB 4PSKA 5CEJA 4QEZA 1SOMA 2FEOA 5IBQA 5E3IA 3EA0A 4MQEA 1Q5PA 2Z9DA 4H3SA 2I2FA 3ETHA 1UKAA 3ZY3A 5KQSA 4N7MA 3QBJA 2SBTA 2F1HA 2OILA 4RF4A 4RY8A 5ELMA 5IEJA 4MW2A 1C9DB 2P9FA 4TKMA 4AZTA 2XZTA 1YA6A 2ZSAA 5B3JC 3PEYA 3COWA 3H1BA 4C20A 1X94A 4M0MA 4Z9BA 2I9PA 3TB6A 1A5ZA 2VAWA 2H06A 3WMRA 4F8YA 1Z6GA 5HKKD 5JFTA 3L0OA 2DCUA 3L06A 3ZH9B 3EQ7A 3I73A 2PCLA 2I6UA 3DO6A 4XIYA 3RSLA 1AO0A 5AW3A 3KJQA 1KZ4A 2VOEA 1SJ9A 3EGDA 2PH3A 1BWPA 1NNUA 2O9JA 2ROQA 4S1VA 2XGGA 3OCYA 3Q1LA 1XAHA 4GLBA 4UCFA 3ZWCA 1HOXA 3HPRA 2RGXA 1E77A 1QJCA 4FT4A 5I5GA 3LHSA 5LJIA 1PDOA 4WQMA 1M2KA 1U8YA 1TVMA 4QSMA 1RPJA 4X85A 1E1RD 1VJRA 5REQB 2EKZA 2UZ3A 5F78A 3NP7A 4AJPA 3FBTA 3I0NA 4XSHA 3KQMA 2R87A 4V1CB 1JRLA 1JYSA 5BW5A 4BZZA 3FOBA 4F2PA 4J3FA 2I2WA 4DV6B 2VNAA 3TQQA 2HPZA 3AR9A 4BGEA 4TKZA 5IWCA 3UUEA 4HN4B 4WZAB 2GCNA 3BB4A 1LUAA 4G6ZA 2GYUA 2X22A 1QK5A 2ALJA 2Z04A 3Q3VA 5JXJA 2AN4A 1G7TA 1NMXA 3NDJA 4Q1BA 3ZTYA 2GFIA 1P60A 1Y1PA 3WK9A 1IPHA 2B8NA 4G0PA 3C87A 5C3UA 3BWEA 2AHOA 3WFIA 1XTBA 1MHTA 1BFKA 4MUNA 1XIVA 1WDKA 1ZITA 2DSTA 3WJ1A 4CF4A 2C95A 2XW6A 1UZLA 2ONCA 4AKTA 1CRQA 2AD1A 3JQFC 1LPPA 3CIOA 1NW7A 1SCNE 5JMOA 3V2HA 1BCSB 2YJZA 1N5JA 1PS8A 5JNRA 4OA8A 1UJ6A 1X0XA 2VSOA 5JARA 4BNFA 3QTBA 3LT0A 4WY8A 1JFTA 2E5WA 2Y1KA 3C6MA 1EMDA 4KR6A 2QD3A 4R8VA 4TWRA 4KFTA 1NN1A 1YAJA 1L8OA 3O8RA 3LX6A 5E2IA 2QTZA 5AM4A 4MGEA 1N6LA 4LY6A 2AE2A 4KJZA 4KBYA 3M5CA 1M1UA 3KZVA 1I2DA 3OG9A 3H9QA 4KK3A 1O8BA 1GIAA 4XWOA 3K4HA 3AILA 4KX3A 3I9FA 5KVAA 4Y6OA 4RLFA 2C9CA 1TPYA 2ZZNA 4OIFA 4EA8A 2WVHA 2MJLA 3M6VA 1FRQA 4NWIA 5FDFA 2FDXA 2OCIA 5ILQA 1WXWA 1XWIA 2YZMA 2XTAA 3NTLA 3GAZA 4BDSA 1GGFA 5IBPA 3GNTA 1TVEA 2WUGA 5GAJA 5JAQA 3EXFA 3IQWA 3NATA 3LW7A 4Y1FA 2GYWA 5LLSA 4B3XA 4BO6A 3IPCA 4NYMQ 3WBFA 2GYVA 1WABA 3P26A 4EUSA 1YACA 2AFIE 3DOCA 4OYLA 2JLYA 4P5DA 2GFQA 3LA6A 3PG5A 4QNRA 2WA2A 1BJRE 3JASA 4CQNA 2QD4A 3RU9A 3MQ4A 2J87A 1X0VA 3D31A 3RS8A 2A9VA 2OO5C 2RGNC 2D2EA 2ONJA 2A9OA 3IP3A 4JVLA 4G0QA 4PY2A 3L6UA 2WRZA 4GYYA 4GR5A 1TTQB 3T7KA 3GH1A 3UVEA 2AEMA 4DBZA 1VSUA 1L7VC 1Z7YA 1N7JA 1KBQA 1QC5A 1GNPA 2NGRA 3AXTA 2FQWA 4O8ZA 4QQNA 3MCVA 1CS0A 4OYHA 3UENA 1BYIA 2GAFA 2VYFA 1C1YA 2P2CA 2J32A 4TX1A 3TINA 5LQJA 4WXPA 2PL1A 3R5HA 1GYRA 1FJXA 3A6ZA 1XX6A 4MS3B 1EP9A 5D5QA 1UDXA 1YI0A 4L4ZA 1YOVA 4YRTA 2FDRA 3BMCA 5HA5A 3NTRA 1F1BA 3JSXA 3LH5A 4S0ZA 4JX8A 2OEPA 4CUJA 4B3RB 3TBHA 1UQTA 1R6XA 4GM1A 3CW8X 1RI3A 2EG9A 4RADA 4XW2A 5BYKA 4D9JA 3DO8A 4YO7A 1Q7RA 3CGGA 2NZXA 3EIOA 4L22A 4EY7A 1C0IA 3AGPA 5G41A 4CYMA 1AA9A 2BDTA 5FNZA 1OX5A 1WLSA 4PE5B 1W87A 2O50A 3A6JA 2HT1A 5H8WA 1Z2DA 5FBWB 3W34A 1J24A 1U4NA 3IIEA 5EVJA 1Y4SA 3GGJA 2AG0A 1BJTA 4HBZA 3TD9A 3P0JA 1JWAB 1OXXK 1KO8A 3AESA 4X3PA 3BN3A 4BNJA 4DAEA 1RM4A 3A2NA 4S1PA 2Q4TA 1GTG1 2QTVB 1UPXA 4DIOA 4TLMB 1A04A 5ALXA 5BMVF 2PUTA 1G3MA 4OD0A 1TMKA 4ZPXA 4LRWA 4URYR 5C1DA 4K9PA 1Q6YA 3ZE0B 1OI2A 4KXNA 5M34A 1L7NA 1P7CA 1CF2O 4FR5A 4KREA 3RVOA 5KSZA 1BHJA 3ETDA 4UULA 5HQ3B 4WI1A 2XDAA 2HF7A 2OFPA 2X5KO 4IDDA 1AKVA 1GZUA 2H7XA 4WN3A 3WNVA 4Y6RA 2W8ZA 2DSNA 5ALDA 3DT6A 1JLKA 5LYYA 5CX4A 4OLJA 4Q7JB 1K7XB 1RD4A 3ND9A 1DC3A 2PO7A 2RBKA 4HUTA 3UMYA 5EYPB 1C7ZA 2DMRA 4JC4A 1U2DA 4J0HA 1NY6A 4LXTA 2ZUFA 4KITB 1FLVA 1O8CA 3WADA 5DBHX 5IT9A 1P5FA 4N18A 4KAJA 2GCEA 1G8MA 1HRKA 1GVNB 2FRDA 3E05A 1N3YA 2VDMB 1FFGA 5J63A 4F5EA 4D9CA 2YYYA 1T8WA 1CUAA 2LDBA 4XJSA 2C7QA 4XEHA 2IELA 2MOKA 4CIBA 1FA9A 3MUNA 4J2OA 1KS9A 2EX4A 3H42B 4TLAA 4YIKA 3R7SA 4IF6A 1EVQA 1Z17A 4A2CA 1BSVA 3ZNQA 4Z3KA 1PP4A 3TI9A 2FUG6 4BLQA 3ZHRA 2OKGA 3E2PA 3HJCA 2JFYA 3LK6A 3WC4A 1A5TA 1O5TA 