4K9RA

Spore photoproduct lyase y98f mutant
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
340
structure length
340
Chain Sequence
KPFVPKLVYFEPEALSYPLGKELYEKFTQMGIKIRETTSHNQVRGIPGETELARYRNAKSTLVVGVRRTLKFDSSKPSAEYAIPLATGCMGHCHYCFLQTTLGSKPYIRVYVNLDDIFAQAQKYINERAPEITRFEAACTSDIVGIDHLTHSLKKAIEFIGATDYGRLRFVTKYEHVDHLLDARHNGKTRFRFSINSRYVINHFEPGTSSFDGRLAAARKVAGAGYKLGFVVAPIYRHEGWERGYFELFQELARQLEGMDLSDLTFELIQHRFTKPAKRVIEQRYPKTRLDLDETKRKYKWGRYGIGKYVYRDEEAKELEDTMRRYIEQFFPGAYVQYFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spore photoproduct lyase
publication title A radical transfer pathway in spore photoproduct lyase.
pubmed doi rcsb
source organism Geobacillus thermodenitrificans
molecule tags Lyase
total genus 124
structure length 340
sequence length 340
ec nomenclature ec 4.1.99.14: Spore photoproduct lyase.
pdb deposition date 2013-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4k9rA01
3.80.30.30 Alpha Beta Alpha-Beta Horseshoe pyruvate-formate lyase- activating enzyme pyruvate-formate lyase- activating enzyme 4k9rA02
4FHDA 4RH0A 4FHEA 4RH1A 4FHCA 4FHGA 4FHFA 4K9RA
chains in the Genus database with same CATH superfamily
3HVUA 2PYZA 1ID1A 3KE8A 4M1SA 1G21B 9GPBA 4A0RA 1RBZA 1ZONA 1PEDA 2XDQA 3NYRA 1U0LA 3EASA 5T6BA 2RARA 1IXYA 4RS3A 1Q0LA 5JQGF 1PS9A 4IV8A 5GONF 4OHFA 3HCBA 4LZOA 3NT4A 4C21A 4Z86A 3O38A 3P9YA 1ISMA 4NDNE 1DT3A 3AIOA 4UNSA 2K4MA 5EJGA 1XN4A 4DLUA 4BTLA 2PS0A 1GZ7A 4DV2B 4HCJA 1O6BA 3LP6A 4LYYA 2XT9A 5H68A 4F04A 4J03A 4L5AA 3ZW7A 1XC7A 4XOIA 1SRRA 3ROXA 5K0EA 3S5UA 4B9AA 5HRCA 1E1RA 5A4FS 1IHPA 2YWXA 3QA9A 3I0NA 4JHLA 1RKXA 1W88A 4DLVA 3IEVA 2BBWA 1BMFA 2Z8ZA 4EA9A 1HTTA 3NH9A 3U7QB 4G8DA 1R9MA 4OQDA 2ZT6A 1YDHA 4IKPA 2V0CA 3AR8A 1OH6A 2B1GA 4LKOA 4JC4A 4IUDS 5FUXA 2XRZA 2E2WA 2Q5EA 2WBLC 3LFUA 4P58A 4PAMA 4DQLA 4OIFA 3TWOA 1VI2A 2IDZA 1JG2A 4NMMA 4I1PA 3ADKA 