4K9RA

Spore photoproduct lyase y98f mutant
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
340
structure length
340
Chain Sequence
KPFVPKLVYFEPEALSYPLGKELYEKFTQMGIKIRETTSHNQVRGIPGETELARYRNAKSTLVVGVRRTLKFDSSKPSAEYAIPLATGCMGHCHYCFLQTTLGSKPYIRVYVNLDDIFAQAQKYINERAPEITRFEAACTSDIVGIDHLTHSLKKAIEFIGATDYGRLRFVTKYEHVDHLLDARHNGKTRFRFSINSRYVINHFEPGTSSFDGRLAAARKVAGAGYKLGFVVAPIYRHEGWERGYFELFQELARQLEGMDLSDLTFELIQHRFTKPAKRVIEQRYPKTRLDLDETKRKYKWGRYGIGKYVYRDEEAKELEDTMRRYIEQFFPGAYVQYFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spore photoproduct lyase
publication title A radical transfer pathway in spore photoproduct lyase.
pubmed doi rcsb
source organism Geobacillus thermodenitrificans
molecule tags Lyase
total genus 124
structure length 340
sequence length 340
ec nomenclature ec 4.1.99.14: Spore photoproduct lyase.
pdb deposition date 2013-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4k9rA01
3.80.30.30 Alpha Beta Alpha-Beta Horseshoe pyruvate-formate lyase- activating enzyme pyruvate-formate lyase- activating enzyme 4k9rA02
4K9RA 4FHCA 4FHGA 4FHEA 4RH1A 4RH0A 4FHFA 4FHDA
chains in the Genus database with same CATH superfamily
1T5SA 1W581 4LNHA 5CXXA 3PUHA 1SC4A 1PDWA 3HLTA 4IJWA 2FP4A 4RTNA 2FAXA 4LMPA 2VHXA 2ZSDA 4OQQA 1KBOA 4F8YA 1G2IA 2ZBEA 3WSVA 3A7DA 3RLFA 3KWJA 3T7EA 2YBDA 3L7BA 4O4LB 5GM2A 4A0FA 1FJHA 3H2SA 2OZLB 4X1KA 5GP1A 4ZI7B 1NVUQ 3OPVA 5CVCA 3VX3A 1LA2A 3X2FA 4H15A 3RTEA 3ULKA 2H0QA 2GK6A 1PR1A 4D9NA 4U9HS 1TEZA 3I8XA 4ZVNA 2WT8A 4YRGA 5BQ5A 1WQ4A 5E8RA 1Q0RA 3OT4A 2QYHA 4BKOA 3V6LA 2RBKA 1FNBA 4JMPA 4Z3DA 1BCSA 3OBIA 1GFWA 1GGHA 2IYAA 3SZUA 3A26A 4DIKA 1HEUA 2RC5A 4KGVA 1Q1BA 3RAJA 1WM1A 3K2IA 4BMCA 1O9HA 1W46A 5GJCA 1M2WA 2OM2A 3ILXA 1A9YA 3TAXA 1U3UA 3WV4A 4F4FA 1NA5A 5BR4A 5JS8A 1V5IA 3T4XA 5GWXA 3GRYA 5DHAA 2I7DA 2BOVA 3S2FA 3WV5A 5JWRA 3TPFA 1T3LA 1NF8A 1MOSA 2QPTA 3U19A 4YQYA 5ILOA 1JBQA 5GADl 2FFBA 5AMXA 4IP0A 1HRKA 3S8EA 1RM3A 3QE0A 3JYQA 5HMMA 4WK4B 3M70A 2ADOA 2H7VA 3EJWA 4XX0B 4ETNA 5BUSA 3R41A 4FLMA 5JCOC 1JDNA 4RFSB 3CNBA 1FNCA 2C4NA 5C8DA 2NO7A 3CW8X 4J6EA 4BX3A 4WKPA 2BFEA 1JXOA 4HWPA 1B3BA 1S2IA 4JVSB 1YB4A 3EVDA 3B1ZA 2C0CA 2M98A 1ZI9A 2BY4A 1TA9A 2XMCA 1J49A 2WNIA 3JVDA 4PZDA 3TZKA 5B3JC 4R6WA 1PKXA 2QRHA 1GA6A 2GLUA 1OTXA 4TUYF 2JIQA 2VWGA 4V1CB 2EDCA 3ZDDA 3GU3A 1KE1A 3BB1A 2DR3A 3BE5A 3GQBA 5I9MA 4B83A 1T2EA 1X80A 1E2QA 4D41A 1E62A 1JDVA 1YK0A 4RD4A 3ZHBA 3MVEA 4WNCA 4JI0B 3CPSA 4RWEA 5HK8A 2BGRA 2PZGA 2O0KA 1UMDA 4DMUB 2Q6OA 1G8HA 3M6UA 4U7PB 4X3OA 3HCFA 1ESDA 4CM6A 1V7CA 1XC7A 3VJMA 2GCOB 2QN2A 1T2VA 2BMVA 1W6UA 2QRJA 1DDGA 1E1MA 1JMVA 4PN7A 2I6GA 3AF0A 2VUSA 3A6ZA 3TJRA 3UC9A 1Y8RB 4OK5A 4HJXA 2DBRA 5E3JA 5G0SA 4OHCA 2C2OA 1JHPA 1ZCFA 4NCIA 3O8QA 5EJ2A 5IW8A 4RTOA 2ORIA 3IT3A 1JU9A 2O3SA 3CCCA 3JPYA 3ZE8A 3B1VA 2VRWA 2QLTA 1P5ZB 1WP4A 2GNPA 4NOJA 5JEDA 2NO9A 3ET5A 4LQDA 5FNZA 2QS9A 2P9FA 3GEBA 1HWYA 2O3TA 2X1LA 4IRUB 4J0EA 3RYHB 1HTTA 1SXPA 1B23P 4AF6A 3GJZA 1DIOB 5KJ6A 3FRHA 4I5FA 4ZRDA 5EGSA 1RM5A 5H3HA 1NR1A 2E82A 4MB2A 4YRJA 4NVRA 4FK8A 1JA0A 4JJZA 2IH4A 3BXHA 4JFAA 1T9ZA 4XDGA 4DUPA 4OYHA 4KQEA 2GJSA 4BX0A 5C0OE 2QD2A 1I3CA 4A73A 2CT8A 4MYSA 2QX9A 1CR2A 2C1XA 2ZSAA 4RW0A 4BL5A 1V8OA 1HKUA 1G20E 2NXEA 4BNFA 4B4UA 2JIRA 2DFPA 5M2QA 3RPEA 2H2HA 3QF7A 1CQXA 5CM8B 3WHIA 3ZJYA 5J47A 1GG5A 1AQUA 3P2KA 2NXCA 5C5EA 2GRJA 4LF4B 3RB8A 2VSXA 2B7CA 3HCDA 2GJ4A 6CHYA 4I3HA 1RI2A 1P5HA 1R4NA 1XL0A 1KAHA 3D9QX 4G0OA 3SBDA 4FMDF 4J03A 4LTMA 4XPZA 1ZXXA 4FD2A 1R7RA 3IMFA 1P7ZA 5DWQA 5TLSA 1U7XA 4RTPA 2F55A 5DP1A 4IKEA 1P7PA 2OQ2A 1KEKA 4Y6OA 1DOZA 2JLUA 2FPIB 3KQVA 4GI2A 5J23A 4HXEB 1PI3A 3W06A 3PE4A 3MC1A 1E77A 4QG7A 3X3HA 3KETA 1U11A 3STTA 1Q7BA 4ZYLA 3M4NA 1DADA 1Z2EA 3EZFA 3NWJA 3N0TA 3QXCA 1TW3A 4J0HA 3QXHA 5AFSA 4MQBA 3HDJA 5K6TA 2BMWA 4ZQGA 4D9MA 1VI2A 3TD2A 4ZIRA 2C94A 4H3KB 4BV8A 1K6JA 1M74A 2TMKA 2XF2A 3NHSA 3OMLA 1YGYA 1JHRA 1ZK4A 5K6RA 1RKXA 1D2NA 3SSOA 3VOSA 1RRKA 1X1TA 3LM8A 1FYEA 1R4ZA 2X3YA 3KLMX 3L2OB 4BVEA 1FFWA 2COEA 2W2MA 3ZHTA 2FFAA 1GNVA 1PUIA 1SCKA 2JCXA 4HADA 1SBYA 1N0HA 1XZCA 4OQNA 1PS9A 1R9JA 1OF1A 3SG0A 3BCRA 3AUUA 4RE6A 4C05A 4AP9A 3IAUA 2W70A 3EDMA 1UJNA 1XVAA 4URHA 5CTJA 2G36A 3OECA 3QUCA 1MXFA 3QXGA 3AEKA 3DKPA 2I6XA 3ELWA 3ETCA 4K1XA 1XFDA 5FBWB 2PCJA 2R4QA 5C4GB 1M6YA 2X4IA 4KVZA 1FCJA 3G2JA 1UXOA 4XJVA 1DG1G 5BW8A 1JKMA 4L72A 4AY5A 1NLZA 2FUG1 5FJIA 3HBLA 2CHEA 2VQDA 3V46A 3F9CA 4EJ0A 3FTFA 4Z9BA 3QITA 2EKQA 4Q6BA 2HRZA 1W2HA 2OPHA 4MHSA 1ICEA 5BN4B 3SHFA 2ODPA 1LRJA 4PZLA 1DEXA 3ZH2A 5IJWA 2JZOA 1PG5A 2QXYA 1EH5A 2I2DA 3GCGA 3AI1A 1VG0B 3DEAA 5C1PA 2X2FA 3RI3A 4NTZA 5AI0A 2R7NA 2EP7A 1SK9A 3FR8A 3LX5A 3R7DA 1RMQA 1Z13A 4Y6QA 2VDWB 5AI5A 3HKDB 1ZISA 2Z58A 1T9AA 1NJFA 4KX3A 3NB0A 3ZEAA 2KB0A 1WOYA 2YJ3A 4FCCA 4YT5A 4A26A 4K9OA 2W6QA 4RMIA 3V33A 5KVSA 1G8GA 4TM8A 4KR3A 1E7WA 4RTRA 3OLZA 4OI2A 2BGLA 1V5FA 3FYSA 3VYWA 1WXFA 2PGLA 4NK5A 5KBYA 3D1VA 2IGBA 4LDZA 1MB3A 5FFMA 3S2IA 3UWMA 4B8WA 4F2GA 1YB1A 2F4VB 3AFNA 4JGIA 4OHKA 4YREA 5JH7B 2PUEA 3IC5A 1DARA 4HQLA 4N54A 1RCUA 1Q84A 1IOWA 2BSXA 1XZQA 2PZAA 2VF7A 1QQ5A 1P19A 3HCEA 4AF8A 