4K9RA

Spore photoproduct lyase y98f mutant
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
340
structure length
340
Chain Sequence
KPFVPKLVYFEPEALSYPLGKELYEKFTQMGIKIRETTSHNQVRGIPGETELARYRNAKSTLVVGVRRTLKFDSSKPSAEYAIPLATGCMGHCHYCFLQTTLGSKPYIRVYVNLDDIFAQAQKYINERAPEITRFEAACTSDIVGIDHLTHSLKKAIEFIGATDYGRLRFVTKYEHVDHLLDARHNGKTRFRFSINSRYVINHFEPGTSSFDGRLAAARKVAGAGYKLGFVVAPIYRHEGWERGYFELFQELARQLEGMDLSDLTFELIQHRFTKPAKRVIEQRYPKTRLDLDETKRKYKWGRYGIGKYVYRDEEAKELEDTMRRYIEQFFPGAYVQYFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Spore photoproduct lyase
publication title A radical transfer pathway in spore photoproduct lyase.
pubmed doi rcsb
source organism Geobacillus thermodenitrificans
total genus 124
structure length 340
sequence length 340
ec nomenclature ec 4.1.99.14: Spore photoproduct lyase.
pdb deposition date 2013-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4k9rA01
3.80.30.30 Alpha Beta Alpha-Beta Horseshoe pyruvate-formate lyase- activating enzyme pyruvate-formate lyase- activating enzyme 4k9rA02
4RH1A 4K9RA 4FHDA 4FHEA 4FHFA 4FHCA 4FHGA 4RH0A
chains in the Genus database with same CATH superfamily
2UZ3A 4P0PB 3F73A 4MHOA 4XLLA 3ZU5A 3IJ5A 2PYZA 4QOEA 5H3HA 4AQ7A 4H7PA 1A9PA 3KKZA 1HYBA 4NOMA 3U40A 1MTZA 2B9VA 5JI2E 1EA5A 1JDTA 1EWRA 1MNAA 2F1OA 1P77A 3IAXA 4UE6A 5DMXA 3STTA 3UWDA 4A91A 2PUJA 5KC8A 2VF8A 3T1YB 4Y2TA 5EUQB 2QXTA 1I0IA 3GZNA 1W0CA 1XGKA 3L77A 3DE4X 3PF9A 4W6ZA 3STHA 2F3SA 3B3GA 1W4ZA 3BMNB 1JKJA 2AFIA 3GLRA 5LA6B 1CJCA 1DIRA 3AETA 5FTNA 4IOLA 5TF0A 3RS2A 4YJ3F 3J81k 2HTEA 3WYAA 4JOSA 4G5OA 1QONA 4IAOA 4Q3LA 4TTQA 4XGIA 4EWLA 2GZSA 1DXYA 3PDIA 4S1VA 4DLRA 4XIYA 1KVUA 3V9AA 1U7OA 3DBVO 2ZREA 4H60A 4HGZA 1CRLA 2SKCA 3WNQA 2AUMA 4HMQA 3ETEA 4J49A 4XVRA 3U4CA 1STOA 1TZKA 1WPRA 2NUPB 3GEHA 3QFRA 1OTXA 1U8YA 4EF4A 3BWXA 1E9VA 4CI9A 5FTLA 3OZVA 3O8LA 1WP4A 3RVJA 1LLCA 3U19A 4AMZA 1QH9A 2QPLA 3IP3A 4PYLA 1I4WA 1I3MA 1OT3A 3TN7A 4PO8A 2OM6A 2D7CA 4H08A 2RI0A 1QHYA 5KAPA 2LKDA 2OHOA 5HCIA 2HJHA 1QPZA 1R8YA 3R5FA 1L7NA 2VP3A 2X8JA 2WHXA 2NVWA 3GBSA 4K88A 2BGMA 4ZQCB 4QODA 4E0BA 4GBMA 4EB6A 4C4TA 3IXMA 1XRQA 2E18A 4QVGA 4WLFA 1M2NA 3WGZA 4BN4A 3GF4A 1RQLA 3E1SA 2RHCA 4JQSA 1ZH2A 3K96A 3EWIA 4P36A 2Y05A 2GQ0A 2W93A 3AWDA 5IJWA 2XUZA 2A9KA 2HBRA 3TZQA 2ZUEA 4MQMA 3MS2A 3NP7A 1OUMA 3CUYA 4DSAA 1GPMA 4B3GA 3A1VA 4AG3A 3C8DA 2G5PA 2FX5A 3C98A 3GEDA 4NYJQ 5KTPA 3K0SA 4B32A 5IH3A 1ODSA 5CNKA 4OKSA 5H3CA 1PJ3A 3AUTA 4KUGA 5GQSA 4EY7A 1RAAA 1CFJA 3QWHA 2GX6A 3S2UA 1DKUA 3VPAA 1VI5A 4JGGA 4MV5A 3TJZA 1H4VB 1R9JA 2K2QB 1TM3E 2AXQA 3CR3C 4M0FA 4EATA 1HL7A 1U1IA 2X1HA 4B9AA 3BD7A 5H68A 6LDHA 1VP9A 4YHBA 5HKLA 5BNWA 3SZOA 4O4LF 1EVYA 1XCMA 4M2LA 2X1LA 4GSYA 1OC4A 2XVAA 3FVVA 4LYAA 4ZCQA 4DBZA 1T29A 3TR6A 4D80A 2GXQA 4FINA 2L17A 4KQCA 2GPYA 1PFKA 1TMOA 2E21A 4WLNA 4GKJB 2IE8A 2C9YA 5JUWA 1EK5A 2JCXA 2IHJA 4FHDA 4XIGS 4K05A 3J7AC 5LQDA 3G59A 3R3ZA 4FN5A 1F0PA 1AM4D 1Z6YA 1QE0A 5TQVA 4BBZA 6NULA 1RIFA 4M1EA 3VPFA 1GD1O 5ALRA 3AB3A 3Q11A 3IE0A 4UFOA 4RJIA 1B4DA 5DLDA 5ALXA 3TZKA 1VPLA 1H2AS 3A1EA 3F97A 4PQRA 3RSSA 2W8ZA 2X8AA 5BQFA 4Q00A 2HMYB 2ATIA 2PLNA 2VRBA 3C6QA 2WJWA 4WCVA 1K89A 1GZDA 4BKMA 2AXPA 2AG5A 3ZQ4A 2QL6A 1N2ZA 4JSTA 1SHJA 2ZSIA 4X1KB 1KZ4A 1VRCA 2C9CA 2JRCA 4DARA 1GTG1 2W7TA 3HFGA 2YXEA 1QDUA 3ENNA 3IRVA 3LUHA 2V7QD 4L85A 1Z2AA 2EBWA 1FX0A 1E18A 3K30A 3KSMA 1N2CE 2VL7A 5AKIA 2ZSEA 4C03A 2GYUA 1A2OA 1AF4A 1NBMD 3BE5A 4CMEA 1MHTA 4X85A 4K03A 2IHZA 2DPLA 4B4DA 5AI4A 1TTQB 2H2DA 3KOZA 4EGQA 2OCLA 3AHIA 3SC4A 4K86A 2YRXA 4HNAA 2Q62A 4MR7B 4RQUA 1N2GA 3HCPA 4RV9A 4L78A 3I23A 2V3CC 3FTPA 4NZOA 5EJ8A 1L4NA 4M22A 3L7DA 4D1YA 2QZJA 1M1NB 4MHTA 3BWBA 3ZCUA 4K8RB 1FMCA 1P7WA 1XJ5A 1Z7GA 2J7KA 2JIDA 1FK8A 2QAJA 1WSBA 4H1UA 1U1EA 2QYSA 1M6WA 2ABWA 2QQ0A 3SE0A 4B3DA 2WVAA 3G0CA 2QRVB 1I2ZA 3FZQA 5IF9A 1MX1A 1ECLA 2A84A 1UXHA 4DT1B 2J4DA 1AUPA 2JLYA 1GU0A 2ASVA 1ISGA 2C7PA 2JANA 3O3NB 3VVMA 2VATA 3JQGA 2XTMA 3F7MA 5DHPA 3QXXA 4C3VA 4ZFNA 2VHZA 3VKUA 1R12A 1DWPA 1KO8A 1SC6A 2CFCA 2GLUA 1CY2A 4FFBB 4R3UC 4RVGA 3WSWA 4IVRA 9LDBA 5LL6P 1HDCA 1UK6A 1X8JA 4KFUA 4PLTA 4BECA 5KJFA 1Y7PA 3M81A 5KREA 2C2XA 1HX7A 3I83A 4OH1A 1M0TA 1T0UA 1POWA 1ZO8A 2UZ0A 4WWHA 3VNSA 1ODLA 3LQKA 4Q12A 4ONEA 4Z9YA 4DDTA 2JLSA 2NQ8A 5EIFA 4RIEA 3AF4A 3B7WA 2NU8A 3ZD6A 1P4GA 1YVPA 1H66A 3P9KA 3LZ6A 4BLTA 4QXMA 1Z0ZA 4ZT5A 2GKGA 5BR8B 5I7FA 1L7VC 1GTJ1 1EXWA 3L1KA 4N65A 4C3OB 2EDCA 5IS2A 5CFPA 1P18A 1FLVA 2YJNA 4BBAA 1W1WA 4KQHA 1X1CA 3M3HA 4IIYA 5C1OA 1N92A 2PX2A 5COQA 1Z4IA 2Y6UA 3WIBA 2D2EA 3PFBA 2F8TA 3W8RA 2Q0QA 1XCGB 2WTNA 3GT3A 4JNCA 3MT0A 5B7GA 2JNWA 4GMKA 4PHCA 2PZKA 1LLUA 1W52X 1T26A 2ZYVX 3Q8XB 4FQ7A 1SWWA 2B9EA 3KJXA 4IEFB 1T0JB 2A4MA 3BMQB 2O8EA 1YZ3A 1KA9H 3K9WA 2ZBRA 2ZW9A 3DF9A 3IUNA 1JJ7A 4QTYA 3FKJA 3GFPA 1W581 4QD3A 1H8HD 2OZVA 1W1UA 4HQKA 5F64A 3E9CA 4PGHA 4MS4A 1NDHA 7ADHA 1E3LA 3HE3A 3HP7A 1U9JA 3GXBA 1QZUA 4FOLA 2VYQA 3QVMA 3M6XA 1TIBA 2EX1A 2E5FA 4DLSA 4LFBB 1SMKA 4E21A 2Y1KA 1RXYA 2QW0X 4DR2B 4OYRA 4YXFA 3THYA 5FL7A 3QH4A 4LAFA 2I55A 2WG2A 1ZVQA 3L4EA 1QM5A 2R25B 3LP5A 3MINB 1N5IA 4I66A 3A27A 1ODCA 