4X66B 1KJZA 2WI8A 4OGWA 4F9TA 4YCSA 1URPA 2HLPA 5C81A 3DPSA 1ZLXA 2PO7A 3N5KA 5G40A 1JBKA 3H11B 1S89A 2SKDA 3NHWA 3IBYA 2EGUA 1FXWF 2CNLA 2XMBA 4PCVA 4FOSA 2FKAA 4Z2YA 1YZKA 1NV8A 2XCLA 3PHJA 3RKSA 3CFYA 3ODPA 2MSEB 1JB9A 2B35A 3GGJA 4X1KA 5EPUA 2Q9BA 2W2OA 5K4GA 2I2CA 4XWAA 2XGMA 3RYTC 2MSDB 2AW5A 1NI3A 2QZZA 3UJ7A 2LBPA 4EFMA 3L7OA 3ORQA 2HRDA 2JGAA 1PJQA 2Y05A 4PFKA 3DXFA 3GRYA 3CNLA 1ZDMA 4WECA 5BOSA 1PKXA 3WC4A 3A14A 1PWYE 3RYFB 1QYWA 1T1JA 1XDSA 4YBRA 3CUEF 5IRCD 1D1QA 1FTSA 1GA1A 2QXTA 3BN3A 4G37A 1LBHA 1U1DA 3OT4A 4FFVA 4JSYA 4Y2GA 1VLJA 1TJPB 1ZIYA 5HVNA 3I62A 5FNVB 4EMTA 3LBHA 4BUCA 5F78A 1GDHA 4KPUB 4IG9A 4CR6A 1EGMB 3QGMA 1HNXB 3S2IA 1M2WA 1OC4A 1XDWA 2P2GA 2EZTA 1JJ7A 1MRSA 1TA4A 1T6NA 5JD6A 5CCEA 3ERCA 1GTJ1 1MP0A 4LY3A 1SURA 2YV3A 1V47A 1PFYA 1U1IA 1VJTA 5EXXA 4GOLD 5LWHA 3U44A 4FE7A 4R8MA 1VSBA 1E1MA 1KFCB 5H81A 3Q1LA 1KE2A 3GD5A 4YH1A 4YMVA 3AR9A 3BB1A 1H5UA 1K06A 5JCXA 1GQFA 1ZMXA 3IO3A 3O8BA 2Q0SA 5GV7A 1H9CA 2X9VA 4FDLA 2WU8A 5TEWA 3PE3A 4H0NA 2OPHA 4CUKA 3IKMB 3GW8A 3T9DA 5EJ5A 2FFHA 4NTZA 4MQ4A 3D6AA 2F1OA 1BHQ1 1YE8A 1DRVA 2QBYA 2AKEA 2P8SA 3SC6A 2C0CA 2UXCB 4B32A 3M34A 3K73O 2FE4A 5L3ZA 3QH4A 3V7WA 5FF9A 1WZUA 2AJBA 3OIFA 4LWQA 1I32A 2PD3A 3RDPA 1GLNA 4WZBA 1CU1A 4LXQA 4DLBA 4PLPA 4F2HA 1RAIA 2CDBA 2X5JO 4TGLA 2HPAA 5F1OA 3U49A 3FWYA 4D0LB 2ABWA 4YRKA 1GGJA 4BBAA 3B53X 2H4WA 1D04A 3L93A 1QDEA 1X7ZB 1TEZA 4CQNA 2N75A 3OQOA 1IQRA 6AT1A 4B75A 2JATA 2GQ0A 3P71T 4KVAA 5DRTA 5CFOA 3LOUA 1P4GA 4KYIB 4HNAB 4NIMA 2QYOA 4AZ3A 3V32A 4LZNA 4NONA 4MVJD 4N6GA 3K9NA 5BMVB 2CV2A 2VCYA 4OYYA 4V3CA 5AVKA 5M5BA 5E4JA 5ITWA 5H02A 1UEJA 1Z5GA 2IOFA 1HEYA 2ZKIA 1WB9A 2HIMA 5JAPA 3UOAB 3V8QA 1HYGA 2X0EA 1Y34E 3H84A 1ULAA 1RRFA 2IVZA 2P7HA 3K96A 2G1KA 2GASA 3DBIA 1L4BA 1KIAA 1QUEA 1QDLB 4I5FA 2JKYA 3TMYA 1BOFA 4B35A 3HXQA 2R5FA 4MW5A 2UYYA 3QVXA 1QO7A 2H7CA 4D4HA 2ZI6A 4CLRA 1OJLA 