1G41A 5EVJA 2IH5A 1GKLA 5H3CA 2QMYA 3CURA 4JQCA 4REQA 1N6PA 1S2MA 4OFBA 5CGZA 4XR4A 3TLYA 1Q1NA 1FS5A 4B4WA 1W34A 2BZ0A 5ICCA 4LHXA 4PYOA 2CLLB 1XTRA 3GGSA 3PX3A 4KWIA 3LBHA 4H60A 2O5RA 3WWCA 2RGNA 3PC7A 4A1OA 2ERCA 3TW0A 2XCRB 3PEVA 2BUBA 4Z0TA 1NQAO 5AI8A 2Z3VA 1KHTA 1PGPA 5A5DA 3IESA 1PQ4A 3N3BC 3ENZA 2DJ5A 3FYCA 2QLBA 4OO3A 4EMUA 2ZRNA 1GPUA 2YRWA 1CP3A 4BVHA 3UHOA 5C52B 2DX7A 1FMTA 2ZTMA 3PXXA 2X22A 3NHPA 3K4PA 3H5OA 3FTDA 3PDWA 4IIBA 3I6YA 5DGTA 1ORRA 1PT6A 3SAJA 4X93A 1H85A 1H5NA 2Q0HA 2H9YA 2Q4DA 5FO0A 4X66B 5TF4A 1IJEA 2GXUA 3OUZA 1J33A 4O0LA 1JEYA 3AKZA 3DLAA 1KU0A 2P69A 3L0DA 4EFLA 4R8RA 2H5IA 2OG2A 2GCPA 3D4BA 1KYYA 2HB6A 3LO5A 1PS8A 4ITUA 5CT4A 2E0IA 1XZHA 1M1YE 4HYTA 4HBZA 4X8LA 3BEDA 4B6GA 1RRVA 4GOMD 3V4VB 4KO1S 1E7SA 3MT8A 4A8PA 4YROA 4X6UA 4K26A 2X86A 3GNLA 3NBZC 3V48A 2E55A 4HH3C 3GIDA 2C96A 3L7LA 5G02A 2Z2JA 2O2XA 4KRGA 2C54A 2VYFA 3L0ZA 3JY6A 4DDUA 5BQFA 3EUAA 1MHPA 1QF7A 1U0SY 3TRHA 3JQDA 4EUSA 1W4CA 2E4ZA 3PGVA 3GJYA 1E3WA 4BFUA 3ZDRA 1JFTA 3GFPA 3PGLA 5T6MA 3G9UA 2X7XA 5KHLB 2FN8A 5COBA 3ITDA 4U9IS 4PQRA 2D00A 1GWNA 2ZK7A 3RYTC 1Z2NX 2NXJA 4J7AA 1RRMA 2OT3B 1ZRMA 2YHBA 3LL4A 4LJ7A 4QBGB 4MVJG 5KVQA 3T5CA 1OIWA 1E20A 1VHWA 1LBHA 1XJ5A 3P9KA 1CUYA 1DO0A 1MA3A 3CUTA 5K8CA 2EX4A 3FUVA 5K8UA 3I01A 5J2TB 3HCWA 5LQMA 2FZCA 2AQKA 1XZNA 3DSRA 1EM6A 3DV0A 3PQ4A 2F43B 3NBAA 3QH4A 1VB5A 4UFNA 3T0GA 3I5XA 3C98A 3FJ1A 1BTOA 3PXCX 1C14A 4CW7A 1Z0ZA 3RSOA 4KMSA 2YWBA 1VMEA 2HPHA 1T9CA 5IKOA 4DBLE 2WPNA 4ZVKA 1JPVA 4A6PA 3VNAA 2WWFA 4KMRA 1B0PA 2JFYA 1ZR4A 1ISPA 1QFXA 1X7GA 2D06A 2HJHA 2ZT7A 2GB4A 4AYTA 2H59A 3DZCA 5EIAA 4ZZ3A 5C32A 1USKA 1ZXBA 3A4LA 1UP7A 4P32A 3FD8A 5CT6A 3HVJA 3RCBA 5C1DA 4NBTA 2QAIA 2XRMA 2HF8A 1GAJA 4O4LA 4TWIA 2WWYA 1KO5A 2OZLA 3EX7C 3L8ZA 4KQ2A 2NYRA 3AC0A 4XEHA 1JWAB 2Y77A 3D0KA 4Y2PA 4A16A 3T1HB 2KJQA 2GD1O 5EESA 4W6QA 4XDHA 1E7RA 2NNLD 3MS2A 1NT2A 5CW1A 4ASUD 1Z07A 2OLEA 4N6GA 3M1LA 1CU1A 1HZZA 1CNFA 1M7GA 4R1MA 3KT8A 3T5DA 2HA3A 1C3EA 3SHOA 4QTYA 5I7EA 4XGNA 2GH1A 3WGIA 4PCLA 2UYOA 3IB6A 4PC2A 4BU0A 2H2FA 3EFHA 1T26A 1DAGA 4DCOA 4DCVA 2BZGA 2ET6A 2GETA 2CC2A 4KJZA 3PE6A 3U62A 4MEBA 3PFWO 2BKXA 3WVNA 1IZZA 3IOBA 3SPXA 1G19A 2EG5A 2ACEA 1E8DA 4S05A 4R3NA 2BBSA 2NTJA 8GPBA 5LQSA 3DYBA 5HW0A 3AP2A 3LG2A 2TECE 1VZ2A 4YJDA 1BD3A 3V1UA 4AP6A 5B4VA 2WEKA 4PAOA 3WLAA 1AA6A 1W5AA 2BFDB 2HEGA 4GFDA 5KEIA 4Y6LA 3K0SA 4BMSA 1ODTC 2GKGA 4XX0A 4XVQA 4YRAA 4GZ3A 1P31A 3QVOA 4RFSA 4RGVA 2FUNB 4MCJA 3AIMA 3D4NA 2ONJA 2R6AA 1IHOA 3M5WA 1QIDA 4DLBA 4Z5XA 2ID7A 1JVBA 1FVOA 2ETXA 2I55A 4LYAA 2CV1A 4M9RA 5JS7A 3CH6A 3P9CA 4B3DA 4I9UA 3DZFA 1L7EA 5EPOA 2XT0A 3X2EA 5DHSA 3S2UA 4V1CA 1DKQA 3KEQA 1KH3A 3GDOA 4R8KA 1GLVA 1OAKA 1UPCA 4J1TC 1X19A 4UHFA 1YASA 1NTOA 1ZCZA 5KMGB 3ROFA 621PA 3EPJA 4S1NA 5DOVA 5AVRA 1X1SA 4FC7A 3FDJA 4UNIA 1Y9ZA 4RANA 5EMLA 4BRWA 2BIFA 4C3OB 4QVKA 2R47A 3BBLA 3R5KA 1K7XB 2O07A 1U7OA 4XD7D 3W9UA 2D1QA 4AS2A 1TJYA 4LNAA 1W76A 2GCOA 1VSTA 4NPCA 1M5UA 4IICA 2FSVA 3HWSA 1KYWA 1CUGA 3C70A 1DCMA 1Y8RA 2CFIA 2NV6A 4LJKA 4MAFA 4RMHA 2XDWA 4TMZA 2VC2B 3KUCA 4BDSA 3NVKI 1DPGA 4GO1A 1X7DA 3MRXA 1ZZEA 1O9BA 3DWEX 3RSSA 2QTCA 2NO4A 1SVKA 2HLDA 1R12A 2YXDA 3NYWA 4PLWA 3WQBA 3RYHA 1ZGAA 4ZAXA 5MN5A 2M6KA 2YASA 4H7JA 3MJEA 2Y1OA 3DTVB 4Q3AA 3GUCA 5HMLA 4P54A 2QT0A 2BGTA 4XRRA 4HV4A 3KQMA 2IEBA 3G2KA 3BTSA 2JHGA 4PLFA 1ZD8A 3S44A 1TRKA 3BA6A 1O57A 6ABPA 1ZMBA 3JYPA 4H0FA 5L45A 1S8AA 3HO8A 5CNIA 2JVKA 1GN9A 2DT8A 1XX6A 2VNIA 2ZW9A 4MI6A 2GCEA 3ZGZA 3N0XA 1FTNA 3AU8A 3OJ0A 2ZSEA 2P5YA 1M8FA 3DM5A 4R68A 5E2BA 1I01A 1BFUA 1THMA 3B9PA 3HPRA 4KFRA 2Q7DA 1HYHA 4P1ZA 3KOMA 2BBWA 3KOYA 4CR7A 5L3RA 1TMOA 1R0ZA 1MW9X 3AY7A 2FK8A 2FSUA 2ZS8A 4ZYYA 3RVSA 3LAWA 1GZ4A 2FPIA 2EX1A 4FIDA 2CXNA 1JWLA 2QWXA 5SYAA 4EGJA 3RASA 3OE1A 2AOWA 1V3VA 4KFCA 1O6CA 4NICA 1YIOA 2VP4A 5ALHA 4EFMA 2Q5LA 4HNUA 2QP9X 4AWXA 3I1YA 4C0WA 1J2JA 2PLRA 1KZ6A 2QM3A 4FE7A 1X3SA 4B2LA 2W2QA 2FOXA 1CUDA 1YBHA 3SF0A 4BQPA 3ZQKA 2G4VA 5H59A 4G23A 5CITA 1EK0A 3FHJA 2A5YB 3AUXA 2WOOA 4Q21A 5K01A 4GOND 2PPLA 1T2UA 5D1HA 2WU8A 1GZ7A 4NEQA 4A2WA 5KNDA 3WYDA 4DMCA 4JOSA 2Q0SA 4UTOA 2YMLA 4QYXA 3WGNA 2O5CA 2VHWA 3QBDA 4PCAA 1ESZA 2NPIA 4M1TA 2B5WA 4E11A 1GPAA 3S29A 3AFMA 2UAGA 1FJ2A 3DE7X 4B79A 2DULA 2D3WA 2VK1A 3CNQS 1CK4A 4PRKA 3K32A 1TMGE 4M8IA 1SXJD 1YVRA 2J7PA 3D4IA 4NYMR 2HQBA 2XKBA 1P62B 3FB1A 2IXGA 1DXHA 1B0ZA 2H06A 1NU6A 2V8BA 3HA3A 3JALB 3G0HA 4IJVA 1G18A 3D31A 2IHZA 2XQFA 1G6KA 1Y7PA 2LKDA 4I9FA 1KDYA 2NQ2C 2JEOA 4PAQA 3SCZA 5BN4A 2HPAA 4AUEA 4D5GA 5KX5B 5EZQA 2QNRA 1OUMA 3GDFA 1AKQA 1E2UA 4FEEA 4WOCA 5LC1A 1E1LA 3X43A 1JH8A 3CEPB 3CRNA 3LLSA 4FDAA 4QOFA 1O6BA 5IARA 3EXEB 2HK8A 2NN3C 2YYZA 4KVGA 2IP4A 2VDWA 1BWPA 3JPWA 5AXCA 3HKDA 4B3XA 1GGVA 3F9RA 5JECA 2IPNA 2R7AA 3LZDA 2DY1A 1Y9AA 2GPSA 3A2LA 4XDYA 4B9AA 1QQAA 4XCXA 3ZGYA 4ENPA 5K5EA 3UJPA 4HQ6A 4FOOA 2XT6A 3GRPA 4RADA 3K1TA 3O84A 3BC1A 5EUBA 1XLUA 2R6GA 4LJ9A 1JAXA 4Q7QA 5C5CA 5JH7A 1TCBA 1XTZA 4UVHA 2VPWA 3CWQA 1B26A 1KEPA 4MYCA 1NP7A 5C80A 3IJPA 4NFYA 2EHJA 2GAOA 1P2BA 2PTGA 2ZGVA 4PZEA 2CFRA 3V7UA 2ZRAA 3RVDA 5CD9A 1UC4B 3OE5A 1E1QA 2CGEA 2HUNA 3C3CA 4HTAA 3RU2A 