1VE5A 2VPZA 5LBIA 1QCZA 1T4BA 3CINA 4JYPA 3T9BA 3PI6A 1FP4B 2JBHA 3HYTA 1FXSA 2P9ZA 4XA8A 1FRVA 1WMDA 2QORA 1XAGA 4EG8A 1A9SA 1GLVA 3HV2A 2NYVA 2R4UA 4IMRA 3VKVA 4DCGA 1QIDA 2LGJA 3OQMA 2R4TA 1HZJA 4X8HA 1S1MA 1HTTA 3NIGB 4BNJA 1N1EA 4KPUA 4IXDA 2NU9A 2PZGA 1WXFA 5LYYA 4RCZA 4LOKA 2Q5OA 1NXVA 5HIAA 2FR8C 5KTMA 2FXIA 1CNFA 3NBYC 5AOVA 4TSRA 1GSIA 3UVEA 4BKPA 4BZWA 1UMDB 2V5VA 1V35A 4N0EA 4RE6A 5F33A 1V1MA 1L0BA 1Z4OA 1L5ZA 3DB1A 3FNRA 1NQOA 2P68A 3WRYC 1OILA 1W47A 4LMRA 4GZ5A 5JNLA 3W2EA 4Z9BA 3GFVA 1OGJA 1GSOA 1BXKA 3IDOA 2R00C 5KPDA 1L5YA 2FSPA 3BCRA 4MDYA 3DE6X 2GYWA 3VSDA 1TF2A 1J2EA 1GSHA 3H5RA 4K6FA 3TOZA 3RROA 1M7BA 2XDWA 3RVDA 3FSGA 4HJXA 4CCYB 4O4IA 2V6MA 1OZFA 1H69A 3TAUA 1FTWA 4UHHA 5ADWA 4RMJA 1FL9A 4YJFB 4D9JA 4C7OA 3MJ4A 1DAEA 1GAEO 3CVJA 3L8CA 2IH5A 2G70A 1W1IA 3MJHA 1FU7A 5LDDC 1RHQA 4FD2A 5K8JB 3LOUA 3G7UA 2OGZA 4L7VA 5E9AA 4H77A 4GSKA 1W8DA 4HNSA 2OG2A 2W2LD 1LFDB 5AVUA 1ZPDA 3MT7A 2IZ6A 3ZE8A 3ZW8A 3QEBZ 6PFKA 3ZNPA 5KQLA 1E8NA 2I62A 2JIPA 3FAKA 5KYYA 2F55A 5FKJA 3Q7PA 3TZCA 4YJGA 5G40A 3SFZA 3G2KA 3G2OA 2QZZA 3RQSA 3CRW1 2A9JA 4FOPA 3OWOA 1GQQA 1EG7A 5CB0A 1FMTA 4LECA 3MS7A 3LSTA 1G20A 2P1DA 1E1QD 2ROQA 1UPTA 1ZN2A 3AU9A 4O29A 4QREA 2LWIA 4DCPA 1RPTA 3A6PC 3OPQA 1Z0FA 4WFKA 3KJNA 3LZDA 3PNOA 3R7LA 4JXZA 1CYEA 1F06A 1FMLA 3UKJA 4I3GA 1N6IA 1DWOA 1YDFA 1TIKA 3RUIA 4CGYA 1WNFA 3ROFA 3ZS9A 5JH7B 3P0RA 1RAHA 3QNWA 5CDFE 3KJEA 2JIMA 4GPEA 3UTDA 3Q7RA 1TZJA 4Y0NA 5CNIA 3EVGA 5IAAA 3PXDA 4F7DA 2J0SA 4WFQA 1WXHA 4DV6B 1T6NA 1PLLA 4KYUA 5JXJA 1JAIA 1XDZA 2O1WA 2P6RA 3A0UA 1GTL1 2PRIA 2VBGA 2W2KB 4NHEA 4D9KA 3H1BA 4QQRA 5K4GA 3HJNA 2A5JA 3RH0A 3HCEA 5CH8A 4NATA 4FHZA 4NK4A 2JLVA 2R5WA 5BQ3A 3BHMA 4ASUA 2VSXA 4W9RA 5JQGF 2SCUB 5EIHA 1FDWA 2ZJFA 4RWEA 1V4NA 4BL5A 4KV9A 4HDOB 2XA2A 1NIJA 2OO5C 3JQAB 4C0XA 2RG7A 4MR9A 1TUGA 2VDUE 4MEAA 2JI6A 1KEWA 3STUA 4LQLA 3OQIA 1FFBA 2NUAA 4WLUA 2ENUA 1HDEA 1J8YF 1Z8FA 2OGWA 3NEJA 4OY3A 5EXEA 8ABPA 5LZ9A 3RHFA 1KK1A 1VJRA 3WOVA 1CDEA 5FB3A 2COEA 3QWBA 5IABA 4L5CA 3T4XA 5BYKA 3O8OB 2PPVA 3DAOA 1YQUA 2X5XA 1SVSA 1A69A 3PF8A 1K4MA 1PX2A 1X19A 2R8XA 4L3WA 2A1UB 5FUYA 3V80A 3BAFA 4Y9SA 4BRSA 3WO0A 3N07A 1T3HA 3PVCA 4Q1EA 4Q66C 4TTRA 4QOJA 4GGPA 4RESA 4Y8VA 3OQ1A 4HVLA 5BURA 1MV8A 4MCJA 5K3BA 3B3JA 1PDOA 1XFAA 4E11A 5EZYB 1J1ZA 4EW3A 4EW1A 1KI3A 5TS3A 3GJ5A 4P3NA 5CFRA 4B8YA 1TVKB 3G6KA 3HZHA 1VSTA 3U3KA 3T1HB 1XI2A 4R8KA 3HSKA 4WCDA 1H4QA 2QR3A 2ZIFA 2C4VA 2WW8A 1USIA 1Z73A 5KQMA 4OX9B 1M2GA 2GDZA 3PFHA 1OH7A 4E4TA 1EUQA 4QU0A 1WZ2A 5B55A 2DPXA 5FORA 2GHTA 2OHIA 5CM2Z 5ED4A 2Z1MA 3N0XA 3IEKA 1SBTA 1X2BA 1XZBA 4EM6A 5C8YB 1J9EA 4OHPA 2QZPA 1D2CA 2AS0A 1N32B 1J21A 1PGPA 3VU9B 3TNFA 1KKLA 4BNTA 2P9QA 2BTEA 4Q4AB 1X1TA 3H16A 1QTIA 1KEEB 1SNYA 4M9RA 3R44A 4AZ3A 5TJ9A 2YVAA 3NORA 3LBNA 2PBLA 3OCCA 3DV0B 3GNLA 4J7AA 2C2HA 1L5HA 5CA1F 2HRQA 2X5KO 4WVLA 2DFVA 1PGNA 1TDJA 3K6KA 3OPNA 4PNZA 3ZCVA 4CQMD 2ST1A 1F0YA 2CDRA 2R97A 3AF1A 3JQ7A 3QK7A 3LPDA 4ITUA 1QHFA 7REQB 3EAGA 1JE0A 3CEHA 3HI4A 3QY0A 1LNSA 3RTCA 1QANA 2ALJA 2WP8J 3E9ZA 3KALA 4EAQA 1A8SA 2ZVQX 1KVTA 1IUKA 2HSEA 4M9UA 4XSVA 1GY8A 1MC4A 2X0JA 1B8UA 1NMSA 3ITKA 4I6GA 1SUBA 3DLCA 3EXHB 2PVPA 3EPPA 2VKQA 4ZO8A 1PR1A 2R87A 1U6IA 3QXGA 3WQQA 4CKBB 2VG8A 3U4QB 3UT5A 4HS9A 1FJGB 3P7MA 3BGOS 3QU5A 5G02A 1IHOA 2AUNA 1O77A 2XA1A 4ER0A 4Y2SA 3AK4A 3KSUA 4J90A 3F8SA 4OXXA 2AA3A 1J6UA 4TKLA 1KEPA 2IHUA 2X0EA 1ZD9A 3TLKA 3V1KA 5JNVA 3RRBA 2FPSA 2JCBA 4M4SA 3OM8A 4H35A 3OSZA 5TVGA 4EBFA 1E4OA 3AUXA 3QHPA 3HVRA 1ZS9A 1SJ9A 2FRVA 5DK6A 3NBUA 4QBIA 1YJ8A 4A0RA 1X7WB 5AM0A 2XMRA 4B46A 1RAEA 4KZPA 1P80A 1TM7E 2Q1YA 2WPNA 1DRJA 3E82A 3HG7A 4FBLA 5B3JC 1WY7A 3TUIC 5ALDA 1W36B 4XUDA 3AVQA 1Y7TA 1KDYA 5BN3B 5CEFA 3QEJA 1SGWA 2C5FA 4UOZA 5ERYA 3JZIA 1XHFA 1Y34E 1FDTA 1H0RA 1H2XA 1O7JA 1Q7TA 3MW8A 1OAOC 5IDVA 3WGUA 5LMNB 1NXQA 1N3LA 1RYZA 4ZVVA 4F9TA 5ITZB 1R50A 3F6CA 2GUWA 1AKQA 2Z58A 3GPCA 1MEEA 3CY6A 4ZAWA 5FWXB 2BFWA 1E63A 2EGGA 3MLEA 1XALA 4FWBA 1HNXB 1FLDA 1DX9A 4FDVA 3LF2A 2IF0A 1OYVA 1U8UA 3LT4A 4N82A 5MGNA 1B74A 4JA0A 4Q7KA 4WXHA 3UK1A 5AW1A 4WZAA 2FWMX 3HXLA 1RMQA 3RC2A 1E59A 3OZTA 2E5WA 2PSFA 4V03A 2N47A 4X6UA 5ARBA 3ST7A 3S2IA 2VTKA 1O96B 4UJ5A 4KXYA 4EYOA 2VQ3A 3DZCA 2CHFA 2C8JA 1NXTA 3L0OA 1ATIA 3KYIB 4RK0A 5AKGA 5DLPA 5FPHA 3WLKX 1O6FA 4KVGA 3DEHA 2ATEA 5B57C 5IVHA 1SCDA 3COYA 3HR4A 3E61A 3ONVA 3UUFA 3WVNA 1QQ5A 2J08A 2ZUUA 4J7UA 4BWYA 4RU1A 1OPXA 1LBHA 1RKXA 1T2VA 1PI3A 4WERA 2HSDA 5J2TA 1QHEA 2ZYHA 4WD3A 1MXHA 3NTQA 1BCSB 2BC9A 2O7RA 1P5ZB 4ENTA 3F5DA 5AUPB 5J3JA 3ZE0B 2GFIA 4OP1A 4DL9A 4PHGA 1JEEA 3TE7A 1YQGA 1HGXA 3KNZA 5F12A 1E94E 2CXHA 4X8LA 1ZEMA 3LFUA 1ZGAA 2A88A 3ZHZA 4DHWA 1Y8RA 4URWR 1E5TA 4KBGA 1U2DA 3BMOB 3IOYA 3O8OA 4GVLA 4MXDA 1GQRA 1NJ1A 4O0LA 3D3WA 1G0NA 4C1NA 1ODIA 1YK1A 1LC0A 2NSYA 4HGOA 2F9FA 1L5KA 1QO0D 4YO7A 4DV5B 4UHJA 3P0HA 1TRHA 1B6RA 4LNHA 5EE9A 5IU6A 2FFJA 5AVKA 5TQJA 2C97A 1O6CA 2G0AA 4PX2A 3LUJA 1OLOA 4A8JA 1L5MA 2X9NA 5C5DA 4MV4A 5EZYA 3K09C 1XZIA 4MVJD 1GNTA 1H6DA 4H1TA 4TLLB 2I65A 3WL5A 3DKKA 5HBRA 2XYQA 4M9SA 3C45A 4FGJA 2OMKA 4QOIA 4TV8F 5HMMA 1T3LA 3X1KA 1J25A 2BUAA 4DVGA 3V8PA 