2WPDA 3IQDB 3KU1A 2ODTX 4W7IA 2OBFA 4B7CA 4IXNA 1HV8A 4KIUA 4XR9A 4V1CI 2O8DA 2BH9A 2YOHA 5IRCD 4RTOA 2ZJ8A 1ZK4A 1EZ4A 1X77A 4Q93A 2R47A 2NU9B 3IAEA 3ZJYA 4YRGA 8GPBA 2OPBA 3PF8A 5K6AA 1E6CA 4OKNA 1Y4ZA 1BDIA 3H0CA 4R9NA 1ZUNB 1E2JA 1CY1A 4HDSA 5C4GB 4FFBA 2FXIA 2IPNA 3HJUA 3RREA 1IXRC 4I19A 3B70A 4FI3C 1PJQA 4HDRB 2AOTA 4Z4IA 1ORWA 3PQ2A 3EODA 1NATA 3AYZB 2OM2A 3IR7A 4KEAA 2JHPA 2VJNA 3PWKA 3U7FB 2YNMC 2Q8PA 3VKGA 4RA6B 2QTHA 5BVGB 3N0RA 3FHTA 2XQIA 1XRJA 1D04A 1TW2A 3MWEB 4TMFA 3ESAA 2GESA 2Q4EA 3QSGA 4Q7EA 2CC2A 3DBVO 3H1TA 3M6FA 4UUAA 2AVDA 3X1YA 5LQMA 4TVBA 1HFEL 1PE0A 4Q66C 4EFMA 2Z6VA 2GOYA 2SCUB 4YXWD 4I8XA 3A26A 4S1WA 1RVDA 5I7FA 4JL8A 4F2WA 5K01A 3L8GA 1SCBA 1L5HA 1JZQA 2WQZA 3A6HA 3BEDA 4DUGD 1C9NA 1YZKA 5FUWA 1AQ6A 4OATA 5JD6A 1YNSA 1PYDA 3AR8A 1R0RE 2PD4A 1KXJA 3PXEA 4F6RB 5PGMA 3H9CA 3PR3A 2VZEA 4Z99A 1W4CA 2O2SA 4X94A 3DVAA 3PNLA 3THYB 1JX6A 1NVUQ 1WCWA 1XTPA 1KFEB 4J0EA 1W36D 1M83A 3H1AA 3E3LA 4BJ6A 3PQFA 2A5YB 4BTEA 5IJXA 2BMFA 3D8TA 3TI7A 1DBQA 2X77A 4V24A 2RHOA 2AK3A 1D2GA 1YL6A 3KKMA 3HNPA 3IHKA 1XRMA 1CY8A 2VHZA 1SUAA 3LC7O 1XCGB 3ABOB 4PSCA 2DWUA 3HGTA 1IWOA 2J0VA 1USIA 2C2BA 3OF2A 3R40A 5DWQA 2YJGA 2ZE7A 2WW8A 2SICE 3UUGA 1WXFA 2CNKA 1FUEA 1JPJA 3OKPA 4ND6A 3CKYA 3QV2A 1KI1A 3SFZA 1DUSA 1OOEA 4GXNA 4QXRA 1ZOPA 3HB0A 2XHEA 3MLEA 2P4EA 3UANA 4LXHA 2YQZA 4CM3A 1B2LA 2C2GA 2Z09A 3AHCA 3JPWA 1Y5MA 3JWHA 3WHLA 2QVLA 4G5HA 1OYYA 2ACKA 1Y9EA 5KVQA 4DHEA 4C6RA 1NP6A 1JR2A 3PUZA 1QONA 2OFXA 3TSOA 1ZS9A 1GL7A 1LLDA 2VF5X 2OXCA 3G6KA 3GGGA 4PYIA 4RMGA 4UU7A 3TLEA 2GF0A 2VYND 3LBAA 7GPBA 2UV8A 3L04A 2I4OA 1F2UB 1NBOA 2P68A 3FNFA 4L16A 5KHOC 4ZXPA 5T41A 3DAOA 4QYXA 2ZPUA 3H9UA 1OT3A 1SQ6A 1F8GA 1ZRSA 1T1SA 2V74B 3CRZA 5BT9A 1KYZA 5DYTA 1DO0A 5K0GA 2I66A 3KXIA 1QLWA 2YICA 1WTCA 5JYEA 4Q0MA 1D5CA 1JKIA 1HT3A 5IZ4A 5CR9A 1QG6A 3GT3A 4RTNA 3VNAA 2O1XA 4PNZA 1XI2A 4US1R 5L53A 2Q4BA 2XYGA 2F00A 1DC5A 2FJPA 2NXCA 3ZIDA 1NASA 3HI4A 1YRWA 3EGXA 4NOLA 4RD0A 5A3RA 3H16A 1JFRA 1JJFA 4OUDA 2HBRA 3U4HA 1EDDA 1C3OB 2BFDA 4WUTA 2ZJ2A 2P7HA 2X9QA 4K46A 2VWPA 1B26A 1PBTA 4RVNA 4H1HA 3VDMA 4HZUB 4W5QA 3E9RA 3G2IA 4I8IA 4C22A 3C1UA 3DKPA 3U7QA 5AXAA 3DBRA 1N3LA 1NPTO 3T1QA 3BJIC 3N3BC 4C0BA 4CI0B 4U6QA 1QZXA 5AVYA 5H59A 1KJWA 3RLIA 4OHKA 3L7LA 1C30A 2J08A 2G77B 4MX8A 3ZWNA 4DQXA 4NE9A 2P79A 2PUCA 2ODAA 1BXRB 3I9OA 1SCUB 2ZFUA 1J21A 1GPDG 3N7TA 5JS7A 3DMYA 1KRWA 2KBFA 2WYOA 5BRNA 1VB3A 3D8BA 3DDUA 4MB6A 2XSZA 5KINB 1EU1A 3WGNA 1KAQA 2QN9A 3KVVA 4GZ3A 3TM5A 4A0RA 5B4VA 1H6DA 4DRZA 2RHLA 2I6XA 1N32B 2X4IA 4EI7A 1XJWA 3ZBPA 3DJYA 1KU0A 3PNSA 4PFJA 5CLIA 3SSMA 4PV7A 3ZWVA 1FU4A 4ZV7A 4OGWA 2I3BA 4DLTA 1G8YA 3RAEC 3VHXB 3N2GB 1NJ6A 5C46F 4GG1A 4U3JB 1D5WA 1GQOA 3A2LA 4I66A 5HP4A 1SVWA 1FSGA 1MRNA 1D2RA 1E0AA 4GI1A 4WNYA 2Z8YA 4BQQA 1VMIA 3KXKA 3SLGA 1AQYA 3B9PA 4HWKA 4IDQA 4C3UA 2AFHB 4Z51A 5BSGA 5FLXA 3ZZNA 1WCXA 3T52A 1C2YA 2GO7A 2NO6A 1RI2A 3VZSA 4BNVA 1G66A 4DFDA 5DX0A 2HU7A 1LPMA 3QOFA 4UHCA 4CDNA 2YS7A 1CULC 2VJDA 4JB0A 1VPDA 1P3JA 1C7RA 4HS9A 4LC9A 4CTKA 5K9ZA 2Q0QA 2F1OA 2B99A 3D4OA 2B4KA 3KJNA 5IXSA 3K9CA 3MUOA 1AC5A 3FIUA 1P9LA 1TYBE 1V11A 1R2QA 3WGHA 1JE0A 2YFQA 3G8AA 4DLBA 4V0LA 4E1VA 3DMTC 2BFNA 2FFAA 1T9GS 2AUNA 4YRJA 3UOGA 5C8YF 1HDCA 2QPAA 3Q6IA 2FEMA 3ND8A 4OSPA 4U9HS 4WDQA 4HEHA 2WAOA 2CYBA 3OQVA 4HL6A 2REXB 4LISA 4PLCA 3LPAA 1P39A 1KARA 4RQUA 5F2KA 3UWSA 2F1IA 1QAMA 4FYIA 1EH5A 3TQRA 1QV6A 3ZOKA 2IVZA 2RGYA 1LSSA 1Z5VA 3L1IA 2EQBA 4KAFA 1XEWX 3OP1A 2W98A 4KVAA 4WBSA 821PA 3BWXA 4RHCA 1B0ZA 3GA7A 5EY5B 4IDEA 4H3HB 4B3BA 4X44A 1MNAA 4LYEA 3SS7X 1Z4JA 