3HXKA 5FL3A 4PYIA 4AJIA 1XU4A 4F4DA 3H1BA 2PXCA 3VU0A 1W88A 4IWYA 3BB4A 4R54A 2JJYA 4ZK6A 3IDAA 4KITB 3PF9A 2JA1A 1ZWKA 5HIJA 5KNDH 1XCMA 5ECWA 5AK4A 1XOIA 3DZHA 3G8DA 4Q1EA 3ER8A 4EP1A 4IM7A 1IRXA 1JKIA 1HC7A 1R0SA 5ICMA 3DEFA 4TS3A 3LKDA 3TOVA 4C22A 4MH0R 1XEAA 3K0HA 5C37A 4KTTE 3X0DA 4CTOA 3CG4A 1G4UR 1L7BA 5ESRA 2FW1A 5F4ZA 1N78A 2NP7A 2HIHA 5IJ9B 4U63A 1C30B 4W5OA 2ZPUA 3VKGA 5JSKA 1FSPA 2XGOA 3HCBA 2I87A 3A1CA 2HF9A 1RACA 1DXQA 3W4IA 1ZQ1A 5JI2E 1UPTA 4IWXA 1N0IA 5KSWB 3GLHB 2KHZA 3WYCA 4QT4A 1U3GA 1IB6A 1IOZA 1AOXA 3LHKA 3VGPA 2ZSKA 2AZ4A 3WO1A 1NBMD 3IPXA 3D3KA 4K1LA 2QTRA 3CPEA 1LPAB 1GQYA 2Z2IA 4I55B 5AIAA 1XQ1A 5HQ3B 1JSCA 1Y1LA 4ND8B 1Q0ZA 3B2EA 3FB4A 3WGYA 3DXYA 5FI5A 1MVOA 4OQXA 2WZBA 1A27A 2YVAA 1KMIY 3M1AA 3REGA 1EJ0A 1T0PA 2HC9A 3KSRA 1P2UA 3PRJA 1IVSA 4B3RB 1K66A 1YZQA 3ZS9A 1ZRNA 1F8XA 3HY4A 1K0UA 2BT4A 4DLXA 3C8ZA 4DJFC 1C3OB 2LDXA 2RH8A 1MORA 2OGTA 3OUUA 1AH2A 3DOOA 4R2WA 3AHFA 4IIDA 3SIXA 3SEZA 5DGDA 3HJAA 3WYFA 1U81A 4KAAA 1F0PA 1Q3KA 5BWLA 4IIUA 2IV3A 1LWNA 2AJDA 2R5WA 5JCPA 1L7OA 4TVSA 3FZYA 4P3KA 1RBQA 2W6IA 2F43A 1NF9A 1LTQA 5KDLA 2YFHA 1VCMA 1B3RA 3PDUA 4R5MA 3S4YA 5ALQA 2C84A 3UOGA 4ZDIA 2HSGA 1X7YB 4EYKA 2A5DA 2YXEA 3Q8MA 5SZHB 1IXZA 4YUZA 3U60B 1MIOB 2PZBA 4UHCA 5H68A 4F3KA 1BEUB 4ZAGA 1OROA 1I4LD 3TLEA 1WVMA 5IYZB 4C43A 5LM3A 4XA8A 1M9NA 8ABPA 2PMKA 2UUAB 1NTRA 4KR6A 2ECPA 3KQHA 1J06A 1EX7A 4CIBA 1NWHA 1WB4A 3G5UA 2IPXA 3PIIA 4MYUA 4QSHA 4AK9A 3HV0A 4ZEVA 3C5VA 1TTTA 4BFCA 3VH1A 2HR1A 2ZI3A 3IAS1 4AXBA 1Z39A 1DC5A 2EL7A 2HFJA 1QFMA 1S4QA 3DYVA 3FF4A 5LYYA 1C1YA 5AQEA 1VG9B 3T12A 5TIIA 2Y9MB 3Q8WA 2YJGA 4HDMB 2JD0A 3I42A 4TN1A 2GS9A 3WNBA 4EI7A 1W0JA 3ZCVA 2XE4A 2GZRA 4R0NA 2PSJA 4YIKA 1HR0B 2HD4A 3GY0A 4QO8A 1NSTA 1U1GA 2XGGA 4FFMA 3MN1A 3T99A 5TPZA 1ZD1A 1IUKA 4ZYWA 5HKKD 4UVEA 5L3QB 1OFUX 4IGFA 2OKGA 4Y9UA 1C7EA 1PEYA 1KO4A 3D6FA 4UXHA 3MRTA 1R16A 4KIUA 2C7VA 3R7AA 3I12A 2NSDA 1SVNA 1E0JA 1Y3IA 2XIJA 5JR3A 3UATA 5FA8A 3B1KA 4LHWA 1J7KA 2OO5A 1LWOA 2LNDA 4JDPA 1Y4DE 4ZJZA 3ISVA 4JJEA 5KOIA 1GGNA 3IAAA 5DI3B 2SKEA 3PGMA 1Z7WA 3I4FA 1SB8A 3ABSB 3KRTA 5I7UA 2C88A 2ZAMA 1R4AA 4W9MC 3WTBA 3MRSA 5JJCA 2HT6A 4UARA 1YQQA 4ZC1A 4KLAA 1F4LA 2QR2A 3LPMA 1NUAA 2BFDA 1UEXC 3GLVA 4QBTA 4R2JA 4E2FA 1LFAA 4PFJA 4J91A 1QOQB 1H1DA 2MYPA 4LE0A 2Y6UA 4X5OA 4RTSA 1DAIA 4MUIA 4HLCA 4I81A 3JVEA 2I2AA 5B58C 1C3VA 1NFQA 5AUQA 3QHPA 5M3BA 1IQUA 4XQCA 1E2KA 4F9GA 2N3ZA 1QM5A 2BGWA 2CHUA 2C4VA 3U6KA 2VT2A 1QP4A 2FMUA 3TTSA 3PC4A 2ISQA 3RC7A 1WBDA 5H4GA 5F7OA 4O4LF 2J33A 5KMGA 3KTDA 3QFHA 1MTOA 4GPD1 4MV3A 3WA7A 5FTNA 2HM7A 4C1NA 3V8MA 5JRDS 3KEGA 5F5LA 3TUZC 1ZOIA 3CQ9A 3KVOA 2JNWA 1BJRE 1EA7A 3NCTA 1DXYA 1E6MA 4FMPA 2GHRA 4HWGA 1JEOA 4L9WA 1ATIA 4OSOA 4DSUA 5JS1A 1DIAA 3FOBA 4RENA 1U9IA 4CLDA 5IK2A 3SIWA 5BURA 3UHFA 3K9QO 2ACWA 1FZTA 3I0ZA 2HU7A 5J3JA 5B30A 2BZSA 3R23A 1GA1A 2JIBA 1TGVA 2HJVA 3DVSX 3UVEA 5ITWA 5GIOE 5JZ9A 3LHFA 3OLXA 5K6AC 2LIPA 2I62A 2R6DA 4AN4A 1IVNA 4L4YA 4DR5B 1C2YA 5EFZA 4DIDA 2VP3A 3U6BA 4RYLA 3MT0A 4HYYA 2IZOA 3U49A 1PG0A 2BUCA 1I2AA 2JFGA 4KN6A 4LTDA 2FEOA 1MLDA 4PVDA 3KK0A 3DTVA 4TROA 1VLJA 3FLMA 3H9BA 5AICA 2JLSA 5DT2A 1U63A 1OJLA 4LE2A 2JGFA 4BLRA 3AL2A 4ZJUA 5HOQA 3IRUA 1JG1A 1PAUA 4HFJA 1DJOA 1VI5A 3M5DA 1CKEA 4FONA 3O4JA 4PICA 1DO8A 5J1SB 4HDCA 4MJ3A 3V7NA 1H6CA 1ZG3A 2P9TA 1OZFA 1E92A 3I45A 4WADA 2WJPA 1TF2A 2OYCA 1UKEA 3PQCA 2V0GA 4PLHA 5B37A 4EF5A 1J70A 2ID4A 2C5FA 3MJFA 5BW5A 4KL8S 3BK1A 1I1OA 3ZR4B 2CB9A 2O5VA 4L08A 1NVDA 2VJMB 4P84A 4PYRA 4Z9AA 4CIWA 4V1CI 3RRYA 4C21A 1T29A 5KU7A 3R76A 1WDWB 2FUEA 1FQJA 3G13A 3QMPA 4DQLA 3GMTA 1J8QA 4G01B 3SGLA 3W3AA 2B36A 3PA6A 2BM9A 3KJGA 1CY6A 3AKYA 5ILGA 3QY0A 1K3FA 3KL2A 4UDYX 1W5BA 4F5DA 1GDHA 1YVPA 3HSSA 3JRWA 2JFVA 3U1BA 2O8BB 3D6HA 1PT8A 1HM5A 3LWNA 5JE8A 1E2NA 3EW7A 4Q4AB 4BNXA 1SOMA 4M76B 1SN7A 3IL2A 2G5PA 3DD1A 4G2NA 4OJKA 1OBHA 4UBIA 5JHGB 1LY1A 5DGHA 4RCYA 1H0KA 3CH7A 1C8KA 2I22A 2QLFA 3E03A 3FA2A 2AWOA 1Y1KE 1XF1A 1NSYA 2YZ2A 1USUA 3D5QA 3KLPX 4LRXA 4LYFA 3VDMA 3CVWA 2R87A 3URMA 3S1LA 4F3TA 3OMXA 1CF4A 4G36A 3RQIA 1Q17A 4HAOA 4TLCA 3HCCA 4LKRA 1THZA 3B78A 3P0FA 4Q1AA 2D7DA 2J9FB 1T4CB 2ZE5A 4IFTA 1KBZA 5F23A 3C7AA 3RJZA 3FWPA 4CL0A 2VDJA 4WCFB 1CUBA 1N34B 1YVDA 3TCNA 4ZVPA 1MJ5A 2I1LA 2HMWA 3DXFA 2V6BA 2IRWA 2GASA 2F8SA 4ZRMA 5BRJA 4E5MA 4EO9A 3F4LA 2IQ5A 1E59A 1TJ3A 2QZPA 3BWYA 3OZTA 4BNLA 3TKYA 3JALA 1YR9A 1COZA 3PPIA 5EUCA 2WU0A 3SHVA 3UAZA 3L4BC 2W6MA 1T4DA 3OCZA 4OHOA 5KX5A 3RRXA 3ECSA 4OXNA 4D3FA 3BJRA 1P60A 1D8AA 2DSTA 2Q07A 4HHEA 1J9EA 3WNZA 2FX2A 4DNXA 2YL2A 1ENYA 1TIKA 3S1AB 1H2EA 4RY9A 1NQXA 3EXEA 5G0TA 3DE1X 4XUGB 4ZK2A 5A4FS 3O8CA 3GRUA 4OV6B 2IWRA 5AKXA 1BMTA 5E2AA 1XAGA 3B3JA 2Y2UA 3C3MA 4GAEA 3AI2A 1RSZA 4MVJA 4WZAE 4CV2A 4D43A 2ZQZA 4IVRA 4EHJA 1QIJA 2OXEA 3FCCA 5TVGA 3AL0C 1JAZA 1RMTA 3D4OA 1MRZA 1O89A 2XDAA 3E53A 3HKCB 4KGXA 4X6XA 3IRVA 2J45A 3UTCA 4BMDA 4DADA 1PFGA 4INAA 2C4HA 3AZPA 4LI3X 4EKGA 1BC5A 3NEJA 1O2DA 1JJAA 2OV1A 5D5QA 2EGHA 4Y1GA 4B43A 3DE4X 1WETA 3PTZA 3H75A 1NHGA 3AH8A 3K09A 3JU3A 1FFBA 2JK1A 5CJ2A 4E0BA 2PL1A 4BBAA 1GUBA 1EFTA 1YQXA 1KKMA 1RHJA 2HMTA 2R1TB 1G1AA 