4LBWA 3DOHA 3H2JA 5KYUB 3I9OA 3EK2A 4LZWA 4BNWA 1XTUA 2FUNB 1A5SB 2R96A 3ACDA 4NCKA 1JFRA 5LFAA 5LUAA 1LI7A 4M7RA 1G4UR 1IAVA 4HYEA 5LLSA 1ZP6A 2PJZA 4A82A 3CVVA 3QE3A 4UAGA 3QLVA 3HGQA 2EP5A 1G291 3RT9A 4AO7A 1VGVA 3CUTA 4K46A 1DJMA 3LHFA 3X1WA 4P08A 4HNRA 3OD1A 1OYYA 3QXJA 2CLEB 1GGFA 3ADOA 1DLJA 1JNYA 3CZQA 4FGWA 2HFJA 2DPYA 2H9IA 4IMPA 3V8BA 2G1AA 3WMFA 1LX7A 4OQXA 4RLHA 2AYZA 4MK4A 1NVXQ 1PKEA 5CVCA 5IC4A 2CW5A 4DIBA 4UMEA 1QMPA 4NFLA 4HUQA 4UMDA 2GFHA 3DJYA 1KHTA 1F2UB 3LQ4A 3OQJA 2VRCA 2YHIB 3MF4A 3S2GA 3VHQA 1GG9A 7REQA 1BHJA 3Q7QA 4D9FA 2X4IA 1YWGO 1C3JA 1K27A 1PTJC 4BYGA 1KKMA 1HM5A 1QVRA 2X1VA 4CMHA 1ABBA 1IEXA 2G08A 1ZK2A 1XZHA 4OXNA 4A15A 4PFJA 3CUEF 2EIHA 1KJYA 1L4UA 4KKXB 4CDRA 3RO7A 2ONJA 4FOOA 4WDQA 2F8LA 4F6RA 1S7GA 5C5CA 4OBBA 4G4GA 2L42A 3CLTC 5P8WA 4B87A 2F1IA 2YWDA 4R41A 3SBEA 3C6ZA 4DNFA 3CISA 1LK0A 1H9BA 1V41E 4XWYA 3ZQKA 4D42A 1N77A 2YS6A 2Y77A 4GYKA 2D00A 2OCGA 4N5DA 2O2CA 4EBBA 5JATA 4FT2A 3PDHA 3HP4A 3LECA 2VH5R 4GKKB 3IKJA 1IULA 3V4RA 4JVSB 6YASA 4LJYA 1H0HA 5F2EA 4LZZA 1CTQA 3OETA 4YECA 1UDRA 4NBTA 4J9UE 5CTAA 4PANA 1SUFA 3GRRA 3KEOA 2G9QA 3EEQA 1J23A 4MLPA 2CWWA 3V3KA 1L1RA 3TAXA 5T4HA 3D4BA 1OBFO 2QU7A 4YJ2B 5HIKA 4I9NA 1K2WA 4IOMA 4KLNA 3U16A 5FPSA 5A1TA 1AH2A 2G5GX 1ICEA 5ADUS 1R2QA 4ND8B 3CFYA 4IXWA 1JMKC 1M2FA 2GN0A 4MRVA 2OR3A 3OM0A 4EY3A 3AKEA 3UF0A 4KACA 4PR0A 1DUSA 2XVMA 2RGRA 1S2LA 1ZH4A 4BBPA 2B4YA 2FQYA 3OE7A 2NNLD 3K2QA 1J39A 1C8KA 1GZ5A 2YFYA 2RI1A 4EMBA 1U7ZA 5I9LA 1JU9A 4LXIA 5AW3A 4NV3A 3EEBA 4K7JA 4MI1A 5CVVA 1VB3A 1QFXA 2XGMA 4UTVA 3BCUA 5JSFA 2GTPA 2VK4A 4L6IA 1Z2EA 4N5IX 4YMGA 3T3OA 1QR6A 3QUAA 4JIGA 1Q44A 1XLUA 4HT3B 4M1WA 8OHMA 2FE1A 3HVKA 1SZCA 5DHUA 4DEYA 3OQOA 1DINA 1PZNA 3JATB 1VFPA 5C46F 3KZMA 4XH9B 4ICIA 1CB7A 4JT8A 2VSYA 3CX4A 2B8WA 3P45A 3WQBA 3RK0A 2H5LA 1O94D 1NN3A 2JFWA 3MQFA 4HR7A 4V0RA 1KNXA 2GD2A 4G97A 4LXXA 3UYLA 4ZCTA 1DIGA 3GMIA 2H3HA 3NHMA 4OJQA 1MZPA 4PLZA 3UANA 3DBLB 1HFJA 1ZINA 4P3PA 4TV9F 1Q5PA 3NAZA 1PDWA 1WG8A 1WQ1R 4JBIA 4Z4IA 3JASB 2J9FA 2QTTA 4YYEA 4U7HA 4J1TC 1K2VN 1JHPA 4FHGA 4NQRA 4I50F 5B6PA 4G0UA 4E46A 3PHHA 1NGSA 3ILSA 2EZ8A 1VLQA 4BNGA 1SBHA 1U63A 3M83A 4ZQHA 4ZYWA 2EBFX 3PNSA 2E9SA 3GFQA 4G26A 3T3EA 4D25A 3ED5A 5DNCA 3ITNA 1CR1A 1Z34A 3SZ3A 1FQOA 1RLMA 2I7DA 3SZGA 5BSWA 3C7KA 2A6PA 2ZFUA 3FBWA 1MJFA 1V71A 1ZK0A 1OIWA 2YW2A 4Y6RA 2XF2A 4RYDA 5C34B 3SHFA 3UGQA 3QWFA 1CUIA 4LK3A 5K8CA 2HPHA 2AH5A 5A3VA 3RLFA 1SXGA 3GL9A 2WHPB 3QNMA 3LLMA 3M6FA 5JAUA 3R2JA 4EI9A 4PC2A 3N8GA 4I4TA 1FXUA 2XB9A 3DD1A 4HX2A 2Z4RA 4UNIA 1ULZA 4WNIA 1XZKA 4WL0A 2P6OA 1UK8A 2D8MA 4RD4A 5AJTA 2X7JA 5CLFA 2CK3A 1C1HA 4WCFA 4L75A 4UMVA 3CSDA 2IZOA 2MINA 3W4JA 3H5OA 2P41A 1HA3A 5H70A 4N76A 2WYHA 5CIYA 1K8RA 5A4IS 1L3IA 1QYWA 1O95C 2Q6OA 2BW0A 2GLTA 1EVJA 4YJHB 1K7CA 3TR5A 1IQPA 1CETA 1DJQA 4RHCA 1NLUA 2JKZA 3OCXA 2QUZA 4RIHA 1E98A 4OXKA 4GP6A 4B6QA 1FCJA 3SF8B 1IL0A 3MS4A 2GPTA 5CYGA 3D7SA 1D7OA 4FCVA 5IJ9B 4RHTA 1EDDA 4JB2A 2ADMA 2POQX 3OI7A 4FONA 1ZN8A 2VSNA 4ZGWA 4P3OA 3CX8A 5K8IA 5CB4A 2WNHA 4E07A 1I5OA 2BMJA 4REQA 5DX1A 3G8CA 4AY5A 2JFZA 5IZCA 4C0WA 4KGVA 1WSDA 2X4LA 3CH6A 1AOXA 4RGBA 1RRFA 2VJLA 4GC9A 3V46A 4YCSA 2EKLA 2MDTA 1E1LA 3NBQA 5DF1A 2IBTA 2V0GA 2XXAB 3I3OA 3HB5X 4MZDA 3AM5A 4X6LA 3ZGOA 2ZSAA 1HE3A 2P75A 1Q7GA 2P78A 4L0QA 5D5PA 5ERGB 3VR3D 1YS9A 4F04A 1VM6A 3QTTA 2BH9A 3TQIA 1IVYA 3IP7A 4MYUA 1PD0A 1U5AA 3BMXA 4G37A 3MG9A 4IZIA 2GHQA 2QMQA 4MWDA 3SGLA 2A9FA 1X7DA 2MYPA 3HADA 1JQ3A 4R3NA 4ZC8A 3SYTA 2BAGA 3MTJA 3N2EA 5FUVA 3D3QA 3FXAA 5AUNB 3THRA 1CUCA 2DY1A 3KEGA 4MVJP 3HJUA 3P2IA 5CT8A 5K8LA 2Q6IA 2UUCB 2IXTA 1T5LA 2VHWA 4NXNB 1LI5A 3PGLA 4UNNA 4UU1A 1DX4A 1FS4A 2ECQA 2DLNA 3IMKA 4LI3X 4QNMA 3P52A 3D8BA 2DCMA 1JEAA 3LUAA 3KR1A 3QQPA 4GECA 3SBXA 4D3FA 1NATA 4K6OA 5HUJA 4J0CA 5AVJA 3MERA 5G1OA 3S2FA 2KX7A 3H9QA 4X7PA 4WBNB 1G2IA 3SEQA 1DC3A 5AVOA 1NX6A 2JGNA 2RE8A 5DTJA 1RLTA 5GJWC 3OPYA 2EYQA 3D64A 5FX2A 1DAOA 3QSYA 3A6DA 5KNCA 5J5AA 3R24A 1FNMA 1USKA 2ZJ7A 2DR2A 4OG2A 4LYFA 5IYZF 1UBCA 1GCIA 4WN9B 1QB7A 4EI7A 5KZMB 3EF3A 4EKNB 2GUGA 1C9DB 1IIBA 2B3TA 2CJYA 2IYSA 2XYHA 4J4TA 4EJ2A 5JNUA 3TW0A 5SZHB 4D0GA 4JR2A 3NZEA 5AM2A 3Q1LA 4RZ2A 4RW0A 1GZ7A 5DK4A 1JFSA 3G0OA 4OXYA 5DBHX 2FXVA 1QB8A 3ZBUA 4RCVA 1JLLB 2FI1A 4I46A 4A2WA 1XD9A 4C78A 5KYNA 2BEWA 2D7JA 4MI3A 4Q7JB 1JZSA 3KJGA 3L0BA 3R0IA 4B44A 4YFYA 2X2OA 2ZUTA 2NUTB 2ZJ6A 1WXGA 3UK7A 4A10A 4LDZA 1QIKA 1TU3A 5H3LA 2ZM5A 2ZAOA 3BSSA 3HKCB 3VNVA 2DHCA 1OV4A 1GWNA 2I2AA 2I3ZA 3NYQA 1OBVA 4TQ9A 2X4DA 5AICA 2WD7B 2EFJA 4P32A 1Y42X 5I8WA 3VUEA 2PRZA 2CNKA 5DGDA 1R6XA 3V8RA 3UOWA 4C2AA 1EGMB 1YTLA 1UFQA 3AILA 3SEFA 1Y1KE 3KTAB 3O91A 2J4FA 1TECE 3CCFA 2B20A 2HF7A 4QUGA 3LK6A 2Z04A 4OKIA 3UJAA 1SQFA 4FNMA 4TTPA 4R9RA 1JNXX 2BM1A 5DYIA 3WYCA 1CX9B 4MPRA 4AKIA 1EWVA 4EY5A 2JIZA 1GNQA 2XUQA 3AEYA 4UDXX 2HJWA 2ZJ8A 3K0AA 3VSAA 1GARA 3SIWA 1HQYE 3VI3B 4HLUA 2IOFA 3VXKA 5AI9A 4MKZA 1QWSA 1IUOA 3PEYA 4B7UA 4ZVNA 1C4KA 5CFNA 5IHPA 4TKVB 5KVSA 2ZUCA 4KOEC 1H2FA 3UXYA 2CNDA 2JLUA 1BW9B 2WWGA 2XBLA 3FSJX 2V8BA 4X20B 3U62A 4QYMA 3HJBA 1AD2A 3OJOA 3P2JA 3IP5A 3PHBE 5TPZA 3HWWA 5CPBA 3QVSA 