5JHGB 5FWXA 5CTAA 2MWMA 3THOA 2SECE 3UICA 1NG1A 1Q0ZA 2XH8A 4RCYA 4WLEA 3CUSA 1L5GB 2J45A 4ES6A 3KVNA 4HH4A 4DANA 3AVYA 4NS1A 4E5UA 5B1SA 4QXOA 3N70A 1LA2A 1XVTA 4IP0A 3GMDA 4XEUA 3AUUA 3Q9LA 1RBQA 2FWPA 2H1FA 3AR6A 1ECLA 4BY9E 3TD2A 2FSGA 4B45A 3AMVA 1EVYA 1ZCFA 1Q21A 1N25A 3U9TA 3AB3A 4ARUA 4FEGA 5T6MA 1LEHA 3OPYB 5DCLA 1U7XA 1JHYA 3LOQA 3FN4A 3F73A 1Y9JA 3B2EA 1Y4UA 4YRDA 5HDBB 1BOOA 2BDUA 3QVLA 1T2EA 1KJYA 4A5OA 1XU7A 3SEAA 2X8LA 4FWBA 1XMJA 1VLVA 3D6TB 3IQFA 3I01A 2II6A 5AH0A 3RVMA 3TBKA 2IU4A 3DPSA 2O2YA 3MMSA 5IJAA 5BOSA 1QO7A 4R5MA 4JGIA 4RQTA 2JANA 4FONA 1ZUNA 3RDPA 2DFVA 3PP8A 1CUVA 3LQKA 4II7A 4ESEA 4L5YA 3QSYA 4ZT7A 2C1XA 1R5NA 3SZRA 3IOEA 4QUEA 3QK7A 4IRUB 2NXJA 1T35A 1DC7A 3MFYA 4C88A 3A1DA 1ENOA 5F51A 3RVNA 1KEVA 4EUHA 5K8UA 1DO8A 2N3ZA 4JQSA 1RDFA 4G85A 3K70C 2HF8A 3PI7A 1XEWY 3CG4A 2NO0A 2LGJA 2XTJA 2O57A 3TTXA 4ECEA 3GCWA 1AKUA 1MG0A 4BE4A 1A82A 1LI7A 1QK3A 4KXLA 4WEOA 1TM4E 5K3DA 2PZLA 2AMJA 3TGPA 5ALYA 1OWLA 1AKRA 1W8IA 3A0UA 4H1WA 1KF0A 3QVGB 5EHGA 2C2KA 2IOYA 2WKPA 2WJVA 2ZRPA 5T3YA 1XMVA 1D2EA 3N0XA 3OIYA 3RYFB 1SZCA 3MTIA 4PWYA 3ZTWA 4F3TA 3CO0S 2BF4A 2QLFA 1QP4A 3LTNC 3AL3A 3DF7A 5AK4A 3H9JA 3JD0A 1FYXA 2WNSA 3LRPA 4YS6A 1NYQA 4F5ZA 4IXWA 4YV2A 4Z8YA 2XQFA 1URPA 2ZRIA 4QQRA 1TEVA 4DLVA 1XK6A 1WU7A 4X9XA 1FDTA 5CHYA 4Y7CA 3EN0A 3P94A 5AI6A 2VJOA 1G7CA 2R8RA 1HYBA 1PHPA 2WA1A 4TT8A 4CIAA 2HHJA 1MAHA 1PWXA 2F55A 4D82A 1HA3A 2EJVA 1RZUA 3OIFA 4MQ5A 3GWZA 1CRPA 3TLYA 4WA8A 1XPRA 5GOZA 3VSAA 3V1TC 2ZPAA 3NANA 2CBZA 4FMCF 4CUKA 2IOFK 4IG9A 1PJRA 4ENTA 3EW7A 5KX5B 1QF7A 3JR3A 1NXQA 1I6MA 3O8DA 1E2HA 3AF2A 5E7QA 3VOSA 3H17A 3CZCA 1WDMA 5HS4A 2O8EB 4N12A 4C7OA 3DE0X 4TQUS 4A2PA 2ZI5A 2VUIB 3A31A 1VYVA 1BC5A 4N8DA 5LYJA 4WKCA 2HA6A 2J5RA 4JBXA 4I55F 3H8SA 4PYLA 1S4MA 1N5IA 3PFHA 3DUFA 5IN4A 1IN1A 1YZVA 4INAA 1JQEA 5HWSA 2QTVA 3RC8A 3P9PA 1ULHA 5A5DA 2I62A 5F9HA 2P5TB 3B9QA 3DE5X 3TSYA 3VAZA 5BMVB 2CZCA 2I3GA 2P90A 2XOKD 4URVR 3ESBA 5JD4A 4H17A 1CSEE 2BSAA 2GVNA 4RM2A 4HVLA 1ZR2A 1L5HB 4UATA 1TIBA 1VZ3A 4K9DA 3ZHCA 3GLHB 4D96A 2D5BA 1AHHA 1BDHA 5IM4A 3MINB 4A03A 1MB2A 3ELBA 221PA 3ZUPA 1F6WA 3U16A 4NFHA 1J06A 4YRIA 3D6HA 3VPGA 3AEKB 5D00A 5TMBA 5CXQA 1TGYA 2Q41A 4N5DA 3R5KA 1JHUA 2NTVA 3AWIA 3IUNA 3LK7A 3FCXA 4WK0B 1W4AA 5DMHA 3W5UA 4O2AB 4CN9A 1G59A 3DTVA 5BSTA 1ZGGA 4R40A 5HQJA 3CRRA 4F4UA 1L4YA 2RONA 1SBHA 1F2TB 1C4XA 1UJ4A 1GRRA 4PPNA 2HB6A 5G0UA 4IPTA 5CUQA 5KHAA 3FROA 1F9EA 1VL1A 2WVJA 3MCZA 2IODA 4JLPA 1EVLA 1SVOA 3N0TA 4L2IB 4B81A 1M2VB 1Y34E 4B7UA 1HZZA 1VB5A 3DBRB 4MGYR 3WIVA 1CR0A 1ZRMA 2YL2A 5DN6D 1JEYA 1BS2A 5C31A 3U19A 2I1VB 1SO8A 1P4JA 1CEYA 2O2CA 4H7PA 1FP6A 2O2GA 3WFZA 4E5YA 1RYNA 2JIZD 3O9MA 3PFIA 1Y7IA 1Q6ZA 3DHEA 4P81A 2YW9A 2WWHA 4RFSA 1COWD 1ZW1A 2ODNA 3L0CA 1SM4A 4RA9B 4MINA 4UXHA 5T8KC 3O8LA 2ZB2A 3DFKA 3OCVA 2B0CA 2NZVG 1C8LA 4MDYA 4EYEA 1RYFA 4OQPA 1JTFA 5K8LA 3C7CB 3QXHA 1ZWLA 4F9FA 3F3YA 3ONWA 4NOMA 1JZSA 1XZ8A 2OXIA 1P1BA 1ZG3A 2Y9PB 3O94A 3PXXA 5AJUA 1P7ZA 4NBUA 5H16A 3IVMA 3ROXA 3LRXA 1ID1A 1Q0RA 2FPKA 4Y8VA 1BQ3A 1EXNA 3EC2A 4LHXA 3ZZTA 3GLIE 3ZI4A 4AX4A 5LBIA 1DJQA 3MJEA 3ORSA 4RMIA 1VJTA 4ESHA 4AP6A 3HB7A 4ZOLA 3CANA 1NF8A 4MDEA 1VJGA 4FDAA 4X64B 4D4JA 2O8CA 4AJ4A 2QUHA 1UWVA 5DBIA 5FORA 2FKAA 3PYXA 5JOQA 4Q1FA 4EHIA 2GN6A 3EUWA 2FSFA 4HYQA 1JSRA 3QWFA 3U9SA 4A91A 3DULA 2QLNA 5DGXA 1TJYA 3JWGA 2HRRA 2DWOA 2J48A 4K3UA 4JI8B 1XZIA 1PKEA 4BLOA 4C4OA 5KQLA 3RC9A 4IQ4A 1PJCA 2EP5A 3EG9A 5K4AA 1ECFA 3EZ9A 4CQMD 3UAZA 1C1XB 3HYLA 4U6SA 2F4VB 3AOEC 4JK3A 2ZP1A 3LUFA 3E22B 3OLXA 1WZIA 3BF8A 3ENKA 1EQ2A 4MRNA 4CI9A 