2WF9A 4BGIA 1OE0A 3O9VA 1Y6QA 2IUTA 4P22A 2D54A 2XRYA 3QE3A 3HB0A 5BSTA 3D81A 4G4GA 4KQJA 2W6JD 3KT6A 4LYJA 5CLHA 4OB8A 3L06A 4DMGA 1BXZA 1OYWA 2NAPA 3L8GA 2AJLI 3L7OA 4BQRA 3K2BA 1D4FA 3ZTYA 5EZ5A 4AMYA 1RTTA 3UN1A 4ISCA 2LCFA 2FSHA 1RP1A 5FFFA 4GKAA 3A3YA 4DBVO 2C9YA 1KS2A 2DM6A 3LX4A 4UEKA 5K2OA 1T2NA 2X1VA 4A23A 2IEAA 4LX8A 1KI3A 3A36A 3W90A 1AURA 1PYOA 1ST3A 3U4GA 5IJ9A 1C30A 4G2TA 4Y30A 3T9BA 4EY3A 3LHDA 3NAZA 1RP7A 4G1FA 1SU7A 3OFKA 1NURA 2IYTA 3S28A 2A88A 3PVSA 3SYTA 1KQNA 1CUHA 1ZLXA 2A3RA 4OIMA 2O2YA 3RGWS 1PGNA 1BDMA 2PA3A 1ABEA 3H5TA 2VQ3A 4R7ZA 3ZNOA 4XYBA 3UEOA 4IZ6A 4K6CA 4F4CA 4I1YA 3FROA 5I9IA 2VNKA 4BNNA 1K68A 4WAUA 1E2LA 3QVMA 4E09A 4JNKA 2CXSA 3PWTA 2J30A 1DP4A 1VP3A 1E6WA 2FEXA 1U2GA 3B2QA 4I55A 1NBHA 4S0ZA 5CG1A 1LRKA 1P77A 3ICOA 5HQ3A 3G7SA 2CZQA 3H0CA 3KZKA 4ND8A 4X20B 4C7XA 1ZAKA 2AX3A 3CLUC 4MVJH 2MSNA 5CD1A 4C08A 3HYTA 2IYYA 3QVSA 1SULA 4YJKA 1P73A 3E3OA 4QOGA 2FTKE 1OFGA 3OPMA 4ZMRA 2DH5A 4XB1A 5CFRA 4BE7B 2P1DA 5JH7F 4FWBA 2P9ZA 3ITNA 4Q7LA 2CHQA 1C3OA 3OJEA 2F1KA 3JV7A 1QMGA 2J9YB 3X1JA 1U7HA 1Q7GA 3IBTA 4GPIB 2B8EA 4OGLA 3AQ4A 5DDIP 3RK0A 5IFLA 1E4EB 1TQDA 3ZD9A 3GJQA 1SCAA 3CR3C 1EDBA 2IXBA 2VLBA 1QHIA 2JDIA 3EXG1 3GXOA 4OQYA 1BXRB 4PNPA 4UEWA 1YL6A 4YB8A 3ZY6A 3ZHRA 2VDLB 4GLBA 5KSYA 4GQAA 2FU5C 1QRRA 3FBTA 3I9V1 2YYSA 3LBNA 3FNBA 3QX9A 2H65A 3UG7A 3N8GA 4HN9A 1VBMA 3HBNA 1Z7EA 1D7AA 1X7YA 2JFFA 2RHJA 3GROA 1D7OA 2DPYA 2FR1A 3QI7A 4XVCA 2QF7A 3GUUA 2YWHA 2ZJBA 1MMFB 1SBCA 1IWOA 3H4VA 4QYTA 4BAUA 3MCAA 4MIEA 5IYZA 1NY6A 3ONWA 1ZLYA 3IR6A 5IWAB 3B6MA 4MICA 1Z12A 2GN4A 3LUAA 4ZEWA 1ESMA 3PGJA 3PSHA 1MX9A 1QGAA 2QP3A 5K3EA 1N5IA 3F6CA 2YWRA 1Z8FA 3ZZ1A 3ECAA 3C87A 3ENKA 2I7CA 3TE7A 1AHHA 3RVQA 4G09A 2QXUA 4EM6A 1U1EA 3S2ZA 4P34A 2F3TA 1HG0A 4IH4A 1LB1B 2H52A 3H5WA 5JJBA 4IHJF 1OA0A 3KSZO 1PGOA 4HDMA 4PIVA 4KRYA 2X0RA 2W2NA 3DOCA 4TS9A 2WA2A 4AQYB 4ZO7A 4QJ4A 3GA0A 4ACAA 4QDXA 4EA9A 3M4XA 3O4FA 1GA4A 3SLKA 1R0CA 5L3QA 4MJXA 1M33A 1JHMA 4ZCPA 1UADA 4L02A 4P86A 5DTIA 3CF0A 4CCAA 3KQNA 5I4KA 1E2EA 1VG1A 1SRQA 2HADA 2IP1A 4TLBA 3GJSA 1O4VA 3V4SA 4B48A 2EGUA 4NQZA 3IKJA 1KC3A 4QATA 4F97A 4LZJA 3UMJA 1F2VA 2E4YA 3EBPA 5HXAA 4ZTZB 3L92A 4HAVA 5JPIA 1VKOA 5A3VA 1XYVA 1ZXLA 3H9EO 3I5MA 2J3QA 2VNJA 5DI3A 5EUQB 5FOSA 4WOJA 1NMYA 4QD3A 1HI9A 5JAHA 4EITA 3ICEA 4HN4B 4NXMB 3KQPA 2X0EA 3EGOA 3F6BX 5J2TF 4KZKA 1D6NA 5HBGA 4LRTB 3KVVA 4YLYA 5EE3A 3IEKA 4HP8A 2ZLBA 2OXRA 4ZAWA 4A0RA 2J59A 4N1AA 1U9ZA 2KQUA 3F6YA 3PCXA 1V4NA 4LDRA 3U26A 4DF3A 1VSUA 1RHQA 4TV8F 3OO0A 3OJXA 4IDAA 3WGLA 3HYLA 1E99A 4QFCA 3E58A 5T3UA 3B8EA 4CM7A 5EKTA 4GOXA 4NYIQ 1PBNA 1FE8A 4MR7B 4UDXX 3O94A 4COOA 1IQ0A 4LZLA 1NOKA 2GBCA 1AK9A 2WJHA 3K6KA 5F73A 5ALFA 3I8OA 2Z57A 3MTGA 1Y89A 1CJSA 2OFWA 5ALRA 3Q2OA 1ZM4A 1M10A 3ENNA 1W5EA 6REQB 1MU0A 2QYSA 3L0SA 1PX2A 1L7RA 5FWXB 1HRDA 1MC8A 2ZT6A 1RXUA 2CFSA 3C0KA 4ARUA 4QODA 4AY3A 4FQ5A 1FS6A 2F00A 4C01A 2RKBA 1DX6A 5BNIA 2X0JA 2ZUTA 3G2NA 4S04A 3G2QA 2CCGA 1ZSYA 3DFIA 1ESCA 1DQPA 1TCAA 4MVJM 2CV0A 3FUXA 3FSGA 4FS3A 4XVHA 1YDMA 2X5NA 4FDMA 2WSIA 3GJ3A 3H5VA 2ID8A 1RIFA 3ICWA 2X9NA 2FHSA 3PDHA 2BFWA 2FZLA 4COKA 3P9QA 4Q3OA 2C29D 4A1FA 2G67A 4O0MA 4TYYA 3H1EA 1MZPA 2ZRBA 2R6JA 2GF2A 4P3PA 4AZ3B 3KUKA 4OA8A 1GFIA 1QIIA 5J43A 4IIJB 4FINA 5IM5A 2D1SA 2HLPA 4W99A 5KO2A 1RM4A 2YHAA 4Q47A 1SXJE 2OBFA 3A1DA 4V39A 1D04A 4HDRB 5A7HA 3STXA 2IHKA 4BMPB 3EVTA 3EIXA 5B4TA 1PQPA 1JG7A 4YP0A 5JBIA 1LQUA 4J1QA 1KJ8A 3ICCA 2EEZA 1QP7A 1P4RA 3GFVA 1KK2A 3HJTA 4GIBA 2WUWE 1DTEA 1OI4A 2FZEA 1YMVA 3F2VA 4EMBA 3LD9A 1RYFA 1SGWA 4LBYA 3JQBC 1LJUA 1O03A 4YXFA 3IBGA 3SC2B 4FEYA 4BKMA 2VJMA 2Z8YA 1E60A 4O2AB 2X9GA 4ZDKA 1VJ0A 3WBFA 2Z98A 4M36A 1KDOA 1P6QA 2OHOA 3HP7A 3IYLW 1X6VA 1Y3CE 5DT9A 3RIEA 3RVNA 3C3KA 5KU1A 1CQPA 2E9SA 5L3VA 1B1AA 3HBAA 2O8FB 2IS1A 1RLUA 3LFTA 2RFLA 4UOZA 5B7NA 8MHTA 4IVPA 3GA5A 5AM1A 2JCSA 3AEQB 3BWDD 1CY7A 2D4HA 4KSBA 1QK4A 4MWGA 4ND6A 1I3MA 1TECE 2QN7A 1YTLA 3W1VA 4HNAB 2HSEA 5JVDF 2O8BA 1TUBB 4TT3A 1ORIA 4Q4AA 1WXIA 2JIMA 1CJVC 2Y92A 1WXWA 2NO1A 3R3UA 5JV5A 4UU7A 2OHVA 1HLGA 1T0HB 4K3UA 5HPYB 1G8KA 5MDHA 4U6SA 3PRKE 4K9KA 4LF5B 4FGLA 2D0OB 4F6CA 5TY0A 2WAOA 4W4TA 1YUMA 2ZM5A 3L46A 3QEKA 5T4EA 3MHTA 2HNKA 1EK1A 3V4ZA 3CEMA 3PPXA 3ANYB 1G38A 5ISMA 1Q3TA 2J9FA 4OLBA 1GUFA 1T4CA 1DSSG 1LS1A 9ABPA 1P1JA 1Q92A 3LIPA 5DCYA 1GP2A 3JATB 2ZROA 1Q6YA 1L5ZA 2ZUCA 2ORYA 4KKVA 4U0JA 4WCFA 5TF0A 2IEDA 4MV4A 3PT5A 1EQUA 3PSAA 5TE9A 2QD4A 3DONA 1KVTA 5HS4A 1RW4A 3ESXA 4MUBA 3TCXB 1N75A 1X7WA 2GAIA 1GYRA 3ZKWB 4C03A 1O5OA 3B6IA 1WDMA 4AWAA 4B6SA 4LOJA 3LVFO 3HB7A 1P2VA 1H65A 3GYGA 3RR2A 1UWKA 3U9TA 1PF7E 3MD0A 4JQSA 4FE4A 1Z37A 7MDHA 2R2AA 3S1AA 4WOKA 1ZA2A 3PQ3A 4Q24A 1NBME 3NMUF 1DHRA 3D7RA 2O1WA 2OV2A 2XZPA 4TTQA 4UBOA 2PZMA 1JE1A 1P2FA 2WIBA 2Z6VA 2YMQA 5CFZA 2ZI7A 1TAQA 3GJ4A 3LQQA 1RDFA 1Z4IA 2D4AA 1YV9A 2XGSA 4BMNA 3LZCA 1Z3IX 4E03A 2O1EA 2Z95A 3PFGA 2HYIC 2R84A 2ZIFA 1C2TA 2R751 2VKTA 2X77A 2FZ4A 2HSJA 3OZRA 5LB2A 3VSDA 4URVR 3FWHA 2GBPA 3HKCA 1K8ZB 2KBEA 3DF7A 4AC9A 4BXOB 1Q11A 1QE0A 3EMKA 3HRHA 3RW9A 4XQGA 5C2JB 3ML1A 1ISMA 2L17A 4EMTA 4HAWA 2N0SA 3L9WA 3TS1A 2HHLA 4UUAA 5AJZA 