1ESEA 4HQRA 4JEUA 2R7MA 4XEHA 4KO3S 3U3MA 2JFPA 5J4KA 1KH1A 1NC3A 4XJTA 5CHYA 2IELA 2QMEA 2WIGA 3L7YA 3V4LA 4J75A 1H2YA 4UPVA 3I9LA 2QM3A 3PQ2A 4MMZB 1A0OA 2H1FA 2QM7A 2VTDA 4O02B 4OHCA 3CUVA 3OIUA 5CPFA 2FSVC 3RC9A 3AUKA 3TB6A 4BNHA 2O0LA 5AK0A 1T8YA 3IDFA 5AXDA 4HZGA 4QHYA 4KU4A 5BNZA 5AK5A 4KP7A 5LR6A 2AOUA 3A9TA 5K0ZA 3AF0A 3ABZA 4DREA 3DTYA 5FPPA 4ZVQA 1GRRA 5FLEX 3SCZA 2P4EA 2ZWIA 3FMFA 1BVYF 1XKQA 4NICA 3KQWA 2VQDA 1OBOA 1S3GA 1IWBB 1CY1A 2VDRB 3D1LA 4IX1A 2I2DA 1O95D 2VH2A 3IIIA 4AKSA 1K8YB 2GBCA 3K31A 3SK0A 2WV7A 2Q8NA 4E2ZA 2ZSJA 1B8VA 3G49A 1VJ1A 1G9SA 1NPTO 3D7MA 1DSSG 1QIGA 3IBCA 4N5NA 4B3SB 2XDQB 5JS8A 2GK4A 2X6TA 4RVSA 3LA8A 1XK6A 3IS3A 1OHHD 3QJYA 1LQ2A 1VGRA 1TJPB 3GLQA 3L8GA 3ELWA 4RHFA 2ZAYA 3PXGA 1Y8CA 1ZJ6A 3VMMA 4O3FA 4D0NA 1NNSA 2BMAA 2WMDA 3EASA 3R6WA 4WW0A 1IRXA 4ZIRB 1M2OA 3OU6A 4R8LA 1G7TA 1PSWA 4IINA 3ZDRA 3DMNA 3NHKA 1MG5A 1ULBA 1VE6A 1JMVA 5F1OA 3ROPA 2IYZA 3ZJTA 2AJBA 4CMBA 3GRAA 4E7PA 4K6HA 1KBOA 1LRKA 4FTWA 1XWIA 4L4SA 5KJ1A 4Q3NA 1CNEA 5BSVA 4KUHA 2QTBA 3DOCA 2YICA 2CMFA 3MCTA 4PN3A 1IZ7A 4OO3A 3UFXB 2EX0A 4DIMA 2I7VA 3AFNA 1A88A 4J9VA 4CKWB 4DR4B 3OM1A 4L0DA 5T4BA 4O1IA 5JFTA 2JIQA 3R9WA 3L1JA 4HYTA 4FJ2A 4U2GA 3GN1A 3VV2A 2O7VA 3VM6A 4BB0A 1DEXA 1Z6GA 4JUCA 1T9AA 2KYRA 4R98A 2VQEB 2H1WA 5B64A 1JHAA 3F9CA 1NBHA 3KSAC 5CGQB 5FULA 2B61A 2WHEA 2G9VA 1WDTA 2C07A 5REQA 5GONB 1T0IA 2C5SA 4AULA 1G7CA 1KY3A 2IBMA 1B16A 3MJSA 1WOMA 4JAVC 4WN9A 4NENB 5JVDB 1YMQA 3KZOA 3ZQJA 3VKWA 1T2FA 5ULLA 2G83A 1C3LA 1G60A 4O2AB 5A62A 3DYVA 4M7PA 1YZVA 2GCEA 2QW1A 2Z3VA 4P4UA 2PD3A 3ZGNA 3ZCRA 5JADA 1Q92A 3LX4A 2RHJA 1S2MA 2LDBA 2PSDA 3O95A 3C7AA 4L07A 4ZARA 2ODQA 3P71T 4CU5A 1CR2A 5F3RA 3WV5A 1VSQA 3JALB 5A5DA 3SVTA 1NQVA 1RYBA 4P7BA 2JH3A 2PMDA 1MG0A 3KEMA 4QGBA 3ZV3A 1V8OA 2PZLA 3NCTA 4B3TB 2X58A 3Q5GA 2FA9A 3VYWA 5BV8A 4LTMA 4JK3A 3QEMB 4NBVA 5LQAA 3NOQA 1FP1D 1ECCA 3K6SB 1SA0A 4Q3KA 4A0QA 2ZYRA 1NMYA 4HLQB 1EMDA 2LV8A 1UZNA 3ROEA 2OMEA 2QM0A 4DLUA 4PINA 5LQSA 3ZGVA 2H5IA 2FP4A 1GAWA 4A2QA 2HYDA 2ZS8A 4XUGB 4HFJA 4CLOB 2ONZA 5LMZA 1UWCA 3AL3A 4Q9LA 4EO7A 2ZQ5A 3RFTA 2EJTA 4DF3A 5JASA 2FG6C 2BFBB 1V7ZA 5FPKA 4DMMA 1MB3A 4QE3A 5E9QA 2NADA 4IDDA 5HIJA 5I7AA 1GPUA 3O8RA 2J3EA 3KVOA 3QIVA 2WZDA 3E15A 1XLVA 3Q85A 1MVNA 2WWHA 4Q48A 1WV0A 3ZDXB 5KMGA 4Z4EA 1ISHA 1EP9A 3G9ZA 3GPBA 2OVBA 1ULSA 3PCRB 4TPKA 5DCWA 3FZNA 3H17A 1GUFA 4F12A 5LYJF 5CVDA 1DOHA 2JEOA 2ZK7A 3UMGA 4BU1A 2PL1A 3FI0A 3M1IA 4PWYA 3AP1A 4TYWA 2IPAB 5LOVA 2AHRA 4V2IA 2CLMB 3T1QA 1RKBA 2G17A 3QP9A 4PBRA 1YE8A 1BFKA 1KEUA 2CE7A 4OAQA 1BCRB 2CUNA 3DNMA 1JKIA 3AHJA 3PDUA 2VPWA 3TO5A 3T0GA 4A3SA 3GJSA 2EL9A 4JZYA 4ADSG 4FCTA 1G21E 4BNZA 2P9JA 3AI2A 3K05A 3OLQA 1C7ZA 1JHMA 4WH0A 5AK6A 3RSFA 5FPQA 3IPLA 3ASZA 1L5OA 2BM0A 1XZJA 2DUJA 2VH1A 2XCLA 2VTBB 4LJRA 1NW8A 4G9GA 1MDBA 2XRZA 1Y48E 1RZ3A 1SXJC 4FFOA 2QF7A 4MWOA 8LDHA 1FW6A 3RFXA 2C42A 3PL5A 1PV4A 2HPVA 1DADA 1GGJA 1RBYA 1WHSA 3LVQE 4UARA 5H81A 3L8ZA 4Y9DA 3RTEA 1V2HE 4MGZR 3P26A 4Y98A 2ZE5A 2I6FA 2YRFA 1RXCA 5C4IA 2XZOA 1PNRA 3JVUA 3U7FB 2HCTA 3HGMA 1KI7A 3OZUA 4RLQA 1HTBA 3QUSA 4RORA 3WYDA 2W2OA 3ZWKA 1U2RA 1L6IA 2WTAA 2H2WA 3SIXA 3HKDB 5A03A 1PZHA 4D9EA 1T3TA 4BNKA 2BFFB 1NW4A 2D4HA 1ZJJA 1ZQ9A 4K9KA 3ESDA 4LYHA 2RIRA 3D5EA 1TA4A 1L3BA 1T8WA 1IM5A 3VDNB 3ZGXA 3B1WA 4HTFB 3VDQA 3BDVA 5DYTA 1HYHA 2A5DA 4S2UA 5EWMB 2CJWB 3R8XA 2FW7A 4XGRA 1Y3DE 2OCIA 5CMLA 2P3SA 1J0CA 2DT8A 3JD2A 3UQYS 4IH9A 1GUZA 5CVUA 4RHUA 4YQFA 4B5LA 1K0FA 3AIOA 4OHBA 3L7MA 1Q1GA 2CXNA 2XMGA 1EQ2A 5IJAA 4PCUA 4W8HA 5CT4A 5KOHB 5AVXA 2JFFA 4D5GA 4NCAA 2V3WA 3NNNA 2HGZA 3LKZA 1QUFA 4D6XA 1UWLA 3AKYA 1MBZA 4FW9A 4KTTE 5HKOA 1I94B 4L9RA 3F5QA 1JAYA 1DIOB 2W48A 2XWJI 4WXYB 2O0JA 2VBIA 3FWPA 2ISSD 3U3XA 1LJUA 3CRZA 3OJLA 3V2HA 3NHAA 4X1YA 1XD2A 2YY7A 1S96A 4MITA 1Y37A 1V26A 2XQFA 4EJSC 3AFGA 4LG1A 4MPDA 2ZVDA 2PVCA 3KYJB 1QH8B 2YWRA 3IO3A 2JDID 3ROTA 4FFNA 2YV4A 5BT8A 3GUUA 4GLJA 3PJDA 4F91B 1YRAA 2GCOB 1A8PA 5DHFA 5E1OA 1THTA 3K16A 1J06A 1OASA 1OCEA 3EDYA 2XWBF 4N49A 1LPBB 3GT7A 5DCUA 2YXLA 2BZ0A 3OLZA 5EIBC 1R4MB 4M46A 4TXLA 3WL3A 1G59A 2HO4A 3KWLA 1LPMA 5DPMA 5A4AA 1Z0UA 4S0XA 2BCGY 5DWVA 2JATA 4N3BA 1GFWA 2I1LA 5AW0A 1FFSA 1CZUA 4L8YA 1R64A 2B8JA 3R7WB 3H04A 3CTPA 3RS8A 1Y4SA 3ADDA 4KXQA 3QXCA 3UMFA 1RI2A 3TVDA 5DSXA 5AW5A 1ZAYA 3D3KA 2E5LB 4KJXA 1JSCA 1RJFA 1JJIA 2HDNB 4OCZA 1YQWA 3DQQA 3IEMA 3B5JA 1BS2A 2RAPA 2XX3A 3SS8A 2HQOA 4AKHA 2JFVA 1ZRSA 4UHFA 5C51B 2A9QA 2R8YA 3PUYA 1C30B 4IGFA 4N18A 1DAGA 3GLHB 3ZZ1A 4EHAA 4MLZA 3EDRA 4O63O 4I8IA 1ZJWA 3TKYA 2X19A 5AVWA 3OCJA 5IBRA 3SEAA 2REBA 3T5GA 2I1QA 1FMFA 1N0IA 2R86A 4UD2A 3KPYA 1JYEA 4BP1A 2PIDA 4Q9IA 3DS8A 4TXMA 4IIGA 1Q6YA 5IUKC 1Q91A 5KVCA 4YAFA 4A6DA 3L6OO 3H65A 4LMBA 4KIWA 1ADGA 3K15A 5K6AA 3CLHA 3CPEA 1IBRA 1MC5A 5GVSA 4NX2A 2AOWA 1SVLA 3RF7A 1ZX1A 3DVRX 1N5LA 2PRYA 3DTVA 3OEYA 4C5BA 2J7PD 4R51A 3UV3A 2VN8A 3Q72A 1D8AA 3MMSA 1T5BA 1W7AA 1IK4A 1W5TA 1T34A 3FY4A 3W6UA 1RHJA 6REQA 3GLIE 4ZAZA 1ZCBA 2VXBA 4FN4A 3KJQA 2VJMB 2B1GA 1LKZA 5ALLA 5KSWB 1ISJA 4PZYA 2I3AA 1RAFA 2I4RA 2NXEA 3A4TA 2A7XA 5KYXB 3TZ6A 2A0WA 1LEHA 3DFUA 3C41J 4MUNA 1SXHA 4L5IA 3VR6D 