1RNLA 5IJ9A 3HUEA 4D3XA 1M8FA 1UMDA 5FUXA 3TL3A 4RWEA 1SNYA 2YDYA 3L84A 4JOBA 1LD3A 3G5LA 2W2MA 2X9NA 4IIJB 4Q9NA 3UJ6A 2PZAA 3K05A 5KNDH 2E4VA 1GPBA 4BQRA 1RZ3A 3GIWA 3AKDA 4J6EA 2FW0A 3M4YA 1P77A 1G98A 1QIEA 2HCJB 2IQIA 4RV9A 5BOVA 2AX3A 3BC1A 3RVPA 4S0XA 3NWEA 2P2DA 4Q37A 2CHFA 1Z8NA 5EAIA 1SVMA 3AHHA 4MLPA 3BJMA 1U80A 1ZVKA 4YI3A 3Q3IA 5I9BA 1I3NA 3UHPA 3UH0A 4U9UA 5FR1A 5DOZA 1PJAA 2BFEB 4TL7A 4LRSB 5AXDA 5U4QA 1AHPA 4ZFNA 1DX6A 5IHXA 1GGEA 1G2IA 5ADHA 3CNQS 4NXMB 4MCHA 1FYVA 1V9SA 1II8B 3K0BA 5K3BA 3ZXSA 4DV2B 2Q1WA 2RHJA 1TLLA 1KORA 2CFRA 3PV0A 3KQSA 2R6AA 2XCSB 3H0KA 1ZUIA 4MW6A 4UBKA 3RJZA 1H6AA 1YFLA 4KU4A 4LOIA 1SIBE 1MO6A 5DEOA 4AS3A 3QY0A 1HDIA 3DGEC 3LLVA 3O90A 3VV3A 3W3AD 4D7AA 1C50A 2C7OA 3T9BA 3IMGA 4UE2A 1KK3A 1BS1A 3BL5A 3R0JA 2X1VA 3EOBI 5CITA 2CJPA 4F9GA 4L72A 2FSPA 3WSTA 3AIOA 4YGXB 1YFJA 3L0IB 3RVRA 5GONB 5EA2A 4NZMA 4ZYTA 1E9CA 5LIRA 1T91A 4UZEA 5IWAB 1DAMA 5HZGA 2ZB8A 2QHXA 5KYWA 2BJWA 2WSBA 1ZN8A 1ESCA 1T5BA 3ITEA 3LP8A 4RPIA 5ICFA 4YCCA 3ZE2B 1QRUA 1AGNA 2QX9A 2IY8A 1A88A 4IEEA 3S4YA 1ZR4A 1EXDA 1WMFA 2R25B 3ODGA 2KW5A 1NR5A 5EQTA 1TB4A 3QKTA 1NP3A 3S28A 2AR9A 2ETVA 4YCSA 2I2CA 2AEFA 4JHLA 4P9NA 3AJ9A 2YBDA 3EGCA 2WPNA 2DUNA 2HH9A 2QXYA 1JJVA 3DR3A 4M22A 4L5IA 3BJEA 2GK6A 5A1TA 4BMSA 4M6WA 2YHBA 5JI3E 1JL3A 3QEAZ 4RXTA 4MLCA 4FILA 4D3SA 1PJSA 5F7OA 4MVJH 3DLAA 3QF4A 4ZC8A 1BXKA 1ZVQA 2AFIA 1JKFA 3UH1A 5IULC 1P2TA 5EIWA 4NQZA 2BIFA 5GY7A 3VR1A 2O2DA 1C81A 2JDID 4PQYA 3UV6A 1U3GA 3QVGA 3NU1A 1W0CA 4X8HA 4ZMBA 3K1JA 3UB4A 4ZREA 4RSMA 1MO5A 1D1PA 1BW9B 3T5CA 5DW3A 5GV7A 2C03A 1RXIA 1RBMA 2QLBA 1NURA 3BL6A 3AR5A 2NTEA 3INNA 4JUAA 3ZVKA 3RYHB 2EJBA 2WAXA 4WNCA 3QENA 4A36A 3MMPA 2X8AA 1QQ6A 3DMTA 4NNPA 1ICEA 4WUVA 4C7KA 1GM5A 2A0FA 4AKGA 1N6RA 1U2GC 4WL0A 3VVLA 1FFSA 4A6EA 4BNLA 4W5WA 2IXBA 2X15A 2ECPA 4FE4A 2BFFA 1GCUA 2QNBA 2WP8J 4IEIA 4M4SA 4A1FA 2ZETA 3I2IA 4J16C 4WBNF 4Y0NA 1KI8A 5HZMA 1RLMA 4Q05A 1BA3A 1NDHA 1UADA 2EZ4A 4I55B 5HCIA 3JYOA 1NGSA 5CLQA 2V5VA 1G1MA 4KNYA 4IF4A 3N8IA 2KLBA 2E4UA 4RDIA 1IZ9A 4MSUA 4WGFA 1O5OA 5ELLA 4MGZR 4LQ4A 4W1QA 3OCJA 5EINA 1SN7A 2PUJA 4QRIA 4V1CA 1QIGA 1UXIA 3E0QA 3MGAA 1O0BA 4MPJA 2I9KA 1DJMA 4JEUA 2CKDA 3CLRC 1HE3A 2XIJA 3KOYA 3LPDA 3NAZA 4FE7A 4N4AA 3H1PA 3O7WA 4QDXA 2JJ2A 1IG0A 1DWOA 1LPAB 2BWJA 2QAGB 3SC3A 6GPBA 4AZSA 5GP1A 3DEFA 3FVRA 2ISSD 1JIIA 4FBMA 3C5WP 4X3OA 4ZVTA 5TX7A 2B94A 5AVXA 1VP3A 1G8GA 4BMNA 4J1NA 4GX5A 1LBTA 1P45A 5DBFA 4BFXA 5JAIA 2OY0A 2VBFA 4U4AA 3OIVA 1XDGA 7MDHA 2HRQA 2R96A 4DCTA 4FEYA 2QLMA 2GUGA 2H0AA 2BUCA 3MGCA 1BKSB 3K0CC 2R6HA 1MT0A 1OUMA 5CLLA 4L4YA 3CUEF 5LLDA 3GPLA 1V71A 2FPGA 1IUPA 3I52A 4HAUA 3ZTTA 3V00A 4TS3A 1U0NA 3C70A 4MJ7A 4ZOCA 1JJAA 4CMIA 1UFOA 1W85A 3QY9A 2F90A 1UXJA 5HG0A 2V7TA 3J7TA 5K2OA 1FF9A 2CXRA 3PTZA 2OPHA 3TRFA 1PU2A 2CLMB 2I78A 2OXRA 4KOEC 3RM3A 4M8LA 3BDVA 1CZNA 1FSSA 1KHHA 1VXRA 5AT1A 2EW1A 1PFGA 4E7OA 1QZ3A 2HEGA 4N65A 3TTSA 1VI2A 2Z2KA 1TOAA 2QYTA 1LVHA 3ICEA 3IJRA 1JHAA 4U7JA 1EFHA 3KHTA 3AVQA 3Q9SA 4NFLA 5DTRA 2HPVA 1ISSA 1ILWA 3T12A 3DDHA 4F8JA 1COWA 4KQJA 1UDCA 2BR5A 1NYLA 1WDLA 3Q98A 4PTLA 1TK3A 5BRJA 5KQMA 3O4GA 3DT8A 4PNEA 1M3SA 4IZOA 1NE2A 1K8XB 2WU4A 3EXFB 3JYNA 4NK5A 4PQGA 4R1QA 3PHHA 3A1NA 2OCKA 5SYAA 3WWCA 3DL7A 1HZJA 4PQEA 4Z2YA 5JCZA 1DDIA 1HDXA 4G0XA 1KEWA 3OZIA 1T9ZA 4LVUA 5IK2A 4QOFA 1VYTA 3QU9A 4X60A 1EFKA 3OY2A 1Z9BA 5AQEA 1S2LA 5GM1A 5T4EA 3ST7A 3FTEA 2OLEA 5FV4A 3HXTA 4L75A 2VQFB 2R9VA 4L57A 5EQDA 5E6UA 3UHOA 2YIJA 3JQBC 4FLFA 3F6SA 1PYOA 1L5VA 2LKDA 3HGMA 3JRXA 3K94A 3PYLA 3ILYA 1Y6ZA 2Q3FA 4WJZA 3SBEA 4YUAA 4F3NA 