4ZVRA 4EHNA 1LBQA 2OWDA 1SMKA 3B6KA 1IYZA 2R1TA 3F8SA 5CGQB 2A59A 5ITVA 3V1LA 2AJTA 3CHYA 4UXJA 5E8JA 5FBKA 1BMDA 1L7QA 3EG9B 4YRQA 4OQLA 2CLFB 3GBSA 4H3SA 1G5FA 3LYLA 4TMVA 4YT2A 1SUDA 4K0RA 4KWTA 3SYKA 1L7MA 3PNVA 2NTYC 3PX2A 1KTVA 2I5PO 2LR0A 4MGKR 1P1BA 4RV9A 3GZ4A 1WUTA 3W1WA 1NASA 2GF0A 3L8EA 1OC2A 4OA5A 1EHYA 1TAHA 2VZEA 3QKRB 1E5DA 3QXSA 4KIGA 2EZUA 1C9MA 4BHTA 3JQPA 3N9IA 3TMAA 4C3UA 4EG4A 2BRUA 1R5BA 2QAJA 1FOEB 1TO6A 1TVKB 1QR2A 3AB8A 2FPUA 4G9GA 1WXGA 4QTXA 5CBKA 1GYQA 3HG7A 3GPIA 2QAGB 1WCIB 1U4OA 2P40A 1S96A 3IKVA 4CLRA 1XE3A 5AW8A 1IN6A 3TXAA 1GM5A 1YR8A 1M2EA 4BUCA 1JEDA 3NHMA 2P0AA 1QSGA 1R6BX 1UDWA 2JIPA 2OFXA 4RKEA 1QE3A 4NEGA 3LPLA 4HUTA 5CJJA 4ZP1A 4EA6A 1WHSB 4DL9A 1XP5A 3COYA 3OHPA 5LKRA 4L74A 1N2ZA 4RE5A 3PUIA 3O0TA 2SCUB 4MVJF 4M7OA 4X20A 1UK8A 2IQIA 4W5WA 3WZMA 1CZUA 2N1BA 2WW8A 4YH1A 3RSLA 2PFKA 1P4JA 2D8AA 5EHQA 5KQPA 2PKWA 1UAAA 3VVCA 1S3FA 5FA5A 5JC1A 1NE7A 2XEXA 4R16A 1B14A 4CF6A 4WFKA 1ZHOA 1JFSA 3AKDA 5JYBA 1CVLA 3N7TA 1P3Y1 3JQBA 1E4EA 4QLAA 4E1BA 4AKGA 2YCLA 1RPTA 2IXAA 3TLXA 1F06A 3TTUA 1BU5A 1PTJC 3O92A 3AJ8A 1BXRA 3PHGA 1Z2OX 4DJEC 3PB3A 3AVPA 4I4TB 2IHYA 4P2BA 3MCUA 3BL5A 2JLAA 3G5MA 4L5AA 1SFRA 3X44A 3M6AA 3MTJA 4QT0A 1U9CA 3F7NA 3KU1A 1YXMA 1SG9A 5F9HA 5IMBA 5JXGA 2P1ZA 2HO4A 2PKEA 4WY2A 3PWSA 3O4RA 1NP6A 1RYDA 3ILHA 5EWMB 4NXNB 1V2GA 1KOGA 5BQXA 2ASEA 4XTRA 2XYRA 1B6GA 1Y7HA 2VFAA 3OQMA 1Z28A 3VOAA 3ESAA 5EQTA 4J3FA 5FUQA 4E14A 3LLVA 3WB2A 3F5QA 4BLSA 1JQ5A 3B1JA 2JGMA 4H1TA 2OD7A 2FA9A 4TOIA 1NLUA 3AHHA 5D87A 3IS3A 1B6RA 4F4JA 2H5EA 4ED9A 5KSPA 5E0KB 3DDSA 3PLAE 2JD2A 3B6JA 1DFGA 3TOZA 4YV7A 1BIFA 2VI5A 3SZMA 4O4HF 4EG7A 5CEJA 4EX7A 3LECA 4IIFA 5BXYA 2X1HA 4DDWA 4U5QA 2CL0X 3HC7A 2YHSA 3AUSA 4CUZA 1OHHA 1FRZA 5B53A 1QDUA 3AQIA 4UU1A 1F9EA 3WLKX 4DZTA 4MTCA 3D5EA 5DNUA 1P1CA 1G5PA 4XX1A 4I55F 4XWWA 5DI9A 1NJSA 2P9HA 2VPZA 4A03A 2VCEA 2XAUA 3CKKA 1RI4A 5JZOA 3Q3IA 5DXJA 1WG8A 1YMUA 3MF4A 4MKGA 1T1IA 4JYPA 3Q8XB 4FNOA 1AQNA 1XLVA 1JTEA 2D5IA 3DNMA 2VJDA 3IDQA 5DSXA 4WK2B 4BQSA 3IEMA 2XE6A 4RXMA 4TN5A 1CEQA 5DWDA 1WNTA 1NYLA 2O3UA 3TNFA 1YJAA 4GZLA 1G20B 2BMFA 3KV3O 3N8DA 2WUVA 2G4CA 5DX8A 2YXLA 4K0KB 2VK4A 4CMHA 3PQ6A 1GRVA 3VO9A 1KQGA 3MTQA 4Q1BA 1AKEA 3C5EA 3FGNA 3KAKA 2A5FA 4MKIA 5HF9A 5IANA 2RI1A 3REQB 1KZGB 3NTUA 1EHCA 1U8TA 4CMEC 1HKHA 4DR1B 1QO7A 4NBWA 3RS0A 1KKUA 5C5DA 2UU9B 4KH0A 3ZEIA 2YKGA 2B4AA 2XYPA 1IUNA 1O94C 3KL4A 4ERXA 3K8YA 2YCBA 4H7EA 1TTHA 2Q6IA 1EBUA 2IZZA 1SBQA 5IYZF 3T9AA 3LA6A 1A9TA 5KHOC 3OURA 3OOEA 3HRIA 4PLGA 5AKZA 4OHFA 2A7XA 3A1SA 2YWJA 2ZKIA 1SVLA 1C8LA 4UNRA 1SKQA 3QXJA 4HGZA 5H0IA 2RGUA 1VA4A 2EQ5A 3C24A 1QR6A 3OPYA 4X60A 3F8WA 1AGXA 1N25A 2BDTA 1MJGA 1YKFA 5FI1B 4G81A 1OIXA 3SYRA 4DN6A 6REQA 3JWHA 2FEKA 3EGDB 4DABA 2G6BA 1O8CA 1AQYA 3QLVC 3N75A 3C43A 1XTJA 2WICA 2WU3A 5FWXA 5FOXA 4FT4A 1XIVA 4OBBA 4DR4B 2FW0A 5DM0A 4JB0A 3NJ8A 2PBLA 3B5EA 3R0QA 1LCIA 1BYIA 1QVWA 2WRZA 1RZRA 4LF6B 1ZN9A 2PD4A 3PZBA 1G0OA 3D4PA 4RCZA 4II3A 2HHAA 4P53A 3AEUB 1ZH2A 5CXUA 3RYCB 4B6RA 1SD2A 4A4DA 2HYDA 2OORC 4Z8XA 2CFTA 2HK6A 5HDBB 5IKMA 2A67A 5KWEA 2ZAIA 3BH0A 3QOYA 4Y98A 1VJGA 3K8OE 1AHPA 3FLBA 2Z5VA 1CB0A 2NM0A 2X58A 4J0DA 3GUZA 3IQDB 5FPQA 5ARDA 1SVOA 4RORA 1UBOS 2FUG6 2FSFA 3M2TA 3CZ4A 2C9MA 3RU3A 2RGWA 3WHLA 4RLSA 1VECA 3IQHX 2VTBB 1XKTA 3EIOA 4AZ3A 6GPBA 4R9SA 1GTVA 4PYLA 3LYAA 5ESDA 4DMLA 4MR8A 4BTLA 2GBFA 4FI3F 1NQVA 4HQNA 4IIJA 5ARBA 1NUQA 1I6WA 3O1JC 1HT1E 2XOXA 4PLVA 3LZ6A 5DYWA 2P2SA 4FIZA 2GRUA 3L0YA 3P45A 4HDRA 2NU6B 3W8EA 5E3IA 4N7JA 4AAYA 1P0FA 3UT5B 4JMLA 2YNMC 4MI1A 1FNDA 3IHWA 3VKVA 3JSXA 1X7ZB 3RS8A 1LLDA 2OENG 1YDFA 5KQGA 2NT4A 4KQFA 5EJFA 1EJ6A 4N3NA 1UXIA 1V0JA 4LZNA 1ZN7A 3I1JA 3LWBA 4GP6A 3MMZA 2A94A 4MS3B 4AZWA 1PTJA 4HVAA 9ATCA 4DYVA 4OJNA 4O2AA 2BEWB 2XCOA 1KPIA 3MWJA 4ENWA 4GZ5A 4HRVA 5ECGC 4GF5A 1FFAA 1E7YA 1XNHA 2JBAB 1ZD2P 3VQTA 2QN1A 1SOUA 2UYHA 2O8FA 2ZJZA 4M38A 5AKYA 4YS6A 2ILTA 1GZ5A 1CUJA 2WTEA 4CKBB 4PFQA 1WMAA 5F51A 2BFAA 2CDAA 4J4TA 2J5QA 1K7FB 4GI3A 1Q57A 2HLDD 4G0VA 4IIXA 1F8YA 5CLIA 3BHJA 3EGXB 4HNAA 5A1JA 1TUBA 2GEBA 4H08A 1OFHA 1FRQA 3EBLA 4E5YA 4B5LA 1KDTA 2WR8A 1FSGA 1E9AA 1UDAA 1VIDA 2NNWB 1Q7CA 4JQZA 4PN3A 3NIBA 4ONEA 3K5WA 1AKRA 4F60A 1H4QA 2OD9A 2FPRA 5DSTA 4JX9A 1L5WA 2BGNA 3KAPA 3OJWA 3VOTA 1E5QA 5A9RA 1Z6AA 3CTPA 1J1IA 4OH7A 3WGGA 1H23A 1XCJA 1N2CE 2BF4A 2D0PB 4LX0A 1FTGA 3F5FA 3MBOA 5TJHA 1RXVA 2D1FA 1PCXA 2D1YA 1XMPA 2W5UA 4O5AA 3JATA 1X7XA 3K70C 3QPUA 1P72A 4E2WA 2QL7A 1XZJA 3N1UA 3NTOA 5AM0A 3TAUA 4FCVA 1C29B 1M1YB 2PIDA 2IYOA 3M6LA 3AYXB 3AV3A 1RXSA 3WNQA 1YI0A 1DX4A 2ZIEA 4EZBA 1D0SA 3K0EA 4ZQBA 4N12A 2FDRA 2Z83A 3G82C 3ONDA 1HA3A 3T1QA 3ZKWA 3ZJ5A 1VJTA 1G6HA 2WYOA 3KPJA 4EEXA 3SQNA 4K87A 5EJMA 1TM3E 3QBTA 1I33A 1EM8B 1SCUB 1AZLA 1YJ8A 4QXOA 1SKYB 2QRKA 3C5HA 3MWFA 4X1YB 3CLVA 3ZDFA 2ODTX 3QU2A 5C81A 3U09A 4JYMA 3W5VA 1TJ4A 3W1EA 2G1UA 4NULA 4HLNA 1A7AA 4CODB 1V45E 2OGUA 4OQZA 2TYSB 3JQQA 3BQMB 2B61A 1YS7A 1PJCA 4BX9A 4FEAA 2DH6A 2XDYA 1NVMB 5K8IA 3NH9A 3EQ2A 3GI1A 3NQ41 5T8KA 3RBXA 4AS1A 4F71A 1NN0A 2QUIA 5DHQA 3VNSA 3GLIE 3QJGA 4C2TA 4AWBA 2R6R1 1NXOA 3HXOA 3I34X 4BY9E 2I4IA 1AC5A 