3GFBA 4IOKA 4LCBA 2BFCB 2RG1A 4QT0A 2PUGA 1W35A 4XYMA 1RRPA 4BX3A 3CLRD 3UG7A 2A14A 2JGIA 3FFBA 5BW6B 3ZHYA 4ESOA 2G8LA 4G6ZA 2IHBA 4C43A 1OWPA 2NT3A 3NKFA 2R6HA 2C1XA 3MLAA 3NT4A 1C0KA 3JSAA 1DAIA 5ALFA 5EPUA 3TRJA 1QGED 4B3XA 1JDNA 1GTZA 3UAYA 4E3ZA 4EENA 3OQ6A 1E1NA 1PT8A 2C9OA 4PZZA 1RAIA 4RC9A 3I64A 1Z2NX 1I6KA 1IB0A 3JQFA 4L4XA 2O2DA 1XEXA 2BHLA 3G9XA 3PB3A 5ER9A 3T7JA 3CZ5A 5L3QB 2C3UA 1ZONA 4ZEOA 4BO1A 1K3TA 3ICVA 3R6DA 3GU3A 3Q3JB 5I7RA 4OQDA 5BWMA 5JZSA 1L4MA 3BXFA 5DJ5A 4QO8A 1RQRA 3IDZA 2YV3A 3L5OA 1KTVA 1RZRD 1JKXA 1I7QB 3SHOA 4ZI7B 1T3SA 4C0QC 5GADl 2QRJA 2WFLA 2JA1A 5B4UA 4UBIA 2QLLA 3ICWA 2G80A 4RH1A 5A5VA 1FA9A 1VMEA 1DC6A 3OX3A 4LXTA 5F76A 4B73A 1QE5A 5EWLA 2QTNA 5D84A 4GC5A 4E6PA 2I7TA 3CJTA 2ISCA 1IXRC 2O7SA 2QXYA 1JQLB 1KERA 2YHBA 3K2BA 5LWQA 4JYAB 4MGEA 2Q2OA 3BB1A 3C4VA 1AKUA 3QE0A 3VZSA 2FN7A 1Z17A 2AQ8A 3KR9A 2QTFA 1KO1A 4OI1A 1XNQB 2ODNA 1X39A 2X7HA 2RJ3A 2A0FA 4MW7A 1FVXA 4XVUA 5I5GA 1FEZA 3IQZA 1H05A 1NN1A 4FGZA 2DOKA 3Q6NA 2OD2A 2Q6LA 5TQ0A 3ZHQA 4X6XA 4C05A 1IONA 1V8FA 3PC8A 5TPWB 3I6ZA 1UC9A 2R7KA 2BMWA 2XKJE 3JYOA 3HWRA 1YHNA 4MVJF 4DW8A 3OT1A 2P4UA 4ETWA 1UFOA 4TVSA 5EMLA 4B8WA 4C01A 1Y8AA 2EHDA 1G6HA 3RARA 4EVRA 5K8TA 1SUWA 2DH5A 3K9BA 1PQPA 4YRMA 1YQTA 4QNRA 4E2XA 3U3RA 1MVOA 4MVJG 1I8TA 3IEXA 3S2SA 5IARA 4V0ME 1SK9A 3O83A 5KTKA 5ILOA 1GYPA 1VRWA 1XXHB 5YASA 5J47A 2BI7A 2IYNA 4WOKA 2GTHA 1Q3KA 1YDMA 2P90A 5EYPB 4WV3A 4MA4A 4W1PA 2DKFA 3DEYX 4NFYA 5BN4B 3SXJA 3F1KA 2HCRA 1A8UA 3UGKA 4QKQA 5KJEA 1OI4A 2O8VA 4LSZA 3DMPA 2PMKA 2C31A 3CANA 3OP1A 2BCEA 2HXGA 4LJ4A 4I3HA 3EPJA 3W6NA 3D8RA 5U9CA 2QJWA 3H19A 3QVLA 3ENVA 2ZSHA 2HC9A 2C4TA 4L1KA 3ZVLA 4ZHQF 5CYOA 4C7JA 1IOWA 5A9SB 1WXWA 2JVJA 2Y1DA 1CY0A 1QG0A 1SC1A 1XZQA 4MINA 1WTAA 2O06A 4R2KA 4KWTA 5HF5A 3SF0A 4R8SA 3GLHA 3OT4A 3UJCA 4BBJA 1FJXA 4OX9Y 3FVQA 1NKVA 4AC9A 1PSZA 3GRFA 3CIFA 4JSYA 1RWPA 4DV1B 1G17A 2X14A 3B7PA 2IS1A 3WLTA 1M67A 3UICA 2V6GA 1CF2O 1I1OA 1MGPA 2J0EA 2CHUA 4LDAA 4LDQA 4RVNA 4FKBA 1D2AA 3KUXA 3EGDA 1FSFA 1N6NA 3WI7A 2VDLB 3CEJA 4Q9AA 3KHSA 4BMCA 1ZQ1A 4NBKA 1JR2A 2ZB7A 1NUAA 4ZTZB 3SR0A 4IF4A 2JHGA 1TA0A 1W29A 3I4FA 3USCS 3NAMA 2P11A 3ANXA 3PLAE 3I4CA 3AOGA 3ROGA 4ND7A 2AJDA 2QRGA 1TCBA 4IICA 3U17A 3KEQA 4C0JA 1ZM4A 4GQBA 4PW0A 4XOUA 3RS4A 1WSAA 5ALQA 2Z2KA 3WIUA 2D5CA 2O1XA 4HWPA 2XMQA 2CF6A 2YQ5A 1U2PA 3E81A 3JZAA 2FDRA 2V45A 3TD6A 4Q9KA 1SRRA 4IY1A 1DG1G 2WU1A 4XWWA 4G1VA 1H6CA 2HTFA 4FB5A 2C0PA 4DPLA 3AVVA 4E3WA 3O94A 2INGX 2Y9MB 4UU8A 4Z9AA 4AP9A 4ZPXA 1ZIXA 2VNHA 3GFGA 3MJFA 3JAWA 1T9HA 4MAMA 3BB4A 3WMGA 3KZKA 2ZIXB 2H4FA 5DNWA 2M6LA 3G0GA 4RNDB 2CUZA 3OE4A 1T2EA 4AJOA 3E2IA 1SU4A 4RIIA 3LA6A 2CMDA 1P1JA 1EDOA 4PAQA 1DCKA 4DN6A 3TCKA 2CWDA 1N2CB 1W5BA 1L4FA 1GT6A 4Q0MA 3T6KA 1UOPA 3ADKA 3BQMB 3OC0A 1E79D 4N1AA 3GUCA 1VBFA 3GROA 3P2OA 4ZDWA 1BX0A 4PTYA 3GBPA 2H4WA 5JLAA 1Z6PA 1YDHA 1E2PA 1XF1A 3FCXA 3FGNA 3RIMA 2R0QC 3CGGA 1M6VB 3ZV7A 1FW8A 1VZ3A 3BK1A 2XUJA 3HUEA 2OHJA 3OZRA 2GMWA 2E6KA 1VCNA 2IOFK 4DIKA 4JVLA 4EOGA 2XYVA 4XYLA 3A6LA 4GRIA 1IPEA 4EEKA 1CEEA 2C2KA 2J6IA 3S99A 2BSAA 3RSCA 3KV3O 4AM8A 5BUCA 2ZYSA 3DP7A 1HK7A 3DVAA 1I2CA 1Z4QA 2FETA 4RE5A 1HYEA 2C4UA 4G25A 4BO2A 2PMBA 4L3OA 5FJJA 3TL2A 3U44B 4Y2XA 1IJKA 3DFZA 3QUBA 1PK9A 1F3LA 3HMKA 3N2GA 2OB1A 1JIJA 2F67A 4RZXA 1KO7A 3D8TA 3KLBA 4FMCB 2FWRA 4D9IA 2VDMB 4G8CA 2HADA 3DE5X 1U7DA 3MA0A 3AF6A 3ZE9A 2UUOA 2G8NA 4QOHA 4BMDA 3T5MA 2P2DA 1U3TA 2O8FB 1SAYA 1TEZA 3PEVA 1KZYC 4WPGA 3ZW9A 3LNCA 4GT1A 5HSGA 3D5QA 3V2GA 1X42A 1ODFA 5TGZA 3KB6A 3R5KA 3UMJA 1KDTA 4MARA 1N6PA 2QN8A 1XEAA 1I3KA 1ZY2A 4BFTA 2TS1A 5IJ0A 4EY4A 3PQ3A 1KJNA 2OORC 1SKQA 1ZM3A 3X1MA 2AX4A 2VAXA 4DDVA 3AV3A 1AK1A 1OZHA 1VCIA 4EX7A 3DXXA 1EX9A 2FSIA 1W5EA 2NZUG 3OAAA 1QFYA 3PP8A 3LLSA 4JEMA 5FL7D 1YUMA 2HREA 1BOFA 1PZGA 2AW3A 4OHWA 2OV3A 1OX5A 4PLWA 8MHTA 4HKTA 1OROA 3B5EA 1M6EX 1Z26A 1RWQA 4XM1A 5BVGB 3DAPA 2QM8A 4LHVA 2ZZMA 3AVTA 1U8TA 3M82A 5JAMA 2FQ1A 2ZTLA 3EG9B 1AO0A 1ZVMA 1FYEA 2VSOA 2IXDA 5BMVB 2B5OA 1PG2A 3OPVA 3S81A 2V7VA 3K1TA 1PW7A 3CLSC 4KXMA 1HE1C 3U37A 2C78A 3QU7A 1I3NA 4Q15A 1NA5A 1VKOA 5IVIA 3SVLA 1AIPA 1LSUA 1KHHA 2WJ3A 2WWXA 4U0JA 4ZWNA 4TLDA 4GMFA 1R0CA 4OJKA 1AMUA 3HV0A 3LOQA 2FZEA 3FCSB 2QPTA 5KX5F 1CY6A 2F7SA 4HRVA 1LA2A 2B2NA 5J2UF 1ZOLA 1N0WA 1OFTA 1U1DA 3QVJA 1O8CA 1V9CA 2REQB 4I9HA 2AN4A 4IQGA 1ZD1A 3WLPA 5DW3A 4F2HA 1N6RA 2FMKA 4FFSA 4MQFA 4DGQA 3ZNQA 1H2EA 3U1BA 1Y1QA 3C8ZA 4UQOA 4HDSA 4BNMA 3T7EA 1LF5A 3N8HA 5BSHA 4LV6A 2LCIA 4C06A 3LQ2A 1WX1A 4JXXA 4QUHA 5T41A 3TOXA 1XR3A 4IDOA 4KQJA 5G1NA 4Q6BA 3O8BA 2G4CA 2C9MA 1WQ3A 1W88B 4CIYA 1K9VF 1YXMA 4QU5A 2L0XA 2VI5A 1IXYA 1DJNA 3B9BA 4PNEA 2UZ1B 3PGMA 1KSHA 4O2BF 2LPMA 1G55A 1U1CA 4BRZA 4TGLA 2PRSA 3CF4A 5CA0F 2CL0X 4Q24A 1Q7EA 1Z6XA 4I3FA 4BWVA 4BZPA 2FVYA 1IXSB 3KYDB 3WJAA 5A4JA 1Z29A 4OH7A 4X3OA 2AQKA 2AR9A 4WUTA 4B2IA 1PJ2A 3O73A 3LIPA 1C9EA 5FI0B 1Q20A 2PG3A 1OW3B 4K6MA 4QYWA 1R9MA 4JBGA 1EUDA 1A3CA 2IYWA 5K0TA 2H00A 4H15A 4QG7A 4ZV9A 3USZA 4ANFA 1RQ2A 2UZAA 1T9CA 1TF5A 2YN4A 1Z38A 4DADA 4HXGA 3M6IA 3OBIA 1RJGA 4J16A 3IPAA 1EZZA 1GCUA 2BP7A 1ZG3A 2R1TB 2YH2A 3L40A 4L5AA 4YAUA 1XAHA 