4RY9A 3GJSA 4NJMB 2GM9A 2ZRFA 1TXGA 3AFIA 1SQFA 3H6KA 1Z4PX 4MV1A 3VOBA 4EA9A 3PUHA 3GGSA 4YLYA 1OFVA 2EKBA 3T5GA 3DD1A 4N6NA 3JU3A 1I7LA 1Z0SA 1YR9A 4JVOA 3STUA 3ZU2A 5B12A 1TM7E 5JDCC 2IIPA 5ICEA 3O75A 3GGCA 4WWHA 1JHDA 3KRTA 1N0IA 3ITNA 4XX1A 3KSMA 1HMYA 1FFXA 2H92A 3BQNB 4FDLA 5JCJD 4BP1A 2WY2D 4E32A 3BSYA 3ZWOA 1WPRA 4L8YA 1U81A 2WTNA 4PO1A 1AKEA 1N5RA 1SXHA 1LQTA 1T9CA 4MMXB 5TQ0B 1ZONA 1B16A 4CLXA 5IAAA 4AT1A 1BDJA 2Z3VA 4KLNA 5F5NA 2O3RA 1L6IA 2OHXA 4DMLA 4J4BA 1TLTA 2PRKA 4WH0A 3ZX4A 5CVJA 2JAXA 4K9SA 3RJTA 5KNLA 4DM4A 1U0RA 3GAMA 5A4IS 1CHNA 2CLCX 1MD9A 2BI4A 3S27A 1JDTA 5JATA 4D8WA 1WHSB 1K3UB 3NVMB 1H2AS 1R6AA 2O5EA 1UP7A 2FE1A 5KNDD 3BIFA 4J1TA 2YFYA 4KKXB 3ZCRA 2BH2A 1KQ3A 3NHSA 3PFWO 2AUTA 5CM9C 2RGRA 3A2KA 4XTRA 3GH3A 3QUCA 1PZEA 5HE8A 1YJCA 3A14A 3KM0A 3WK8A 5BN3A 4U2CA 1N2OA 4M0FA 3Q8MA 1CVIA 2IHZA 3OQIB 4DC0A 5BORA 2CL0X 3REQB 2RGDA 1MAVA 1V6AA 4QUHA 5TEWA 4B6OA 2VZLA 4BQNA 1PAUA 1SRRA 4TMWA 4HX2A 3JQAD 5EWLB 4XYMA 1V5GA 1GSHA 3UFBA 2J4DA 4IW3B 5FI5A 4JV5B 3V48A 2BM0A 4YMTA 3KPJA 3STHA 4BMCA 1VGVA 1G1AA 4S24A 1EM8B 2AFHE 4OU5A 3WLKX 1G20A 2OLKA 1NXTA 1UPUA 4JMLA 5ALSA 4QVIA 1RXSA 2R2GA 2JAQA 3LLMA 2G0AA 5P8WA 1GADO 1GKIA 2ONZA 3GEIA 4NR0A 2ZUVA 3BD6A 2FMIA 2P8SA 1WG8A 2IXAA 4P4TA 4B8ZA 4AJ2A 3G3EA 5JMTA 2PNFA 3FOEC 1YR6A 4QXMA 1T4GA 3T99A 3U62A 1TA9A 1W46A 2IDJA 5TGTA 5KYUB 3EY4A 1XNJA 5A62A 3ONDA 2ZUCA 2BTEA 1ZKMA 2BUBA 3GEMA 4Y6LA 2RK3A 2OCPA 5KCMA 4A82A 3ESCA 1MQ8B 4BUJA 4CV0A 1RYYA 2P9EA 4GSKA 1JHZA 1MMFB 4LCJA 2Y1CA 3D2BA 5HJ7A 3X2EA 1YZQA 1IXKA 4BUCA 4FN5A 1T5IA 2HRCA 1BH6A 3EVEA 3ZOZA 5CA0A 3PYMA 1WIWA 3ZK8A 1XRNA 2ZLBA 3K9LA 3PVCA 2UZ1A 4NSNA 5FBQB 1E1RA 1KDRA 2G17A 3JY6A 4J43A 1YOBA 1XVVA 4RH3A 4B4OA 4BB9A 2PRZA 1HK7A 4MW0A 2XECA 4TSKA 4UNIA 4C21A 1KFCB 4OP3A 5ENDA 1P9OA 4E7PA 1MZVA 2I6QA 3HDTA 4TZ0A 4XWAA 2NZJA 2VPIA 2FEAA 3A7EA 5JD3A 3EPPA 5HRAA 4WXYB 3IP1A 4WZBB 1EJ0A 4JI6B 4ALKA 9LDTA 2XUDA 4AL4A 2GHQA 2WM2A 1PL7A 3NCTA 3E84A 4Z7OB 2AEEA 2BMVA 1EAYA 4HPWA 3V3KA 4GMGA 3DP7A 2R7AA 3TX2A 4DE5A 1EK5A 1NT4A 3LXXA 1EGQA 3WY9A 1TO6A 3UW1A 5L3RA 1A77A 1Y7PA 1OI7A 3A9UA 3OFNA 5ALGA 4D0RA 3IUSA 5CFQA 4FM9A 2ZJYA 1YFZA 1UT5A 4PBSA 3KV1A 2AB0A 1HSZA 3AUXA 2HJVA 2D7DA 4YRZA 4AM8A 2WSYB 3U4AA 2CEKA 3I45A 4AJNA 1WA5A 3IUJA 3WL5A 1X80B 1Z37A 3KJHA 4ZHQA 4J03A 4JZKA 3D1LA 1T26A 1Z47A 5CK4A 4C5CA 2FFQA 4EARA 4D9GA 1DTWB 1XKLA 2BJVA 2VUSA 1U31A 3D3JA 3PNOA 4M60A 4OVKA 5CNIA 3JQ8B 1W44A 2VBGA 2QB5A 4EGSA 1SK9A 1YASA 2VR1A 4DABA 1VKJA 5LP1A 1U3VA 2PMDA 2VDNB 2A5FA 2W2PA 4KQGA 2EERA 5AXBA 3UCXA 3UWMA 4ESOA 1IONA 5FTKA 1KH1A 1PR0A 2BVNA 4TZ6A 1PDWA 4DM7A 2AWNA 1N36B 4XAQA 3I2GA 2XUOA 2EZ9A 2P2LA 2O6LA 2VSFA 4LHWA 1NHWA 1XWWA 1X7HA 4BNYA 3T4EA 3RFTA 1H8EA 4OGFA 3L0PA 1M1YB 4QO8A 3KQUA 1OZFA 2GHRA 2EFGA 4KDEA 2BSQA 2GEJA 1EBFA 3CLSD 1Y6GA 3L4BA 3FFTA 4NFSA 1NV9A 2R11A 1UK8A 1CZRA 1TM3E 1W30A 2HGZA 2GZ3A 2C29D 3A3NA 5ALVA 5CB4F 1NXWA 2QUJA 4M83A 3LSYA 1W96A 1DINA 4HAIA 5A5FA 3KQKA 3T3EA 5HUJA 1XG5A 4P0QB 2X23A 2VSQA 2Y1OA 1WHTB 3I8SA 4HNSA 3TOSA 2AFHA 2I29A 1J8MF 4KDRA 4RVDA 5SV2A 3CM0A 1JXAA 2FN4A 1KJ9A 2D5AA 3DBLA 2DY0A 3GUUA 3LTEA 1FFYA 4QUBA 2ZJ7A 1HNNA 2EFYA 3CSDA 1K2WA 3IPAA 4MI6A 1HDZA 1RM3A 1Z5NA 4MKRA 5FOTA 4BFLA 5JSKA 5KYTA 3JWEA 5AW1A 2B98A 4PPYA 3OQJA 1CUWA 2EOAA 2PSSA 4X6UA 1GCAA 3L7YA 4QGSA 1QIFA 3O4IA 3WBBA 2YZGA 4KR3A 1I6KA 1T4BA 2MYUA 1NMSA 5DIFA 1RQ7A 2FFRA 4X20B 3Q10A 5A04A 5IVHA 2B3DA 2WVAA 2O4CA 3GYGA 3D59A 1KWGA 1GAWA 1BVRA 3I5MA 4F84A 1RQRA 5KTSA 1KO7A 2CLEB 3P2JA 3OBBA 4GO1A 4M0DA 4IOKA 4NENA 5D3MA 3KPWA 1YQGA 3B1VA 1IY0A 