3ZXXA 1FPQA 3VFDA 1O94A 1PR3A 3S2YA 4ZYVA 4BXOA 2OGWA 2W6PA 4ENSA 3U1TA 5KNDD 2C04A 4B7XA 1HDOA 4I3FA 1MQ9A 2I66A 3DA8A 5JNRA 3USZA 4YAUA 1NY5A 3DMHA 4KAJA 3MBIA 4EECA 2RJNA 4JLMA 2NTVA 3KKQA 2OVFA 3G8AA 1TMYA 4C89A 1KU6A 2J7PD 3EG9A 3IT1A 3R5SA 4PYMA 3S55A 2IEIA 5B6JA 4UM5A 1T3ZA 2QU7A 2QSUA 2PLFA 4QUBA 4US1R 4C0XA 4NHOA 3RC1A 1S01A 4HUQB 1OXUA 2W90A 5K3BA 2UXDB 4EB8A 1VJCA 3ZV7A 2KE5A 1JVSA 3GG2A 3M5CA 4GMFA 1EWVA 1QANA 5AO9A 3QKRA 4B85A 2EARA 5F33A 3VUFA 1RWVA 3EC1A 4HUJA 5K99A 2XIQA 5BWMA 5I8PA 1V9LA 1QDEA 1G5TA 4C29A 4DVGA 1DWUA 1QHNA 4I99A 4PYKA 1PQYA 1IEQA 2ILVA 1HURA 2QAGA 1GR0A 1WCIA 1CY2A 3PLRA 4NZNA 4RVSA 1MDBA 2C2WA 2FWIA 2JAXA 3H13A 4I5GA 2OY0A 2Y1XA 1HSZA 4KLZA 1RWWA 4L27A 4KXWA 4PZZA 4UE3S 1L7PA 5GZ6A 3MGCA 4U2KA 3T9DA 3E9NA 1CZKA 2CK3A 2IYWA 1LI4A 4GL4A 5EINA 3LCRA 4OB7A 4TMWA 1WHSA 5KTSA 4AIIA 1DNPA 1KYIA 1WPXA 2F4NA 4NE2A 3A6KA 1XNQB 1SHLA 5JMWA 3GFGA 3S27A 4CFSA 4G25A 3LRXA 3SJBA 2CVFA 1DKOA 1EE9A 1NDUA 2SCUA 3TN7A 1E1QD 1OBOA 3D0RA 4CTKA 3ANMA 1IN5A 2Q5QA 1RLOA 2ZP1A 3N2EA 3NBMA 1MGPA 4HNHA 4I19A 1ZRSA 4X95A 4PO1A 3ROZA 5JUWA 4Q1DA 4R1NA 3R7FA 4DNQA 4QVIA 5EJGA 1VZ3A 2YWXA 3E70C 3K1AB 4IUCS 2VOJA 3KJQA 4JEIA 1T0BA 3R8XA 1YBVA 2OLKA 2VT3A 1H66A 3GRCA 4MRMB 4P33A 1L5GB 1APBA 1ZN8A 2NXWA 3RUHA 5KSZA 5L7WA 4GOKA 2Q1TA 5IDQA 5DHFA 3VPBA 4EJSC 2GVZC 5DEOA 1QRSA 3IELA 3CLTD 1G2PA 3BX1A 4IVNA 4O2BB 4D82A 3EA0A 3H9JA 4DLSA 1L4UA 2D7CA 3OFVA 2K2WA 3C85A 4IYRA 1NXSA 3RJTA 1QCZA 1VDZA 4ZCRA 5J4YA 5BQOA 2AMJA 2EFHB 4PCUA 5EWMA 3I2JA 4MQFA 3MTBA 4L2IB 3E3NA 2AXQA 1I9CA 4Z3OA 2GI4A 1J8MF 4A10A 1UKAA 5H4HA 1QHGA 5BYKA 3O4GA 2QN9A 4ND7A 3BTOA 2JFOA 3H1FA 2XKJE 1N0WA 2VDKB 3NP7A 5AR1A 4URFA 3VNRA 2CDRA 3SKVA 4ENUA 3EYWA 3TIFA 2F67A 1S6YA 4WLUA 3FOZA 3DOJA 1NC3A 3MK31 2EJVA 3W9YA 1PUJA 1RYNA 1M2FA 5JMTA 4GGPA 2SECE 3CVUA 5EA2A 1WKVA 4IS3A 4J3NA 4EKDA 4J4HA 1J0XO 3HJRA 5JASA 3U7GA 4U9UA 2Q1XA 2P6NA 5HFAA 1ZNWA 4TKLA 3CE9A 2VWQA 2ZFUA 2XYQA 3A32A 5FYDA 5SZKB 3TOCA 4ROTA 3D2AA 2FG6C 1Z36A 3DAPA 4WK0B 2G5CA 5TRTA 1YZFA 2XMQA 4G84A 5CNJA 3NEAA 1U7WA 3QJ5A 4MS4B 2VZ9A 2W6ID 4AG3A 5CB8A 1OREA 1ND6A 2VQEB 1QYVA 1CR0A 3B20A 1NP3A 1QB8A 2DECA 2VSYA 1G20A 4NYJR 2FG7C 2MDTA 2W2VA 1ODCA 2OAGA 2XUPA 3NZEA 3RBVA 4NESA 2NO5A 3KLBA 5JMOA 1DTWB 3AHIA 4PS0A 3U48A 1F6BA 2XCQA 2AFIB 2F59A 3HL4A 3WWOA 2OAQ1 1XZPA 1K7CA 3REQA 4GZ6A 3AFIA 2O59A 3A7EA 4GG1A 1TMKA 5I3ZA 4JH0A 1J23A 1GSOA 4QQRA 1E2BA 1Z16A 2IYRA 2RHMA 3EUEA 1JW9B 3PQDA 4IF6A 4ZU1X 2XMZA 3U3JA 1P44A 4BP3A 3TFOA 3GEMA 4C7OB 4V3BA 1DCFA 1U94A 2IY9A 4JP5A 4TTJA 3WK9A 4DTCA 5BV1A 5IEBA 3PUXA 5TQ2B 2ZRJA 3EFOB 3MPOA 3V2UA 1QQBA 4X0EA 3G79A 2VPXA 3I9KA 2P4EA 1FP1D 1W0JD 4BWVA 5DWVA 3ZV5A 5DM1A 4C4TA 3KP1A 4DBLC 3U7RA 1DIHA 2VDVE 4HQ0A 2WZDA 3SR4A 4J0FA 2EQBA 1E64A 2FR0A 4Q05A 4PZCA 4RV4A 5TPZD 4DRXB 4N0EA 4Q00A 3GLUA 1WF3A 5HRUA 1T6XA 1U28A 4QUEA 4DR7B 1ENPA 4OAOA 2IFTA 4M9XA 1PJBA 3EGDA 1QV9A 3PUKA 4N8DA 4YYZA 5CA0B 1ZIOA 3C6YA 3D0QA 1R6DA 3BE4A 1U1DA 3IAM1 3QYFA 3M34A 4PZ0A 1H0HA 2OCBA 3CW2A 4UHBA 1JILA 4X24A 4D0SA 2V9PA 1CRPA 1IN7A 3IE2A 2PM8A 4IW3B 3VSAA 3OIFA 1HQKA 1T5HX 3NI2A 4MVJP 5J40A 1ZD3A 16PKA 4QUAA 2XXJA 2Y3IA 4Q7MB 3QIVA 1I3KA 3KJNA 3AEUA 2ZANA 3CF4G 1U8EA 3STUA 2FWRA 3IUPA 3RYCA 5JAPA 4ROSA 1HNZB 2QJRA 2HCBA 1AF7A 2ZYTX 4MA4A 5TT1A 1RVDA 3KUXA 3LC7O 1DB3A 4MV5A 3F5SA 4ZQCB 1TL7C 4IQGA 3ETLA 1PQUA 3A37A 4DA7A 1J42A 2OB2A 4ZT3A 3ZW7A 4DRZA 4GOJA 4F8EA 3WDLA 4P7FA 2VTBA 4Z2AA 1NXQA 2PX5A 3C15C 3KKPA 3N5CA 2C3YA 3H2KA 1U7UA 4UCXA 1RAEA 3UFBA 4ESEA 3UKJA 2NGRA 1PLLA 1Y98A 3OT1B 5TR9A 1SKUA 2NU6A 4FLFA 1SUPA 2ZTSA 3LT0A 1YB7A 3UT5A 1AQIA 3AIKA 5FULA 2JGAA 1GTL1 1Q0PA 4LA4A 3HLYA 4NBSA 1MQ8B 1X7ZA 3TIXB 2WTAA 2EW2A 2CUKA 1PD0A 1RYMA 2P4SA 5A4JA 5C5IA 3KYBA 1HL3A 3U16A 1KZYC 1ZU4A 3A1EA 4H7FA 1PVOA 1E2IA 3LRTA 1YH3A 2IKSA 4MS3A 3N59A 5HJ2A 5B12A 1XNRB 3MTEA 3OU7A 4PRYA 1GN8A 4RM3A 3I04A 2BEWA 2GF9A 2LP4Y 4MUYA 4DEXA 1HZJA 2IDZA 1EXMA 1F14A 4A8JC 2DG2A 2JBAA 1JG2A 1MV8A 1T9HA 3K5PA 3ZGNA 3OTIA 4JLOA 1RQPA 1JNYA 2JJMA 1U8YA 5HQJA 2ZTLA 4ARZB 3I6BA 1BVRA 3PGA1 1FQKA 4WDRA 3UW1A 1KTIA 4CKBA 2XB8A 3OTQA 4J0QA 3P96A 5AKLA 1FDWA 2O05A 4CM8B 1CYEA 2BHLA 2QGZA 4EI2A 1ADJA 1WS6A 3EGXA 3UV3A 4MUMA 2W0MA 4X7RA 1ZJWA 3DTVD 3B3FA 1PR9A 4YJ3F 5IKXA 1C0LA 2RJ3A 1ZL2A 4U2CA 5IKPA 3AW8A 4CIDA 3C41J 2RKWA 3UJ8A 3IQGX 3LBIA 4HT3B 1A7KA 3DC2A 1M8GA 5L3ZA 2WSLA 4HOYA 4EKIA 5BV0A 1N2SA 4ZT5A 1E18A 1RR6A 3HN2A 2B8TA 3P0IA 5FV4A 3U3RA 3UB3A 1QBKC 3L5KA 1WTCA 1MFZA 4YJFB 3T7RA 3VAAA 1KEVA 2XZTA 2FXIA 4RELA 2O2HA 4OLJA 5CLLA 5CH5A 4NX2A 5FLXA 1YZ3A 4CDRA 1NW9B 3SSNA 2V3CC 5HFJA 1M1YA 2WWRA 1MC1A 1QOPB 3OAAA 2PUHA 4IIEA 2C2YA 2L2QA 3PK0A 1WQ3A 4IIJF 4EY5A 4EHDA 1X39A 4KH1A 4CDMA 2PT6A 2QV0A 1P91A 3GDGA 5A9TA 3S40A 4M87A 5DXFA 3RK1A 1DQSA 2IEGA 1EM8A 1SCUA 1NF2A 4M0DA 4Q9KA 2ZE8A 3H9QA 3N05A 4JA0A 4MAAA 4X1YA 3CBGA 3W3AD 1AS2A 2NOAA 3EZXA 5KVCA 3ELDA 4X1IB 4KE7A 4X84A 3F9IA 4JGGA 4FGUA 4YXWA 1PNQA 1NU8A 1K88A 3WLRA 4Y2YA 4WI1A 4AJ1A 2IS4A 2ZSHA 1RT9A 4O2AF 2I6SA 1EZ1A 5DNEA 2DJIA 2GEKA 5A05A 2MWMA 1AV6A 1TX4B 3IXQA 1CUWA 5DZSA 4GICA 2R9VA 3ZVRA 1ULAA 2IYXA 1LSSA 2WG0A 3EWAA 