2QHXA 1WCXA 2ZR7A 3EODA 5SYAA 2EKZA 3RVPA 5DW0A 3ZE7A 3U60B 1MNQA 4HSEA 4MW1A 3NDPA 1LH0A 1EFAA 3PPXA 3VBCA 1HLGA 1RM4A 2GK7A 1ZN9A 3DZ8A 1O08A 4BIIA 1XZFA 3OE5A 3RHTA 3L0DA 2PRJA 4F84A 2O5EA 4IUCS 3A6GA 4RXTA 2C84A 2WV9A 5AESA 1M2KA 4K9QA 3CVUA 4JI6B 2R1UA 4X1IB 2VK8A 1LPAB 2OXCA 4ASUD 2I2WA 2AE1A 2JGFA 2VXYA 4PSAA 2OYRA 2GEKA 3WRXA 3W5CA 3MBKA 5MN4A 3BIOA 1S02A 2P7HA 4HQFA 1Z5WA 1DIHA 2BBOA 5A02A 1U28A 4CTOA 4CUKA 1CLEA 5GVRA 1P0IA 3OMWA 4GH5A 3RFFA 1TQ6A 4NNOA 3GC6A 4BNXA 5AXCA 1CE8B 2OCYC 4AMYA 2IZ0A 1DB3A 1G9TA 3WYEA 4EUNA 2XGJA 4KHPB 2W98A 1Z0JA 1PJRA 2I2FA 3N8NA 4TM8A 1IBLB 5CK5A 5HJ2A 4RHEA 4Q9JA 4PVDA 1DQRA 3ZH2A 1Q0SA 2VCEA 4HNQA 1NW3A 3V00A 3QXHA 4NESA 3IR7A 1EHCA 5A6SA 1B23P 3UNXA 4AY2A 3PUXA 1ODTC 1WWKA 2TMDA 3K73O 3E9QA 4QRHA 2IUFA 3BL5A 5AHXA 1R0XA 1T43A 2YDYA 4OPMA 4CM8A 1P2FA 4ZJPA 3HN7A 4IBOA 2B78A 4P4SB 2ODPA 2HNBA 4NAVA 5DM0A 5A05A 1QVZA 3QLVC 4PTLA 3ZY6A 4PO1A 5FNVB 2VTEA 5FWNA 5EVCA 3KLOA 2ZIVB 5E4JA 2UUAB 5K3DA 2ZT8A 1P39A 2PMWB 5LWHA 3QFTA 4X64B 3Q7SA 1TKBA 1MDFA 3DMRA 3RRFA 3RAJA 3FIJA 1FRNA 1RI5A 3AR7A 1JB1A 2JHCA 4EYQA 4EZIA 4K9DA 3RM3A 4OYHA 1FPMA 4IS3A 2OO7A 2GRUA 1P4AA 3GV0A 4YRGA 3LAWA 3ZCQA 4BVBA 4FGUA 1W9MA 3G85A 1MX9A 3BF7A 1FFAA 5TQ2B 5IKXA 2DFNA 3U5TA 2W6MA 1Y89A 1NC1A 4NFHA 3A6ZA 2HIAA 3TZHA 4UVDA 3ACBA 5EFOA 3JSXA 3OZIA 3QLUA 2BGUA 3KB1A 2OQ2A 1HLDA 4EF5A 1MMFB 3TQCA 3DLPX 1S0UA 1VBMA 4K0RA 2DHEA 5KJ6A 2B5VA 4HYYA 3R0XA 1GITA 1UINA 4KN6A 5BQPA 3SR4A 4LX8A 4HLCA 6GPBA 4O5OA 3R3UA 3N70A 1AXGA 5CH5A 1V37A 2PGLA 3PC3A 1NAHA 1V6SA 5AKYA 2HRRA 2KPOA 1YONA 3E1GA 4JOQA 1LU9A 4M86A 1J22A 3N0VA 4IRXA 4F92B 2REQA 5AJZA 2O5VA 3H1AA 4P86A 3LWZA 1KR5A 4HG2A 4HH0A 4TZKA 2YJGA 3BH7A 3KAKA 5AP9A 1SVIA 1I01A 2ZRHA 3M2TA 2P7IA 5AOAA 4EG6A 3ER8A 5HIMA 3FBTA 2Q50A 2WA2A 3T3PB 3ZC3A 3N1UA 2VXCA 2CBZA 4OAPA 4C6TA 1S3FA 3LUDA 7AT1A 3W05A 1XX6A 5KNLA 1NVDA 3U13A 4JP8A 1M1YE 1PZEA 3FPKA 3E7DA 1W36C 3HCRA 3N75A 5GY7A 4R2JA 3Q98A 4M55A 5EPEA 2FWBA 3V1NA 5K01A 2P8JA 2Q3CA 3FTEA 2NSLA 4H0FA 4YTEA 3RYTC 3GEPA 2GD0A 3KKNA 1LTKA 2RK4A 4GXTA 5TMEA 1F0NA 2AWNA 3KCNA 3H11A 2WD9A 4PLGA 3T0FA 4D02A 9LDTA 1Q0ZA 3FE2A 4FSHA 4JGBA 2FX3A 5ENVA 5GJVC 1OBHA 1TFRA 3K9LA 1QGZA 4WBXC 1DIBA 1WJGA 4JU8A 3IAAA 3QVKA 4OD0A 1RR6A 1MJ5A 5JMTA 2KSQA 3K9QO 2FJUA 4M53A 4NU0A 5AO9A 5M5BA 1HG1A 4HL6A 3ITDA 1F8XA 1J1IA 4TOIA 2PEYA 1YZNA 1EFVA 5F21A 4KR9A 5CB6A 2WY2D 5IAEA 1I2DA 2QP3A 2YXBA 4JOCA 4Y18A 4KITB 1RXVA 1Y9JA 2HSWA 1YR9A 1S2NA 1MHPA 1YAJA 3B3AA 4R8RA 1ZUWA 1XCOA 4G8JA 4JLOA 1DAFA 5FYDA 4GM1A 3RGWS 4BLSA 3PE6A 4D98A 1X9HA 3BTOA 2QRPA 1QTRA 3GLUA 4JBHA 1DTWB 4URFA 2RARA 1L8XA 3DL4A 1AKEA 1DU4A 1F4LA 2JBWA 1FPQA 1II9A 3BGSA 4XGQA 5HCNA 5DNUA 1B15A 4GOKA 5AOCA 3EMBA 3WWOA 4C7VA 2QX7A 4EKGA 4JJKA 4B35A 4YCLA 1NVAA 4XFKA 5AVYA 2FWPA 1BHQ1 1S6YA 5FR2A 3STXA 5KU1A 3UJ9A 1ZSYA 4HEA1 2ZJ1A 3QI2A 1CUBA 2GRAA 2NZ8A 2PQ0A 2V7PA 3C7TA 3N87A 5GAJA 5HKAA 3KZVA 2DQYA 1O9GA 3FMOB 3LQFA 4UCXA 2ACEA 1J2YA 2VAPA 3IJPA 4F96A 5ADVA 3M9WA 4DLVA 4OK5A 3R7DA 2AN3A 3B20A 4XLZA 4HV4A 4LNUA 1I36A 5IP5A 3GLVA 2B6NA 3D6NB 4U02A 2O4CA 3TEFA 4ZVPA 2C7QA 2B1QA 5C4MA 1KAOA 3BEOA 3NLLA 5EC8A 4B40A 1HQKA 2JH8A 5C18A 3WKAA 3MWEA 1HC7A 4ZA2A 3DKPA 2FDCA 1T3ZA 2AI1A 4NBWA 4YMHA 2YJ6A 2ONCA 2X0NA 4UCWA 3O47A 1KWKA 4E13A 2O8BA 2OZKA 5ES4B 1T1GA 4O4JA 4KGXA 4G07A 1GA1A 4LOAA 4M98A 5ALIA 3SJCA 3ZDQA 2O7NA 3VR5A 2RJNA 3AZQA 2WIJA 3GCWA 3FFTA 4JL6A 3PV0A 2OHVA 2PKQO 4G0VA 3BH0A 5FOQA 1U9YA 2FPPB 3LH5A 2C8KA 1EX1A 3GH1A 2PNJA 3ZEAA 4QSMA 3OECA 4W8OA 2DECA 1NSYA 1T4CB 1UBNA 4TTVA 4MLCA 5DIZA 1CIJA 3NM6B 4DTCA 4YMWA 4R0MA 2UVPA 4QTTB 3KKEA 5AKLA 4O2BB 4CLEA 4DCJA 4IJMA 1PFQA 4IMIB 3S8MA 4Z4GA 4M0KA 5E9JA 2LIPA 4NU6A 2B99A 1MUUA 1AGYA 3PEFA 1EE9A 1TM1E 2GHRA 4AUEA 4XD2A 5DYNA 5CEEA 2HFKA 3AUAA 1NR5A 2EF1A 2XWQA 3BEDA 4R1MA 3QVGB 5DP2A 4CETA 1E3IA 5IDQA 1MN6A 3FPAA 1U1GA 1NNUA 3ZHOA 1K7YA 1NJGA 5BY2A 4AZ0B 2P9EA 4YAIA 4OGGA 4E5NA 2O19A 1TIPA 2PFGA 1DWQA 1OKKA 4OXIA 1PZMA 2I6QA 2ZUBA 1OMOA 2JKVA 1EM8B 1HDRA 2SKDA 4HDMB 4KQIA 4BKQA 3CCBA 4QT4A 3MK31 5AM5A 2YMMA 5DXAA 1BX3A 1F48A 1E7MA 5CDHA 3H1FA 3GLGA 4QYTA 3OF2A 3SEZA 3X1JA 2IOYA 4URUR 4RETA 1EGAA 4X60A 3DD5A 1X86B 4C4SA 4EK9A 3EWNA 5H8WA 2BGGA 4GI1A 3TQOA 3EXEB 4KLRA 1JQJC 2AXEA 2CZQA 4N39A 4YP0A 4KDRA 4F93B 2MSCB 2ZPUA 1FVHA 4RDXA 4LC0A 1GHTA 2X22A 2JJ1A 1TQ2A 3N2KB 4Y30A 2H2FA 2I71A 3F96A 3RSHA 4EHKA 4KLCA 1P1KA 3PEEA 3ORQA 2EKQA 2ZT6A 4LXUA 1U5CA 3K6RA 1PJLA 1K8ZB 3DR3A 2OSBA 3I3SR 3JD3A 1PJQA 1VLLA 1ORTA 3KXDA 3JRNA 3M4NA 4Z7QB 5KINB 3NNDA 2NTYC 1SKBA 3DXZA 1VL0A 1UJ5A 1WZNA 4RACA 4CYMA 4WTOA 3QPWA 1D6JA 1Q0QA 1Z18A 1SD1A 4IFBA 4K9OA 1YJBA 1RHMA 3P0IA 3PHJA 1HFEL 4KGZA 2PX3A 1KMHB 5CDSA 1U04A 1OXUA 4TMYA 3V48A 4DXAA 4BVFA 3V34A 1OZ0A 1VCOA 1Y8QA 3CLVA 3I8XA 3OG9A 3UPTA 2RHHA 4JJAA 2P1RA 9ATCA 1I0ZA 1P5FA 1U0GA 4IHAA 1CYDA 1EXMA 4G36A 5BUQA 4HNVA 2BY4A 3GWZA 3HM2A 4W7SA 4XQCA 4A4DA 5JC8A 1ZDMA 4TZ6A 2AVNA 1U4OA 1ZNYA 1BOOA 2XHZA 3RFVA 1YASA 4I8XA 3ZDEA 1OZAA 1PQWA 5DMHA 4S05A 1L1FA 2YV2A 1MIHA 1EEXB 2F8SA 4GX2A 2QT0A 4EG0A 4OEHA 2J3KA 4AKEA 3O7WA 1J33A 4G0NA 4Q9NA 3EGIA 4OJTA 2QG6A 3C1OA 2MYTA 