4RXMA 5EZSA 5BR4A 5KKCA 1SUEA 1RWQA 4X92A 4Q5IA 2CV1A 3PEUA 1PR1A 1E1DA 3QUBA 3GJRA 4K88A 3WA7A 1TJ3A 1UBRS 4F04A 5BVHB 3U1VA 1WAMA 1B7GO 1Q50A 2ZRHA 3COSA 4G86A 1SCUA 5H68A 2XCLA 4W9NC 3WI7A 2ZIFA 2F3QA 3DLTA 2ZTVA 2ZR0A 4BQFA 3FHOA 4YR9A 5D86A 2FQ1A 1R9JA 2RHHA 5CX1A 1IN7A 3B2QA 3WRYC 2RB4A 1UP6A 2ZJ3A 3W6PA 1XWFA 2OCGA 2ZS7A 3MBOA 4B8YA 1GU0A 2B5VA 2M6RA 3K2EA 2XCTB 3RAJA 3TXXA 4DA6A 3QBEA 3RJ5A 5ISMA 4MQBA 1GTVA 3K8ZA 2WJPA 4CM9A 3GZJA 1OTYA 1T36A 1NVMB 2JI9A 5E6UB 5F5XA 4INZA 4L1KA 1UR5A 3EEFA 5L3ZA 5EIOA 4OH1A 4FWIB 1Y5LA 2X8BA 3EVBA 3HADA 1WLYA 4WKGA 3THRA 1C9EA 8ABPA 1FZTA 1ORVA 4BVGA 1KNXA 3MSXA 2EIHA 4CL2A 4XQ0A 4XQEA 1MABA 1ZD5A 2PH5A 2QZ9A 3B38A 3O3OB 3I5YA 1Z35A 5AOAA 3B48A 4I08A 3NW9A 4FJ0A 1IJKA 3HEMA 4TSFA 4DEVA 3Q11A 2NADA 5A7GA 3TTWA 1NKTA 3GLHE 3PPXA 1OGYA 2XVYA 1CD5A 1DEOA 2HRDA 2AC7A 4C04A 2DM6A 2VRBA 3QU2A 4QYMA 5ICCA 1RCTE 5FWYB 1J0EA 4L76A 4MRPA 4RJIA 2P3LA 4LNUA 4LSZA 5FUVA 3ADDA 1PR2A 4AWAA 2PJZA 2P8JA 2I34A 2WWWA 1P7WA 5C8XA 2PUEA 3FHJA 4R2XA 3WNDA 4KVGA 4DQDA 3DM9B 4LXXA 4RC9A 5I7SA 3ROQA 1KIMA 3AY0A 3SJBA 1K7EB 1TU4A 3AFMA 2FMUA 5KVCA 4B2PA 2A0WA 3ZE1B 2W93A 2WMOB 4Z1MD 2E21A 1QH8B 2NQ8A 3S40A 1SC9A 5JSHA 1E9SA 4ITUA 4G4SP 3NAGA 1KH3A 2OHOA 4UPVA 5FBKA 3S68A 2ZK7A 4U8GA 4DUYB 5IKMA 4FDMA 3D6FA 2JFWA 4XGRA 1V47A 4DJDC 4X8OA 4XYLA 1OX4B 3RF6A 1DCMA 4I81A 4AG6A 3I58A 4JYMA 4X7RA 3V7YA 1E3WB 4OSOA 2WIJA 3EARA 3HNOA 3EGWA 3VTKA 5B57C 4M0CA 5ILOA 3OU7A 1CKEA 1E32A 1A27A 4BEBA 1UDBA 4FIDA 3EBLA 3GC6A 1PNQA 4QGBA 3PQ5A 5JCOC 1CZLA 3VPAA 1Z26A 3B36A 1J33A 2ZIAA 3TL2A 2A5LA 2JH3A 2IDMA 2C42A 1JYFA 3THWA 2IF2A 4HFNA 1KDPA 2HHAA 1KQOA 1JU4A 1U8AA 4PAQA 4A5SA 1Z28A 2DY1A 3RSZA 3S8MA 2YYZA 5HKBA 4AURA 2GMWA 2R5FA 1XMXA 3LY5A 5TF4A 3S2YA 2W22A 1YHYA 1BD3A 4RNCA 4BMOB 2QK4A 5L3VA 1V16B 1GKKA 1AH2A 2EG5A 2VHVA 3I37X 5FL7A 5IF9A 4ZO4A 3V4FA 3ZXXA 3CSUA 2BGJA 2FMXA 3FD8A 5EJIA 5JQGA 3QFHA 2AJ8A 1KPGA 3SY8A 2NXNA 3VDXA 4E09A 4ARIA 1BMQA 4DS3A 4L3OA 1NDQA 2C2ZA 1Y98A 4C6SA 4JBGA 4CLDA 2OZLB 4PG5A 2X4GA 3D6NB 2NX2A 3WWYA 3SC4A 2C77A 4D4MA 1AV6A 3PFKA 1UF9A 3MXOA 3QLUC 4BB0A 3HEBA 2IS1A 3A4YA 3TLJA 2CD7A 5K3EA 1OU4A 1CJSA 1JF8A 1Z8FA 2R6GA 4BO2A 1XL1A 1PNTA 2QIOA 2L82A 3JQBA 3LQQA 3PRYA 3QWAA 1MVLA 4M38A 3KU4A 2H4WA 2YJNA 3QNMA 6REQA 3OEHA 1UMCB 4RTPA 2ZYWX 1JLLA 3GRCA 1MRSA 3CZPA 2XX3A 3SIWA 2AF3C 4WZZA 1WP4A 3NC0C 2J4CA 1V1JA 4RORA 2QBYB 2ID7A 1PV2A 2Y1LA 3BGIA 4FKBA 4BFTA 4BP3A 1TLFA 2DCMA 1HTTA 5KJEA 3VI4B 4CQLA 2OTCA 5JH7B 3INGA 4HGQA 4CEIB 2O23A 3JX9A 1N2SA 2O8FB 1FEZA 3QNUA 1H4VB 2W42A 1ISGA 4RK4A 4M99A 3UYLA 2DR0A 1UK9A 1B6TA 5A03A 4NPHA 3WK5A 1A9RA 5IAEA 4G0WA 3VJRA 3NNDA 4DEYA 1IEVA 1QQAA 3E15A 1NRWA 1TQDA 1FVOA 3ASZA 3AUTA 4BNKA 1SUBA 4EO9A 3OBIA 4K2AA 1ZZEA 2BFCB 1MJGM 3DDCA 1RIFA 3IVAA 3O4JA 2X0JA 3Q8WA 5G4KA 4ZN6A 4FFPA 2BKUA 1EWQA 3V1MA 1MH1A 4V3CA 3NWJA 3ZW9A 1FE8A 1BWSA 5BUQA 2K5UA 1HC7A 3BE4A 2CZGA 3AVOA 3H11A 3TM4A 4A8HA 3MILA 2JLWA 1KE1A 2PBFA 2HIGA 3O8NA 1RRKA 3NOVA 2OBYA 1ZLYA 1DEXA 1M1YE 1OLSA 2H1RA 4K6KA 4N7JA 4GU5A 1ORHA 1J70A 2HJRA 4IIJF 4J4HA 2P2GA 2CVQA 1TTHA 3PU6A 4NOKA 3O93A 3L1JA 4GH5A 1Z63A 1DJNA 3ZHYA 3EVDA 4P98A 4DDKA 1PI3A 1SWVA 5A7FA 3ZQ6A 1O4WA 3MK31 1XTSA 2F9FA 4JB2A 5AI8A 4X91A 1A4IA 1TVCA 4PYOA 1L7OA 1YK1A 421PA 2G6TA 4DR1B 5ECYA 5KNCD 2OR3A 2GKOA 4ZU6X 5J3JA 2IU6A 2IPAB 2VJBA 3RKSA 1SHJA 3TWOA 3BSWA 1QGUB 2ZWVA 1CJVC 3NIDB 5IARA 5DULA 5A9RA 4HH1A 4ZWNA 3RFUA 1E1CA 3TG8A 1TJ5A 4K87A 5LZ2A 1JE1A 1R74A 4KP7A 2FLWA 2V5AA 1UINA 1NZFA 2COKA 1PZFA 3LQRA 1Z56C 2O05A 3IV7A 3F4KA 2GN1A 2IW1A 1SD1A 3KJIA 4TZTA 4YN3A 