1Q2XA 3GLFE 1Z4QA 3I4CA 1PK8A 4GWKA 3WX0A 1AUOA 9MHTA 1I10A 4WERA 4I6JA 3BJMA 5IBCA 3VH3A 2ZRIA 1E3MA 4Y6GB 2HSZA 2OCKA 2I7VA 4QJ3A 2HQOA 1YRYE 3COPA 4GQIA 1XYGA 6YASA 3IKTA 3OY7A 1B0UA 3HU3A 4S1TA 1J21A 3RG2A 4NZYA 4MHOA 4X7PA 3CM0A 4MJ7A 1UDBA 3EHDA 1KY2A 4X3PA 3TLKA 2DBQA 4Q15A 1GNQA 4P3OA 3VC3A 3LUFA 3N7AA 1G8AA 1QU2A 4HUQA 5EIXA 4JXKA 4WHMA 3LLUA 3U9SA 4PZAA 5DLDA 1M5RA 4LSGA 5JY1A 5BSEA 2BN4A 5DSZA 4KW7A 3OFNA 4PHFA 1QXSA 3RTCA 1W94A 4JELA 3IAS6 3IHLA 4JIMA 2GSWA 1ZWLA 2XYHA 2Z4SA 4LBWA 5BORA 2RC6A 3H7AA 4W82A 2BVNA 3OKPA 4OXKA 3JCZA 4P38A 3TL6A 4ESVA 4LRSB 5BV8A 3WQQA 3MJCA 2QYTA 1GZ6A 1E1CB 4JR1A 4MVJD 3TQCA 3CNLA 3FM9A 4FFLA 4F45A 1IHDA 3FWKA 3ADCA 1BXGB 3QOWA 1QUFA 5E9AA 3ZWDA 3FDIA 4G63A 4KO4S 1B76A 1JLRA 4OLFA 4WZBB 3VR3A 4NC9A 7REQB 2PSFA 2GEFA 2VHCA 4IXNA 4JBNA 2DPMA 1PBTA 4LXIA 1D0VA 1K3TA 3LBAA 3T5AA 1NSFA 3AGPA 1UBNA 2VCHA 4XGIA 3ZZNA 1I3NA 1G8YA 3OICA 3ZQJA 4D02A 3AVUA 2GZ3A 1DUVG 4UZEA 2AD1A 2O7RA 3GCXA 3G1UA 5ELMA 4EL0A 1UMBB 1A8PA 4P4SB 3SE0A 1U4NA 5H81A 1X3LA 2NVUB 3FMPB 3CNOA 1VKNA 5LP6C 4EG3A 2VDUE 2PEZA 2ODQA 1GCUA 2BDUA 3DDUA 3E61A 4XGQA 5HTOA 1ZNQO 2P62A 3KFLA 4RQTA 3R7LA 4RTLA 1SBHA 5JNSA 1TCUA 2CE2X 3K1AA 2WY2D 1P2DA 1TM7E 2FCRA 3LNCA 4JKIA 4MRMA 3WK6A 1K27A 5JATA 3H4IA 5LU8A 1Y1RA 4FM9A 4DOMA 3LQ1A 1NVKA 3DOUA 1EIWA 3STYA 1E3DA 4HDOB 2HI0A 3HJGA 3QEJA 4IS2A 5AM2A 3JD1A 4JDUA 2P35A 1GYPA 2WF6A 4R1LA 1N6LA 2ZRGA 1GPLA 4HRXA 4P4NA 1C9JA 4ER0A 1TA4A 1DG9A 3PQ8A 4XARA 2QRLA 2YC4C 3K96A 3ZY5A 1TLLA 4I2VA 4PG7A 3A06A 2ZYIA 4AFNA 3TGLA 4C0BA 1BWRA 5GY7A 2PLAA 2ZI9A 3P4YA 4R8MA 4UNSA 3AV0B 4L2IA 4O4JA 4ESOA 1QGED 1R5OA 3KM0A 1JT9A 3HDHA 3M8KA 1LDMA 2WOJA 4JAVC 1RAGA 5JMPA 4OM8A 4MUHA 3U4MA 4UFPA 1CUEA 1YDHA 2IXTA 3K2EA 4E2XA 1EMDA 4XIGS 4BEBA 2OR3A 3CZQA 1P9WA 3FZEA 3I0NA 5LNK6 4A15A 5A4AA 5MN6A 2QORA 3IJ5A 3CEAA 1J07A 3LE8A 4HGRA 4F56A 4F85A 2R62A 2WB2A 1TQHA 2B8JA 3D3EA 5K0NA 2AG8A 4B47A 5JXHA 3HCRA 3MJSA 3OPNA 1NE2A 2AFHB 1DEHA 1XMOB 3O1LA 3P0JA 4IUBS 1E1RA 3GRAA 1XTKA 4RK7A 1G21E 1MDFA 1ZN2A 4QOJA 5LNK1 2F9MA 3I6QA 4II2A 4NZOA 4QTUB 2JDID 1XDBA 1RC8A 4B75A 1V47A 3JRXA 1A95A 4OBXA 4R1TA 1U04A 4LPKA 1UDXA 3EGCA 1E6CA 4ABYA 4EW1A 2NZWA 3NRCA 1DKPA 4YJ2B 4MS4A 4YHBA 3ZDEA 4LJAA 1QRTA 1YWGO 3RRZA 2GEVA 2GTHA 2HBYA 3QLUC 1IY1A 5BNFA 3ZWQA 1TVMA 2CF5A 2VXOA 5B3AA 1B8PA 2GPNA 4I1SA 1VLMA 2XRZA 1LTHR 1ZVQA 4GLFA 2X7JA 4CMKA 2GNAA 1L8OA 2QUZA 4Q7JB 1YBAA 1HEYA 1FQWA 1CW2B 4K40A 4B3FX 5I7VA 5IAKA 5U4XA 4I4TF 4I4LA 1D4OA 1WD5A 3IA2A 1P1IA 4ZOBA 4UJ5A 3DMGA 1ZOLA 2IHBA 2XECA 3L6BA 3TO5A 1PG2A 4WA8A 2BSAA 4OHPA 5DGIA 1YS4A 4LWZA 4OJYA 4MPDA 421PA 4C7OA 121PA 4TZKA 1UC5B 4J2OA 4M9CA 5TQ2A 3W2TA 3EFOA 2XBMA 3VYRB 4CDNA 2XTZA 4H77A 2JFQA 4HTFA 3ORYA 4EH1A 2PT7A 3K15A 1NN5A 1A8HA 2F9FA 1MNAA 2PGIA 2ZVJA 1Q7RA 4LMBA 4MR9B 3GPLA 2BR4A 4UMEA 4KOAA 3DMTA 4PAMA 4YACA 3WB0A 4LFCB 3WLTA 4DRXA 2BUAA 2YZGA 4DZZA 1LGYA 5EKDA 3RD5A 4CKCA 5KREA 4C78A 1TRHA 3NXSA 5EJAA 5CA0A 2WJ6A 4TYQA 2LKCA 4A92A 4BNVA 1QZUA 2YUTA 1FUUA 4G0PA 1T1JA 3IMGA 4ZI2A 2OZEA 4CHGA 2XQKA 1K4MA 1NQ5A 4NCXA 1JG3A 4MB0A 5BRNA 5LVAA 1QWSA 4JK3A 4QM6A 1OI3A 1UK7A 2VCYA 5KTKA 3JARB 5E1MA 1BHQ1 2H1SA 2JCYA 2VA8A 5FUVA 3GFQA 2FSSA 2YTZA 3R2JA 3C6ZA 1EUDB 1X1RA 4LIPD 4DIFA 2A35A 4KO8A 3I9OA 4JOQA 4RK4A 4HWOA 4R9RA 3LIIA 2PUWA 2GPTA 3OEHA 1YKSA 3AESB 4A6DA 1OU4A 4UM9B 2AQHA 3LOUA 3OLCX 3RUEA 5FPSA 1YFJA 2OK7A 2FXVA 1SOVA 1CHNA 2B4KA 2IEYA 4FX2A 4MPJA 2Q4EA 1TADA 3BXGA 3BD6A 3N7UA 2Y4NA 2BJHA 4D42A 4MRPA 5IN4A 4FYHA 3C1AA 5HEKA 1Y3HA 2V1UA 3N8IA 4RABA 3OT1A 3SFVA 3GQVA 2IHTA 5GGYA 3FNGA 1XVLA 5ENDA 2G6TA 1A2QA 1OV4A 1ZFNA 2EW1A 1SG6A 2GLXA 2HK9A 2IU3A 2XYGA 3TR0A 3ZNNA 1JFRA 1OAAA 1T8WA 3D6AA 5AKGA 4DV1B 2XMGA 3EXG2 1V26A 2OKCA 2YJNA 3I5UA 4I1VA 1X1DA 4G1BA 4M1SA 4EBBA 5LQAA 4PX2A 1JQ3A 1XKXA 3D8RA 3EZ7A 1RAIA 4P0PB 2O4CA 3N8HA 5K4AA 1TZMA 2VDMB 5IVDA 5JS2A 2PZJA 2DUNA 4GEKA 5F77A 1MQAA 221PA 4FXPA 2EQAA 3DDHA 3P9SA 3ZHXA 1UK9A 1IUPA 4ARZA 3FSGD 1CPYA 4EA8A 1RTKA 3RKRA 2R5NA 3LP8A 3J81A 3I83A 4YP6A 2HAEA 4CM8A 2PQMA 2V58A 1F0KA 1GZVA 3I2IA 1A9ZA 2R25B 1XHEA 2BEVB 5A0FA 3JXEA 1GXSB 1GTMA 1VSBA 3IEUA 2JFUA 1BA3A 1NVFA 3IBCA 3KQWA 3NR2A 1FRNA 1O3YA 1Y80A 2WJZB 3Q0EA 4I1RA 5C53B 3OZXA 4ND1A 3ZGLA 5BN1A 1WB9A 2I2XB 3B5JA 5BSKA 4F4IA 3I9LA 3OM1A 2NACA 5K3DA 4LRUA 2Q50A 4LF8B 1YI1A 2DLDA 2YFYA 5HNKA 1MUUA 2Q8PA 1H94A 1HO3A 3CLUD 1I7NA 4N5DA 2H7XA 2V7PA 3B36A 3FOAA 1T8TA 4BFZA 1B74A 5IDWA 2YJ5A 1S3SA 2VYVA 1CZRA 4BO2A 3H1PA 4UBNA 4YJFA 3RBAA 4ERNA 2ZRQA 4F91B 4YMWA 2HGSA 3H84A 2IYNA 5AIBA 2WP8J 2PXAA 3NFYA 5LDDC 1HORA 1YS2X 1KJIA 1N7IA 2DR0A 1AKTA 3V9AA 4DMHA 3CZAA 4EVSA 3M3HA 5HQTA 5CJPA 1P0IA 4DHWA 4ZTBA 1DXOA 2CCKA 1P7CA 1OX4A 4FYPA 4WBSA 4D57A 2FX3A 2Q5CA 3RUAA 3ZCXA 1YF3A 1HDEA 2AW5A 2ZBFA 3SBEA 2GXQA 4X1IA 2C82A 1R27A 2FUKA 3H0EA 4QPZA 3VKWA 3DO5A 4K81B 4TKUB 5F1KA 3T3NA 2DFNA 3ZQUA 3D3QA 1MOQA 4JJGA 1LDBA 1NBWB 1VE6A 2P3SA 4MP8A 4J0CA 2VHUA 4D45A 5C8YB 4TT3D 3GFTA 3AVOA 1ZGZA 1M6HA 4GYYA 2BFMA 1SCNE 1C5KA 2E6UX 5JNVA 2VUIB 4BCDA 3E5NA 1OILA 3NIGB 4Z9YA 2WWIA 5ALEA 1C7IA 2A1IA 4UMDA 3VX4A 3OOWA 2QN6A 1ID1A 3ZVNA 2QJFA 2O2SA 4RHUA 2GN8A 