2GN9A 1ZIPA 1O6GA 2DU8A 2RGUA 4G63A 4ZV7A 3FVTA 5BORA 4KFCA 1QBGA 1YC5A 3AJEA 3ZD9A 4QUBA 2ZZKA 3FX2A 3QELB 2WNIA 4X5OA 1CW2B 1D0IA 2C04A 3K1JA 2GFQA 5CCEA 1ACMA 2VKTA 1IXZA 3FGPA 1NTOA 3VJKA 3W34A 1QH1B 3HBMA 4YPOA 4FXOA 4XVHA 4F0JA 3OE7D 4L2IA 3TXYA 1EAYA 2BI8A 4G9EA 4V0QA 2Q07A 5FUXA 3TLGB 1YBVA 3D1JA 2BGTA 3QBJA 3V7YA 2B5WA 3EFOB 1XVUA 1NBME 2RC6A 2ZJZA 2RHMA 3Q87B 3TE6A 5FWYA 3ROZA 2QQGA 2DSNA 4PG7A 3N0TA 1TE2A 2VIIA 3QUTA 4KIFA 3BRCA 4J0DA 2KBFA 4P22A 5J1SB 1V8PA 2PCJA 3VTKA 4L7QA 1G41A 2GS9A 3GRPA 4QXAA 1PFYA 2CZCA 4C04A 4GRAA 4ARZA 4LGMA 2PZBA 2X8BA 3PD1A 3VC2A 4BQFA 1M2VB 1TK3A 2YBEA 1SUSA 3MTAA 4B47A 4Q7QA 1I4EB 1T1SA 1ULHA 1Y3IA 3P9PA 1BAPA 5JBIA 1WU7A 4YP7A 5P21A 2JGLA 5GIPE 1E0AA 3N6RA 1VJDA 3ICCA 3QVTA 4YV2A 2CVQA 4DUGD 5M04A 4Q39A 1PG0A 1GL6A 2Z2IA 1ONPA 1P1FA 4KQKA 3QU4A 5INTA 3SC6A 4UE2A 2VSFA 3VBEA 3DFMA 3H5WA 2OSVA 2J3MA 4HLUC 4NKRA 5ANRB 2UU9B 4OF4A 3W2GA 2GB4A 4NCHA 1FTSA 5I45A 3TPCA 5ELMA 1KGSA 1CQXA 2FG5A 1T4CA 1DHRA 4BEVA 3AHGA 2NX2A 4YUAA 2YFKA 3B8EA 4CM4B 4ZYTA 1ESNA 3A9SA 1BMFA 4INOA 1XHLA 4OJMX 2A9PA 1WVIA 2GVZC 3WIDA 3G9TA 3RRXA 2IEIA 5FOVA 1P3JA 2HHJA 1NQ5A 2R84A 5FUWA 2E6UX 4LI0A 1JHXA 5A0TA 1DL5A 1KAQA 3OJXA 1XROA 1G8AA 2ETVA 1R4NA 3AEUB 5BQ5A 2EFYA 2EBUA 1JHQA 3ELBA 1J0EA 3I76A 4GP9A 5L3ZA 1GCOA 5K3OA 2OV6A 5I51A 3GDHA 1Z16A 4RZSA 5JR3A 4BWFB 4UUPA 3KAPA 4YQEA 3GLFA 3PYXA 4OQYA 1BFDA 3OLYA 3SWWA 1CJKC 2B92A 3IJEB 5A6VA 1NXSA 5EKUA 2CK3D 1PFGA 4J29A 4IIDA 3EA0A 1A1VA 3QEKA 1H6AA 1US8A 2P9TA 1J8VA 5BRNA 1PJ4A 2VPXA 1A72A 1QYXA 2C3YA 1C5KA 2OXRA 3IIEA 3E0QA 4UHDA 1BD3A 4CKEB 4X62B 1NV9A 3GOQA 4O5AA 2NO1A 1PS8A 2V98A 2WTUA 1TMYA 1HNZB 1JXOA 2OCDA 3FUUA 3M8KA 3RG2A 1P9WA 1UR5A 3DCIA 1JVNA 1G8MA 2BONA 2GKSA 1FFCA 1R0ZA 3R7NA 4KG7A 1B3BA 2Z5FA 1EHYA 3DBHA 4XR4A 2NV0A 1P5HA 3EQ2A 4OXRA 3LWNA 4BLOA 3KZNA 1NVVR 2I4NA 1NONA 1C1XA 5D86A 3QITA 1UODA 3KS9A 4IXMA 4BNIA 3OT5A 1G8YA 3C1AA 5LBUA 5H16A 4WUVA 1ZGBA 3SAJA 4F9GA 1JI3A 1JWLA 4MVCA 1EP2B 6ABPA 4H0CA 3OZDA 1IJEA 2QRQA 5FNZA 3OOSA 3TSYA 1P62B 1JKFA 3QLJA 5E6RB 5BUSA 1HE5A 3E3AA 4RFSB 5T8KA 4JP2A 3A3KA 1KI9A 1C3OB 2BGJA 4KMRA 5IULC 2ZB4A 4WY5A 5JECA 4NZMA 3VZCA 5F7XA 1JEYB 5LSAA 1P2UA 1H1LB 4B4UA 3CR8A 3KSZO 4UCQA 3I0MA 5HF8A 3U3JA 5EJ4A 2IH4A 1TZCA 2LW7A 2P4QA 3FYHA 4JT9A 4TLBA 1M8FA 2OCXA 2QVBA 4XRRA 3KOXA 2QROA 3K70D 4GPTA 3GGDA 1Y6QA 4KRYA 3ID6C 2WAMA 3E5NA 4IZHA 1TCCA 1YFKA 2G82A 2VYVA 4V1CA 4R1TA 5EE3A 1F3OA 1M0WA 2BDTA 2PAAA 2HB6A 3MWFA 5JD3A 3WWYA 3CYFA 4OQMA 1L7XA 4X84A 1PR4A 2CJPA 1H0KA 2HK8A 1T9ZA 4HH4A 2WQ7A 4JJFA 5L45A 3L6UA 4IJVA 4AF8A 1QIFA 3DQPA 421PA 3PHLA 1JDPA 2FPGB 3R74A 1GU1A 1KORA 3AUFA 5KNCD 3QEAZ 1AHHA 4CV3A 4X65B 1IE3A 4G4JA 4CE6A 5KTSA 1VG9B 3OFNA 3V33A 2AMJA 1QIEA 1M34E 3E9NA 4MS1A 4G86A 4EP1A 4JUIA 4UMFA 3R3XA 5ALTA 3AW8A 3KVNA 3SSMA 1YDGA 3L84A 3ANSA 2OGUA 3E9EA 4RA9B 5IH7A 3LW8A 4FFVA 2RC5A 4P5EA 3MT8A 2J30A 2EYUA 3FCEA 3RS3A 3IVCA 1LWNA 3I37X 3IBYA 4A0SA 3LQYA 2HN9A 4Q1AA 3LHKA 1JAHA 4DM4A 3SP1A 1CF9A 3DZFA 5HQ3A 2GEUA 3WKCA 3A1NA 1EUCB 3PVZA 4I14A 4RVFA 4D8XA 1M5RA 1T0PA 4UM8B 1F12A 4UREA 5CXXA 3WLMA 1CUWA 4M0MA 4X44A 2ZAMA 3KQSA 5THQA 2OLKA 1ID1A 4NMWA 5SZKB 1KK3A 1XTQA 1NHGA 5KKNB 3SICE 3NKVA 2OGSA 3GRYA 4KQ1A 1FIUA 3NIFB 2GBIA 2VQFB 1NVEA 1Z28A 2FW8A 4QXOA 4DR5B 3O92A 4MDFA 5JC1A 2PM8A 4IHJA 1U3UA 4XDYA 4ZZ3A 3LCMA 3MUEA 3IAEA 4OXQA 4X8OA 2C54A 4MZXA 5JZBA 1RXSA 5EIXA 3ZWWA 5JYEA 2E0IA 2VYND 3KZCA 4G4SO 4QJIA 5IZ4A 1H5NA 2DGDA 4BFXA 3B1YA 3CEPB 4RS3A 4WSOA 4ZVTA 3HYSA 1M66A 2ERCA 5FAXA 3KWFA 2HMTA 3CS3A 4MVJH 4QUIA 1D7AA 2UXCB 1XA0A 5DE3A 1Z0DA 3LC0A 5FQNA 4BFSA 1USWA 1BU8A 1GR0A 2GDJA 1DLIA 1L9KA 1Q1EA 1X80B 3HM9A 2CDAA 2D1RA 3PEUA 1VPWA 1BVHA 3PFWO 4K9LA 4WOJA 2GK6A 3ZY5A 5AH0A 2ID4A 1REQB 1F9EA 1CEXA 2BF7A 2XMCA 3K0EA 3LWDA 3OCUA 3PGVA 4JLBA 1ANKA 1H94A 3X1XA 2Z3WA 3ETCA 1G7RA 1TGVA 3P5SA 4U2EA 1L5GB 4BNLA 4Z6KA 5TPZD 1JQDA 2WLTA 3IUPA 3ISVA 5DYGA 5LBTA 4RPCA 3HCFA 1G6KA 3R7FA 1S2DA 3WGHA 2FQWA 1WEKA 3AHFA 4ZC1A 3MOSA 2WFZA 4DIEA 2F43A 1HKUA 2PQMA 1QIIA 2JI9A 3OU7A 2BFNA 3JWJA 1RI1A 1W4LA 1FNBA 4UASA 1A9XA 3ZDAA 2GPSA 4RHYA 2EGUA 3P2YA 3A1WA 2P5YA 5EJEA 1MP0A 4LSWA 3H83A 3KT3A 2O48X 4CT5A 3B85A 4D0RA 4MWCA 3WYFA 1IY1A 3LWBA 2POCA 3DDSA 1U8EA 1GAJA 3AUUA 3BSYA 3EJWA 4L9SA 3BWVA 2QLFA 3FR7A 4AVYA 3VNBA 5JNTA 3PTAA 4P98A 1BXGA 2QJFA 4Y2UA 4KEAA 3TZLA 1WDMA 2JVIA 4YACA 1NMQA 1P6UA 2JA2A 2PKEA 3KT8A 2X5NA 2AJ8A 2CD7A 2YXDA 2FPWA 4HDRB 4HPWA 4LV5B 4MW9A 5E9WA 3A2KA 3TD2A 1C8BA 1RCFA 1SC9A 1OLXA 1YR8A 4RTMA 1BMDA 1ZVVA 3MOGA 1G2PA 2Y1XA 4HDKA 2HV8A 2QLMA 3IV9A 3MWYW 1A4IA 1E5XA 1CUZA 1E5VA 2ORWA 2XITA 1MOZA 3CG0A 3IKMB 2SHKA 1IMOA 4MVYA 3DT8A 1BMQA 2XCUA 4FBMA 2PA0A 4B3CA 2V9ZA 1GQSA 1YK0A 1RD4A 1NW6A 1Q16A 5C8ZA 1XZDA 1U5BB 3QGMA 1W25A 2HBZA 4PO9A 1UMBB 1VE9A 1OQAA 1KDVA 3SZMA 3WLLA 4YO8A 4FLMA 1WBDA 4AJLA 4GI5A 5JZOA 1I5RA 1RT9A 2FF7A 2Q1TA 3LLUA 1RWMA 2QDKA 4ERNA 2Y1EA 3INYA 4OHRA 4AJKA 1C50A 3UPDA 3CZCA 5JU6A 3IERA 1H3EA 4I9UA 2JIRA 4ZODA 5CXQA 3W5SA 5HDBB 4C76A 2H29A 1SH7A 3UYKA 3OJEA 1P1BA 1TA9A 3AF2A 4P7JA 2Q2QA 4MOWA 1ILWA 1SZJG 3NB0A 4GLOA 1X7GA 2BBSA 1JA1A 5I4KA 4KREA 4OIMA 3QX7A 