5HF6A 3HJGA 3N5KA 2H85A 3ZWXA 5JXHA 1QXSA 3TF5A 4X41A 2I4NA 1KVRA 4JROA 3UHFA 3TAHA 2UXCB 3LG2A 2IF0A 5HSGA 2QI9C 4CGZA 2WFLA 4Z4FA 1Z25A 5JH7F 1NQTA 4IDHA 1PWZA 4BL5A 3FUVA 1DIBA 3T0IA 2YN2A 1N9GA 4BN0A 2H9AA 1U7WA 5EERA 1DTEA 3C1AA 1BCRB 5IAOA 5CHEA 1Y37A 2P9HA 5AHKA 4HXFB 5EJ6A 4ENPA 1P1RA 2YR0A 5AOCA 3IUQA 4G4JA 5EIHA 5JTUA 5C5IA 1XN4A 1PR4A 2ZCVA 2ZXFA 5K4GA 1GQSA 1BNCA 1OKKA 2B21A 4MQFA 3PB3A 3DTTA 5JAZA 4LF5B 4OHFA 4ID3A 5LD2C 5IKPA 3KR2A 3JZIA 1O0SA 2R7LA 2VPYA 3CR8A 1V8ZA 2PIDA 2V4ZA 2R85A 1JFVA 2VDLB 3GU3A 3P0HA 1UZNA 1N2ZA 2F8SA 1ZMOA 4GBGA 1D2MA 3AHDA 2VZ0A 4I1YA 4M9SA 4MHSA 3UWOA 4W4TA 3A4MA 1FP7A 4LA4A 1T2NA 5LSAA 2UZIR 2C54A 4NAUA 4UFPA 3KSZO 5AVKA 3ZBQA 1J2JA 2C99A 3M1AA 3OTQA 2CK3A 5T67A 3N0WA 4LY9A 1V7QA 3FGPA 1DKPA 2R1VB 3BBPA 2P4UA 1WZCA 1NW9B 2ZRJA 3V4ZA 5JPCA 1GN9A 4TMKA 2ERXA 4YB8A 1XHLA 5BUCA 2HU2A 1I7QB 4JGBA 1AHNA 2IXGA 1KETA 2Y9MB 4FZ3A 3PD7A 1P5ZB 1A95A 4G8BA 3RAFC 2YVUA 1B93A 3UV3A 3VR4H 2BPOA 2H2WA 2NZUG 3RC7A 3C7KA 5SZIA 1EESA 2JFPA 2O52A 4TVOA 4QWWA 2HW8A 3MJVA 2YVLA 1FSFA 1I0IA 3E61A 2VPXA 3IBSA 3R5FA 4NAHA 5BW6B 5E38A 5IFKA 3KEGA 2EFCB 4LCEA 3THXB 2EDAA 2IOHA 3P2KA 4DKJA 2IA5A 4O2BA 1NLMA 1XQWA 3AI7A 3CEHA 3ZGYA 4RULA 2JD1A 2QJWA 3ANTA 2QRJA 1R15A 3QMWA 3TDNA 5B55A 3Q4GA 2H9IA 2WJGA 1O6FA 1OJ7A 1RWWA 2OM6A 1ZY2A 1DFIA 2WHEA 1WD5A 1WZNA 3RQIA 3LWBA 2FNAA 1KI2A 2B4AA 1SBYA 1GQFA 1P9WA 2H8KA 3TG2A 2QENA 2JLCA 4OY3A 4YRAA 2PKXA 1IBSA 2FVXA 3EOZA 4LRXA 2CE2X 4R54A 4HF7A 3DL0A 3VYTB 3OJXA 1RE0A 1LFAA 3HR4A 1II9A 2A1UB 2WKSA 5E0KB 4PYQA 4XOUA 4OHWA 5E0OA 4E30A 4P7BA 5DP2A 3ZU6A 3EIWA 3H6HA 3SKXA 4HDMA 2FSSA 1UIRA 3LBNA 2VKTA 3ROMA 1AG9A 2IS6A 3CINA 3AZPA 3MLAA 3LQFA 3R0ZA 4H7FA 4S1TA 3DAPA 4WD3A 2IVFA 2FPSA 1OXUA 2BSXA 1GNLA 4RCVA 1YCGA 1HURA 5DN9A 4J0KA 2J3JA 2RJNA 3VR5A 4I1RA 1TUBA 2G40A 3OU6A 4BOYA 1NVBA 2PT9A 2QL9A 4HYTA 1T2VA 2QBYA 3RD5A 2X0RA 5CXSA 1OILA 5MN4A 1XZPA 1ZBQA 3RUHA 1GUYA 3OZAA 1EB8A 5DPMA 1CJTC 2Q0HA 3NRCA 3VGJA 4AWBA 4P38A 1EB9A 1I51A 1FLAA 3G0DA 1VLHA 2QMHA 2FETA 5IUJC 1MO2A 1K06A 5BNFA 3RSFA 2Q1TA 3TNDA 1F4VA 2HK6A 3T3GA 4LKOA 3KR1A 2Q62A 3EVGA 2HK9A 4ENUA 1CY2A 1II8A 2BTQB 3LHKA 1LSJA 4NEHB 3AJRA 5CMLA 1VYUA 3DA8A 3W5IA 3LCJA 4DJJA 2AC4A 2NU6B 3IYLW 4B3TB 4Q9LA 2GN0A 2O14A 3COVA 5GZ6A 1QP0A 2QU8A 3KFVA 3LHIA 2WWXA 2OWEA 5D87A 1XOIA 1V16A 2X0DA 2MDTA 3QG5A 1BX0A 1ZIXA 4IIBA 2C92A 3HG7A 1A2BA 3H5WA 4L51A 5T3UA 1QDLB 1VLMA 2CBXA 1W29A 3CLTC 3JVVA 3BSFA 2FWJA 1SXIA 4IYJA 3UMMA 2BLNA 2XVZA 4ALIA 4FB4A 3T3PB 5CDSA 3N8HA 1V43A 1ZI9A 2ONYA 2QMQA 2HWKA 2ZI4A 3E1SA 3IKMB 3QUAA 4TYMA 3RUEA 1UZMA 2GX6A 2X8JA 4JS0A 4JP1A 1T5OA 4RW0A 3RRNA 4ACBA 3I4CA 4GOOD 3NHKA 4YC7A 1GLGA 5K7SA 4LY3A 2WD7B 3O8CA 1C1XA 3T94A 1UJBA 1HM5A 2JIZA 2X40A 1WMEA 2V8BA 2J9YB 2JKYA 5H70A 1M1XB 2PX0A 5FPHA 2FZ4A 4G09A 4D0SA 4GXQA 3SF8B 1YA8A 2X6TA 2M2IA 5FH9A 4CM9D 1XD9A 4IM7A 1WV1A 1KY4A 4WX2B 4B3JA 4LW8A 1ZHOA 4XWWA 4MW4A 3R7NA 3VMFA 2AOWA 3EZGA 4EO4A 3CVYA 3CVUA 3SSOA 1RZRA 3ON5A 1Y9DA 5HIIA 1M1NB 2EP8A 5FAXA 2IUEA 4RDCA 1UT8A 2HIMA 2QGFA 2GCGA 2I1LA 4Y9RA 1U11A 3TRDA 3V8NA 1ZAKA 2HUPA 5FBLB 2RGWA 3HRKA 1QBGA 5LMZA 3HKDA 3QE4A 3TK1A 1U8ZA 4NTZA 1MO3A 1RCFA 1WUYA 4TQGA 4ZOLB 2H08A 5IM5A 3UBMA 3UJDA 1VBKA 3G79A 1GZ6A 1P6UA 3ABQB 1MW9X 1O7JA 4POOA 3I62A 2CJYA 3EXHB 2GZMA 2QRKA 4F06A 2X0EA 3TPCA 1M0TA 4C03A 1EGHA 3LT5A 3G17A 3FPHA 4IZIA 4NATA 2R0QC 4WFJA 2PLAA 2Q4DA 1TEZA 2IL1A 1OZHA 3GAFA 1WXHA 3MTJA 3OJ0A 4Z7QB 1PZXA 1QPGA 3MQ2A 4UHFA 4BLUA 1U0OC 4S1NA 4B6GA 2HM7A 2ZAMA 4BAGA 1S2DA 4K03A 4KO4S 3Q3JB 2PUVA 3W79A 2IEBA 1R0BA 3M6AA 4G5OA 4LJ6A 