4RS3A 3WRXC 3MWYW 3C14C 2G8NA 1H2FA 3PC8C 2LD4A 4PZ9A 5SY9A 2A0KA 3UFXB 4L16A 1JBKA 3QPCA 1N3LA 3EZLA 2XLBA 4JUDX 4PPNA 1LBTA 3NM5A 4FD3A 1MP0A 1KQFA 4GRIA 3SZ3A 3VAZA 3LW8A 5HWSA 1RWXA 5AM3A 5ALPA 3A11A 4RD6A 1JUDA 3TSZA 4BVFA 4MRRA 5BOVA 5SYNA 2RKOA 1MO3A 3EVFA 4F38A 1WV0A 4Z4CA 2ONZA 1PJAA 1P39A 4WUVA 5TGZA 4ALNA 4PCVA 1HT2E 1ZUD1 1NMXA 1WNFA 1BQEA 4D9CA 4U2GA 1RBMA 2G1AA 5K20A 2IT1A 4E94A 2WM9B 4GM4A 1PNVA 1SCBA 1CP2A 3IXMA 5B2ZA 3FYTA 3L43A 5LDGA 1BAPA 2G1JA 3ESBA 2ZR9A 3FCOA 4IJUA 3C3WA 3OETA 5HKBA 4UUQA 3PNYA 4RQUA 3THWA 4DB4A 3M1YA 2VP0A 3O4VA 3R44A 4L5IA 3HJCA 1U3WA 1NV9A 1E1CA 4K2HA 1N1MA 4CIXA 4EG6A 5I4IA 1VBFA 3MCVA 2A7QA 2JC3A 1BXGA 3G9XA 4M0UA 3W6UA 5T7BA 1OWPA 1VKRA 1KQ3A 2VP2A 2VF4X 3TIVA 5B3KA 4HDNB 4RGQA 7REQA 5FAKA 5KYWB 2NUPB 1SXHA 3ZI0A 1MQSA 4UHDA 1RQRA 1S8NA 3L05A 5AH0A 1T15A 2O20A 2QK4A 3E5MA 3F4BA 4GSYA 2B1IA 4MEJA 3RJ9A 1Y9JA 1W1IA 1PIWA 2OCYC 2ZRCA 1UMBA 2HQ1A 4ZVMA 4P4SA 2OCLA 3SY8A 5JDIC 2NVUA 3EQ9A 3C7KA 4LK2A 2UZAA 2PV0A 4NMMA 1R0WA 2DTXA 4KMMA 4NNJA 3S2GA 4BLPA 3U7IA 3AY3A 4DM4A 1I94B 1PP4A 2I8LA 3DHYA 4D4MA 1QTQA 3JQCA 4KUHA 4XUDA 3K20A 4TVOA 3NNSA 1WL8A 2HJGA 5EZYA 4N82A 2WA1A 2WI8A 2ZT8A 1UPXA 5JNUA 1GL7A 1QG0A 2DWUA 3AO0B 4BNKA 3NC4A 3EXIB 3QKUA 1GKYA 1MEEA 3SZOA 5KZMB 2P2DA 2XHZA 2QGNA 4YP5A 4BNJA 4OMUA 1TCVA 4EG5A 2WHPB 1AUVA 2Q2NA 4MARA 3LUGA 3WFJA 4LOKA 3HB1A 2FVXA 4QHSA 3ILYA 1PX0A 4FOPA 5FTJA 1Y0BA 1ZMRA 2GD2A 2R7KA 4CCWA 4LXTA 5ALMA 2C8KA 3CRRA 3FWNA 4O4IB 2ZIGA 1WCWA 2OC4A 1T9KA 4RX1A 5L7TA 1NW3A 5ECYA 4LECA 3MJRA 4RH3A 2HBQA 3GGPA 2MMGA 4MULA 2I4NA 3R5JA 4MPPA 5AYVA 3QWIA 4DKJA 5B1DA 2ZETA 3RT1A 1OLUB 1TK3A 3GZTB 5FI3A 2H8KA 2HSDA 4PO8A 4CV3A 5KKNB 2O2GA 3QKSB 1YZVA 3ODPA 2C78A 3CF4A 5AJTA 4Z8YA 4GXTA 1J8YF 4DARA 1E9CA 1VPLA 4MV1A 4TLEA 5ED4A 1I5EA 2ZEJA 4JODA 3OIUA 3WMXA 1I7PA 4D46A 5IX8A 2ASVA 1CTQA 1SPXA 1KHHA 1TQ6A 2AOXA 1T8UA 2G09A 1TFUA 2O8NA 1FUYB 1E7MA 1FBTA 2OBBA 2P3LA 4WKGA 1BJTA 3ZDCA 1IBRA 2VZLA 5LQJA 4PFKA 2PXXA 4WOBA 1B15A 1U2RA 2IZ7A 3TRJA 5IVKA 3N70A 5BV7A 4G8JA 2VH2A 4CM9A 2WDPA 5ALVA 1XMJA 1I7DA 1F38A 4AY6A 2Q6LA 3CR8A 5KAPA 2FN7A 3R0VA 2W00A 4C07A 3HZOA 3RABA 4URXR 3KSMA 2ZS7A 1Z8DA 3WB1A 2JRLA 4E5PA 4DG8A 2G7ZA 1EGMB 2XNSA 4U7HA 2RCNA 1OZ0A 4C2AA 2VR1A 4O2BF 2E48A 4JR2A 1HY3A 1KVSA 3SR3A 3D3NA 4FOTA 5IEJA 3DLBA 5EXDA 1YQDA 1PFWA 2O50A 3CRZA 3GJ6A 4I0WB 4QXAA 5T3YA 4KR7A 3OQJA 1A2OA 4ALIA 4QZVA 3G49A 3GAAA 4EOGA 1E7QA 1MG0A 5JC8A 3WLJA 1NQTA 3WDSA 3ZCPA 5DX0A 4NNPA 3T7TA 1CETA 3FW1A 4WUTA 1BRMA 3PYLA 5BMVB 1N2EA 1OHHD 1TE2A 1DS6A 3RVJA 3F3KA 5AVJA 4MR9A 1ISIA 1KIAA 2IIPA 3F6PA 3TVTA 3ZG6A 2FFHA 4YGYA 1QUEA 2QJWA 5DRYA 4JBLA 4P7KA 3DZGA 1W8DA 1ZGJA 3NPAA 4MQ4A 3JQFC 2YV4A 2O2IA 3K72B 4JI7B 2CDCA 4KX5A 3RQSA 1H4SA 1PJZA 4N6NA 1HE4A 3D4LA 1RBYA 1Q14A 3HYSA 4LK3A 2F3QA 2AR0A 3SNKA 3QVGB 3UA3A 1DKLA 4X6LA 3U31A 3UUEA 4LGCA 1RXCA 2H2WA 4LRQA 4PPQA 4JOBA 1Y8CA 3VO8A 5D1NA 4C1BA 4OM7A 3KWFA 2QP4A 4IQ0A 2VL7A 4PW0A 2GHTA 1CERA 2GT1A 3T9FA 4B9EA 4JU8A 5JD5A 4GP7A 2JKVA 3JARA 2JVIA 4I4IA 4QAQA 3KV1A 5G0VA 2NUTB 1SUEA 3CN7A 1JQDA 3QVKA 3E48A 1OXKB 1EUDA 1XQYA 1UQTA 1Q6ZA 1JX6A 1NG1A 1PFVA 2X14A 1SC1A 3PNOA 5B7QA 3R77A 4UREA 2A8YA 1R2QA 1PW5A 1WE2A 3AESA 2PGXA 1CVIA 2FRDC 2O8EB 5IVPA 1ADYA 1LF5A 2VWHA 4I4CA 2C4TA 5CLQA 3MLAA 3OA0A 4WH0A 1EGVB 1XAIA 5JXWA 2AZTA 4YMIA 4MMZB 2K7ZA 3MS4A 2LE0A 4CMIB 2C00A 3LT1A 4PO9A 4WJZA 4JUAA 4LFBB 3MWGA 1G9XA 5A5EA 3RIYA 3RAGA 5TPWB 5FQOA 3W5JA 2BL4A 4QL3A 3EUFA 2CCJA 2RK6A 1RXWA 1IZ7A 1E5LA 1NAIA 4ZRNA 3IIEA 1CXZA 2HIMA 3CA8A 3P2MA 4E1VA 2R00C 3QPBA 1KP9A 5BSUA 1GQFA 3NS7A 3W4KA 3WKEA 5GJVC 2R7MA 1P2GA 3T3MB 4E33A 2JW5A 1DGQA 4DW8A 2P79A 3OIYA 2JH3A 1YR6A 3QPDA 3TSAA 1OH8A 4JV5B 5ALOA 2C9OA 1YZTA 1L1RA 1X9HA 3DBIA 3F7TA 1IQRA 4HFMA 4HH1A 4AJPA 3MPUA 3BJZA 2O7VA 3RNLA 2J87A 4TWRA 4WINA 4XIYA 3VTZA 3P7MA 2MSCB 2BHTA 1A5BB 3E22B 2XUAA 1EK5A 3GNTA 3R75A 3IOMA 4O25A 4P92A 4CL8A 1XWFA 5CA0F 2IS6A 2V65A 2OV6A 4MW0A 4XJSA 1R88A 3CX3A 5EKSA 1GV0A 2BEVA 3BF7A 3K1ZA 2WSSA 4BBJA 1GXSA 4NBLA 4IMRA 1W4AA 4MQUA 2IYPA 3M9XA 3TG2A 3EH2A 5K03A 4IQ8A 3TXXA 1ZPDA 7AT1A 1FLVA 3EJ6A 3PHCA 4OQEA 1BQ4A 2GFIA 4D6YA 1JHDA 1VE1A 3DE0X 2YINC 1DLJA 1YZNA 1QO9A 2Q7XA 1K5DA 2EBFX 2XWSA 3E8MA 1UL1X 1Z0FA 5EP2A 5AW6A 4Q82A 2NO0A 3N5KA 3DMFA 4RAQA 4UHJA 4TTVA 1R9GA 1NC1A 4YJHB 2GN0A 3FWYA 5WRFA 1TK9A 2PQ2A 4X44A 4DM7A 5JJ5A 5A02A 3W5UA 2R79A 4HX9A 4IV0A 1P4GA 3T4EA 3ABZA 4EW2A 3KZOA 1IY9A 4GE3A 1R10A 4EG0A 8LDHA 3LBFA 5BSGA 1Z5OA 3EVAA 3OCUA 5HCUA 1KKLA 3N76A 4C7BA 1ORDA 1TM5E 4DREA 4E5KA 2VSNA 5AW2A 2Z43A 4RTJA 2VAMA 1F5SA 4MYHA 3NHKA 2WVAA 3FCEA 1FXSA 4KEAA 5HG0A 4NOMA 1EUYA 1NM5A 4MVJE 3E18A 3BRQA 4K9MA 3KJZA 1SXJC 5G53C 4URZR 5TARA 3E3AA 2YIMA 3Q0IA 5AK3A 1H0SA 2WYVA 1ES9A 4TKUA 3FJOA 3ICVA 4RD2A 2P2NA 4AJOA 5BPHA 1CZOA 2AK2A 5FYQA 1ZEJA 4P7GA 2J85A 3OIWA 4HNSA 5C8YA 2G71A 1Z4LA 3N2IA 5G1OA 1ZP6A 1MB9A 4DLYA 4N41A 3KCQA 3TZEA 2H5LA 2AOTB 1U7TA 2XYVA 3G9TA 3NONA 2PNJA 4GMXA 1D2HA 4PGAA 3ZUPA 3INNA 5HE8A 2NG1A 4DLNA 3UHPA 4Z4IA 1QAQA 1Q1GA 1RLTA 3LHIA 3Q41A 2ONCA 4JLAA 2LCQA 2PUCA 1CZLA 2XV1A 3BRWA 4KXFB 2E6KA 4OJMX 2JS7A 1GFSA 4YMGA 2WQ7A