1OJ7A 4YAEA 4GDMA 3VYUB 4YDQA 1N34B 2HMSA 2ZROA 3PQ7A 3OHMA 3Q12A 2ZS9A 3R09A 1OVMA 4PY2A 3UK2A 1ABFA 5I4BA 1R6AA 4L95C 4MKIA 2YOFA 3R5XA 2Z6QA 3PQDA 3RANA 2FRDA 2VHUA 4MO2A 1VJTA 4IIJB 4E31A 1VG0B 4PLVA 1SQSA 3WL4A 5D87A 3I8SA 4JT4A 4IS2A 2IBSA 2IZZA 1E32A 3ENQA 2ZDHA 3SSAA 2GD6A 4ZP1A 1D5WA 2WKQA 4ZTBA 3L04A 1VQ1A 1XUOA 3R40A 5DTEA 1C0PA 4CQLA 4PSDA 1ZESA 5F9FA 1XYVA 3R5JA 4HGNA 4EQ6B 3TAHA 1EXVA 2ZYIA 4E2WA 3C5WP 1CUHA 1WAMA 4Q7LA 4YBRA 2IXAA 3UZUA 1LBSA 3A9VA 3BQ9A 1NDQA 4ER5A 5E6SB 2HYIC 3VZBA 1KO5A 2VNJA 5AHOA 5TE9A 3T38A 1R6BX 4JLUA 5COBA 1Z07A 1RKUA 3GJRA 4FE7A 1PEAA 4ZN6A 2I9PA 2ZR0A 3PRYA 4X7RA 1PV2A 1QGUA 1E1DA 2QP4A 2DBYA 2E4AA 3UAGA 4ISBA 4JEHA 1A9YA 3SQXA 4U0KA 4C0BA 4DLTA 2EP7A 1XCPA 2WWIA 3DYBA 3PPVA 3WB1A 2IOQA 1MABB 3WGGA 1E2BA 5MN5A 1C1YA 3CVOA 1E2HA 4O4IF 3W6OA 3IHTA 3WKEA 2JCGA 2QDXA 4GIBA 4F8EA 5HZKA 1I7SB 1S8OA 1BH6A 5C1PA 1N8KA 3N8DA 3A9RA 5ETJA 1CV2A 1GYQA 1NR7A 1UCFA 2B69A 2W2XA 4ZCPA 1XRNA 2ECPA 1ESZA 1U81A 4JKOA 4LWOA 4OREX 4TLEA 5FUBA 1ZW6A 2G1UA 2AI2A 2VT3A 4AMGA 2X86A 4L76A 2Q3EA 1L7DA 2YXNA 3MGCA 3AUJB 1OWNA 2CGEA 1V5IA 3I6MA 3NHUA 5J63A 2H9YA 3R9XA 1GGEA 2R5NA 1WR8A 3K7EA 1FXWA 1EIWA 4A9AA 3AR2A 3ET5A 3N2YA 4GDFA 2XNDA 5E3HA 2K6GA 4AKGA 4PTZA 4R05A 3TKLA 2SKEA 3G7NA 5JAIA 3ZLBA 1JE1A 1KVQA 2QUJA 2QT1A 3GGGA 4L8VA 5ABPA 2PU7A 4MVJE 4B75A 3NHBA 4JLKA 2DFKB 4FD3A 4GG1A 4MUAA 3MD9A 3LY9A 4PE5B 5HF6A 3VHXA 3D3JA 4X93A 1RLOA 1G8PA 1XDGA 4G1EB 4I36A 4INAA 4MAAA 4OL9A 5FA5A 2OQRA 2IJGX 1E92A 3KBOA 3E4CA 2I2CA 5ALNA 2Z09A 5T4EA 3GA7A 1GFZA 4D26A 4XWKA 1RP7A 2V7EA 4KQ6A 2W5UA 4CVNA 3T7AA 4QJ5A 3EWSA 4AJIA 4IV8A 1FNDA 1WP9A 4GL2A 5AJXA 2V3VA 3IV6A 2O3UA 3PWSA 2V9PA 3GEMA 4OK6A 4XIFA 4D44A 3ZZ0A 2J3HA 4W82A 3ZIAA 2JFYA 1Y1SA 3HKEB 5C37A 2DETA 1NWCA 3VR0A 3OKCA 4GW3A 2NAPA 2JJYA 2TMYA 1YA6A 3S2ZA 4JMPA 3SIPA 3ETNA 2RONA 2G07A 1U80A 1HDYA 4WMLA 3ZXXA 2D0DA 3URKA 3KU1A 4BVAA 4D74A 4JYZA 4HWTA 3IKTA 1G21B 5LB2A 1PDVA 3R5TA 1GZHB 2ZI7A 2JZCA 5DXJA 1Z06A 4OQPA 3L92A 3OE1A 1L4EA 1DV2A 3BJIC 2HT1A 3TSZA 2DFLA 1P6QA 4YT5A 2G5CA 5D3KA 3K5WA 4QYSA 2CLOB 1V16A 2XXBA 4EAAA 3IQEA 4RTJA 4YQZA 2XYPA 1B0PA 2Z2YA 1O97C 5T4FA 1XMPA 1U3DA 2K7ZA 2FV8A 2QX9A 1C8LA 3VC1A 3FPGA 4PAWA 2W90A 1F6DA 3EXG1 3U4AA 4K3VA 1ST2A 1XZPA 3EBLA 5DYWA 5KBYA 2FAXA 4I4CA 4Q1CA 3EYWA 4WK4B 5F9HA 4PV7A 1SCQA 1P4RA 4H2DA 2Q49A 1Z47A 3PFCA 2ZBFA 2O54A 1U0EA 3ITEA 3AWIA 5FOUA 1KMIY 1B0UA 1QNLA 3IDSA 5FFFA 1KO4A 3M33A 3T95A 2D1TA 3BKXA 1QK5A 5HXAA 3S70A 5KWSA 2C7GA 2XUOA 4E15A 2Z2ZA 1ZLXA 3KK0A 5B1DA 1EGVB 2ZRQA 2PUDA 4OHMA 4RAOA 4UBNA 5I01A 4O4LB 4O3MA 2WDPA 1AT1A 9ABPA 5TGDA 3I4LA 1LQUA 2NV2B 3RJZA 3BZUA 3Q3CA 1P9LA 1BEUB 4IJWA 3EQ9A 2GAAA 4KCGA 1V5FA 4B31A 1KAGA 2WFMA 1PP4A 3FPLA 1K5GA 4IIJA 2XZPA 3KD3A 4OQEA 4BJ6A 3MCWA 3A37A 3TMAA 4D4IA 1KEKA 1AUVA 4URYR 3V7UA 4EYSA 2Q3HA 1TM2A 3ERCA 2QMOA 4KQMA 5FL3A 1HBJA 1PCXA 5AQEA 3OUUA 4FYJA 4RTRA 3NC4A 4CL3A 4N9WA 4NPCA 5JJCA 3VMFA 4W5NA 3JVEA 1U2SA 3AXSA 2GKOA 5IJXA 4UM9B 4PPNA 5K2MA 2BJWA 2F3RA 4YRFA 5E0KB 2VP0A 4XVQA 2B1RA 4IDCA 3VOSA 3PRKE 4QJBA 4PIMA 1X13A 4NDAA 4MA5A 1OI3A 2VWQA 3F5MA 3KQHA 2QG9A 1CWUA 1XVIA 2CEKA 3CM0A 3O4IA 1K3FA 5D01A 3T3HA 3W06A 3G2PA 5D7NA 2WG0A 1O5IA 3CJQA 1E99A 4BP8A 2XUKA 1GUBA 2NGRA 3COVA 5AOBA 1FVOA 2YIVX 2ZI9A 3SE7A 2PSEA 3RYHB 1UKAA 3FHCB 3RAGA 3UGJA 3L0IB 2OD9A 2BEJA 4Y0VA 2NYUA 1Z5OA 4HAUA 4X66B 4Q1DA 5LZ2A 3WRVA 3H2KA 2YZ7A 2AN1A 3W5DA 4IJQA 3MC1A 1EA7A 2PR7A 1LJLA 2AJLI 5FP0A 3DTVD 3DMTC 3LKDA 3HJGA 4HNTA 1JX6A 1EJ6A 1XZCA 4PEVA 5TEVA 1Q21A 3BXXA 3RVBA 2BUCA 2HWWA 2B4RO 1Z7WA 3DGFC 1V48A 3IMEA 2ZJBA 1EBBA 3ESQA 3GN2A 3PX7A 2ZI6A 2H52A 4NDNE 3M4JA 3W3ZB 3OZCA 2HQ1A 1CQJB 2PUVA 1Z4MA 4I5IA 5DSZA 3LHIA 4UBKA 3KWJA 3V5NA 3SVZA 2NU7A 2BELA 3IULA 3PDJA 3KYBA 3QVXA 4JUAA 1ESCA 4OL0A 2Z3ZA 1MJNA 1Z2PX 5HZHA 2GBPA 1N36B 4YA6A 3AKDA 5HS6A 4PR3A 2XD4A 3CRNA 3QKSB 3R7SA 3IKLA 4ZCRA 3CUKA 3RS0A 5LN1A 1ISFA 1VHLA 1SM4A 1HEYA 2EFCB 2NXCA 5DN6A 3W5JA 3OU2A 4C89A 4CT0A 3CNQS 1P19A 3HNOA 4BKRA 2NO4A 1YBAA 3BA1A 3O8QA 5K03A 2JASA 1YQXA 3RTGA 5IVKA 1B26A 3KHUA 1M6HA 4QVIA 1X38A 3UMMA 3HY6A 4B71A 3DDOA 3ICEA 4LNAA 3HA3A 521PA 1EEHA 1Z56C 4DQLA 3B8HA 4EIWA 3KR2A 4Q82A 3H2IA 3GLIB 4UBLA 1FLAA 3CSSA 4NPHA 2Q5QA 1R6UA 2ZJ3A 2PWBA 3RJ9A 3ZHTA 4BMNA 4LJ5A 2PFSA 3KSDO 1YR7A 3FHOA 3WWDA 1KS2A 4PNPA 3CIOA 2H63A 4DA0A 4E1BA 4PLCA 1G6OA 2O0HA 5ALSA 1UAYA 4WKPA 5ILQA 3I6BA 3W5AA 5CG2A 3FDIA 1N9KA 1GLNA 1ZI6A 3MUFA 2AYYA 3SLKA 1D03A 1HNNA 1QOQB 2C2ZA 2YCLA 4JBYA 5J2TF 4A1OA 2H5JA 4F21A 4CN9A 1AU9A 1C3EA 3W8DA 4TLAA 1UJMA 2PL5A 1E8DA 2COKA 2VDKB 3DOEA 4TMWA 1IMJA 4RK1A 4UDNA 5A06A 4RNCA 3BRWD 2QRZA 4NC9A 3OJWA 5KOJB 2OUKA 2PL3A 1VG8A 2QIOA 2VF2A 3AM4A 1IATA 5A2GA 5C7IO 3RU9A 2R8RA 1G5QA 5H59A 5IK2D 1KFCB 1YGPA 4P33A 5HE8A 4NYMR 5K0BA 2D2VA 3M4ZA 2Q8PA 1MPXA 1Z4PX 2BD0A 3N58A 4Q4CA 4KBFA 4PCVA 3C3KA 1PHRA 2GAOA 2I54A 2ZKLA 4V3BA 3CGWA 4IIVA 4AIRA 4ECEA 3K1AA 1I2MA 5IVPA 4WQMA 4EGJA 2A0XA 1DBPA 2HXYA 5KCMA 5IKPA 4JZKA 1XDUA 3AEXA 2M98A 4V38A 1NF8A 4BQOA 3EZ9A 2XT0A 5A5EA 1DO8A 4TRJA 1LV8A 5LP6A 3BMCA 2NVUA 1NQTA 1X74A 3RUAA 5K4AA 5DM70 1A7AA 2CB0A 3AM3A 1BIFA 1XMJA