2WF9A 2XOXA 3X1KA 5CXUA 5IJZA 3MT7A 3BZWA 3G2KA 5FYDA 1V39A 4ETIA 2B30A 5AYVA 5JEDA 4OQYA 1W6RA 3UZUA 4E51A 3VTFA 2W0SA 4H0NA 3VPBA 3PGKA 4KPFC 2VK8A 4C76A 1W4LA 3UJ9A 1KZ7B 2IZ0A 4ZGGA 2ZYIA 1DQRA 1M34B 1SD2A 3OHMA 3M7IA 1WBBA 1CR4A 4ZVLA 1EFAA 1QGDA 2WPDD 2C96A 5THKA 3LF1A 5HFAA 4EA6A 4FNOA 1XFAA 4YRKA 3O8OB 2X86A 4P32A 3BUSA 4RTSA 4BJ1A 3PSAA 2BOVA 1NLFA 2GEKA 4XVRA 1K3TA 2QM0A 3W1VA 1VMKA 1A8IA 3DKVA 3F98A 3CS3A 2KM1A 2YOGA 3GOHA 4KXFB 4QATA 2VDOB 3AL2A 5KQGA 1XK7A 3R76A 2XRMA 5JBIA 4D92A 3DEYX 4PLFA 1IMJA 2XRYA 3T06B 1JHVA 4QRDA 5F76A 2V5UA 3F3KA 5K0SA 4D46A 1H2EA 1EQAA 1I01A 4NK4A 3WO0A 1QHIA 3P9CA 3UUWA 4D97A 3LT1A 4PVDA 5KKAA 1USVA 3WQBA 1J97A 1CERA 2G3YA 1EK6A 2JGKA 3W2TA 1HG1A 4Q7QA 1UT6A 4O4JB 3FYTA 3PBKA 5EPEA 4LTNA 4EB6B 4MA0A 3DL4A 1ZCBA 3LX4A 3IKTA 4RKYA 2WYVA 5ECWA 3CLUD 3FPSA 4HXEB 1KTIA 4PS1A 4YP1A 1KEKA 2JARA 1AF4A 1JDJA 1T4DA 2FWBA 2ORWA 2PA0A 1QYCA 1WV0A 1CLEA 4NMMA 4IVPA 5K0BA 1AGRA 3SR4A 2R6CA 4PNHA 1KYVA 2BISA 4ZYUA 2QD5A 1K86A 5LFAA 3M2TA 5FQOA 2CL5A 2HWUA 1ZNQO 1QWOA 2ZJ1A 1INLA 4KQCA 5CFMA 4M0PA 2PMEA 3V8MA 3MGBA 1G4AE 3NOOA 5TIIA 1NBAA 1X1EA 3CLHA 2L0XA 1RKVA 4QLBA 1SXJC 4DMKA 1SGWA 3DPUA 3M1IA 4HDKA 1X7ZA 4Y2UA 2ZI6A 2V4MA 2PAFA 2JJ1A 5AW9A 4IYRA 2I8CA 2G7ZA 3UQZA 2NUPA 4TRRA 3T61A 4AQ7A 1LRJA 1A8SA 3MRTA 4R01A 3HDVA 1TYZA 1Z7EA 4BV9A 1ZGBA 3M3HA 2YJTD 4NYJR 4WLNA 4GW3A 2IV2X 5JO9A 1RQXA 5AJVB 5J4HA 4XB6B 2BMAA 2GK7A 3SZMA 5KNCH 1QB8A 2W2VA 1TF5A 2Q1UA 4NCJA 2I8AA 2XCUA 3MFQA 4NG5A 1M72A 1U2QA 1Z2NX 3OT4A 1AK2A 3QRWA 1YC5A 3E9DA 4N1AA 3TMKA 4DSZA 4F85A 3OE4A 1M74A 5K8VA 4L6AA 1M2NA 1CR6A 2ZJAA 4AG3A 3MS7A 1AK1A 5AJXA 2MSEB 2IYOA 4U7WA 3VJLA 2J9FA 2NXWA 4I9NA 2QM8A 1JMYA 2O1EA 2QTCA 3D7NA 5HMMA 1FBTA 4W5OA 1BJKA 3JYPA 1U3CA 1ZRNA 1D0IA 1QRRA 2IT1A 4BCCA 1H2BA 3SS8A 4N5HX 1KYYA 1N8KA 2ST1A 1IQ0A 1RHMA 3BTOA 3CNLA 3N9IA 3NC4A 4RLSA 1NA5A 3FSEA 2POQX 2KBEA 4C0JA 2BFBB 1W47A 1TCBA 1CC1S 1UBJS 2HI0A 1H2FA 1QSGA 1SCAA 1ZJZA 2WG2A 4BQOA 4Q1AA 2XB8A 1KI3A 4WE3A 1CUEA 2NVUA 3KL2A 2HUNA 2PX8A 4B3HA 1JKJB 1U2ZA 3RROA 3LRTA 3IV9A 2P9YA 2IPXA 4HH0A 4UPEA 1M6WA 3PDIB 4WT7A 4MRMB 3W90A 2EBWA 4FGUA 3S99A 2B7LA 1NMZA 2F1RA 3CJQA 3CMMA 4W5JA 3UMSA 3V8PA 4WEQA 4LZJA 1H1LB 4CZ2A 1SXPA 2X3UA 4LMAA 2E6UX 1XZFA 2A9RA 2IXFA 3EFBA 4MICA 4XASA 1V25A 1W2WB 2FU5C 4RZXA 1V1RA 4BQEA 3PNYA 1Z5OA 5FA8A 5JU6A 1RXWA 1JZTA 2A92A 3TZKA 1PS9A 4EYSA 4FFBB 4U7FA 1IZ8A 1NXVA 4QFDA 3VO9A 3DH0A 4K0RA 4R9VA 2GXQA 1ZEJA 2MHCA 2VHQA 1FTNA 1NF2A 1PR6A 2ZRDA 3KCQA 4IDBA 4R2MA 3H2SA 1JA1A 3VU8A 1V2HE 4PCUA 1M33A 1HT1E 3I8OA 4MRAA 2MINA 1X80A 3QWHA 4ZHQB 5EP3A 1P5JA 3KEOA 3OZBA 2GZ2A 3I2KA 2EW2A 1OYWA 2FSVA 1OFHA 2JZNA 1Z0JA 2RHDA 2ZT8A 4UUMA 1F48A 2DX7A 4FYMA 1QCYA 4OFZA 1OU0A 5HFJA 2OP1A 1Q11A 1R4MB 5CVTA 4EG6A 1ODFA 1E0KA 3NB0A 2IHNA 3PXGA 3QX9A 5F1PA 2D3WA 3DDWA 1Z38A 2YFHA 1IY8A 1FVHA 3LWZA 2PMFA 2E2WA 2PWPA 2FEPA 4LOAA 2ZS8A 4RPJA 1XVAA 1OJLA 4TQ9A 1AZSC 3VV2A 4C4ZA 5KOJB 4U00A 1SC4A 1U3DA 2OV8A 1XQ9A 1F60A 1R5JA 2XBLA 2XQVA 4MJ3A 4UTZA 4A0GA 4DJFC 3W5CA 2GZAA 5ITSA 4KRYA 3BTSA 1F3OA 3FMOB 4RSRA 4KR0A 1F5NA 2JKVA 3T7EA 2QQ0A 5BQFA 3OO0A 4IUDS 5A9TA 3KJGA 3ZCXA 3TEJA 4U2DA 3OLQA 4FGSA 2WMYA 3HCCA 3LUCA 2WJHA 3ZD8A 5AOBA 1IK4A 1NQUA 4M54A 3FKJA 2I3AA 3CWQA 3KOXA 1KI9A 1RXCA 5LB4A 3RRZA 2XODA 6LDHA 2UXDB 1Q91A 1I24A 2YMLA 5SYMA 4ZOLF 1KSGA 4CETA 1DMSA 2Q5EA 1Z0FA 4IOMA 1CEQA 4MYRA 5I9NA 2VRCA 1FOEB 3MQFA 1A1VA 4WCFC 3GB9A 5DM70 3WR5A 1X8LA 2FUG1 4JVMA 3TQSA 1KYQA 3VOTA 4A23A 1V5FA 4U2EA 4B5LA 4WLUA 1IUKA 2VAXA 1CUCA 2Z8XA 3O1JC 5HTOA 3HO8A 4H9GA 4RS3A 4C2UA 1VSTA 2G9RA