5BRAA 2WMYA 2DZDA 1ZJYA 2N9UA 4DYVA 3DKIA 5JSYA 1V3VA 1MF7A 4IMPA 2C2HA 4MMZB 2Y1DA 1SD2A 1VHWA 1QORA 2VDKB 3ASVA 3JD2A 1T4CB 3PEVA 4I14A 4KAFA 4LDAA 1YD7A 1E2IA 4AQYB 4RYDA 2HU8A 3EBPA 1Q7TA 1P9WA 2I66A 2OWDA 5EIAA 5KX5A 3WP1B 1V2HE 3A4YA 4B83A 4NOMA 3CKLA 4KDEA 3LRPA 4FGUA 4UBMA 4REQA 4MRVA 3NRJA 2ZRIA 1XDBA 4U8GA 3PG5A 5ICGA 1MJ5A 2NZ8A 1NYLA 1QC5A 1Y89A 1YCGA 2FPKA 3O1IC 3I1FA 4K26A 3MLEA 4ER7A 3F71A 1CY1A 1YKGA 2BEWB 3RFFA 3SZ3A 3WLNA 3VAZA 1U0GA 3WFIA 3RK0A 1G64A 1DBWA 1RU3A 2YWBA 1FLVA 4YCDA 5EZYF 2J59A 2P41A 4KQWA 4Q3EA 5ALFA 1SR8A 3ZI7A 2UYHA 2P30A 4L4XA 2PE5A 3QOFA 5J63A 1JU4A 1M83A 2HL6A 4MEBA 2ZSAA 1NF8A 4MA4A 4JITA 2H9IA 1JR6A 5CH3A 4QODA 5AI8A 1KY2A 1K92A 3S40A 4AG3A 5JAZA 2HNAA 2O8EA 3H2ZA 5MGBA 3T6KA 3QXXA 4BNWA 3NHMA 3A6LA 4CEIA 2VIIA 4NI5A 2XUPA 3KOMA 1NXXA 4Z3KA 1DARA 1NMYA 2YJ4A 4II7A 2ZRLA 3OJEA 3ZUGA 2UYCA 2XR1A 1OW3B 3PPIA 4HPJB 1E1KA 3WK8A 2FFRA 5IK2A 1I01A 5LFAA 2QLLA 3G8CA 2P3QA 3DE6X 3EEFA 1HQYE 2FWBA 3GFGA 4JS0A 5C7YA 2VI5A 1GG2A 2JZNA 2Q21A 4HPWA 1RC1A 3NTXA 4R8KA 2YYZA 1K7EB 3PJDA 4WN9A 4COKA 2I6FA 3L02A 4CN9A 1QO9A 3D2LA 5EE1A 3RU3A 2GBFA 2X8LA 1Z38A 3EEYA 3WYBA 2ZUEA 1XLUA 1ZC3A 1JR3D 3I8XA 4J2TA 3M3DA 2XB4A 3DKKA 5IDWA 3I64A 4OK5A 3CR7A 3NTVA 2O5EA 2B25A 3SYMA 3OE5A 3PQDA 4YCLA 2CNWA 1ZL2A 3GV0A 1PL0A 1T24A 5F1YA 2WYIA 2HJHA 3IAS6 4FNMA 5JQGB 4XYLA 3T95A 5LN1A 1RWOA 3EISA 1XMOB 2XWJI 4KMMA 5GONB 1ICEA 1TZBA 1MEOA 4I7EA 3UC5A 3BM5A 3HVKA 3NM6B 1Z16A 4JT9A 1TMYA 1RQ7A 1RP7A 2TS1A 1RIIA 2Y8EA 3HKDB 4G09A 4YRDA 3T5DA 4FR2A 4HDSB 1KFKB 2PX5A 3G79A 3PWZA 1HR0B 3H2GA 3B5EA 4QGAA 3BXXA 3TDNA 2PLFA 1MABA 3VYSB 2XDWA 2ZPTX 4QRDA 4LKRA 1A98A 3FTNA 3GCGA 3GJQA 3SDBA 1UKZA 3B9QA 3TNYA 1GZ4A 2VXOA 3W5VA 1HX7A 1PSDA 1J2TA 2G9ZA 2PIDA 5CVJA 5B7GA 2XTZA 3F7TA 4TQUS 1CNMA 4HX9A 1GG5A 2GBGA 2JJ2D 2VAXA 1L5HA 2EQAA 1W0CA 2AMFA 2B61A 3HWSA 1QVZA 4PYMA 1U8XX 2A9FA 1LX6A 3FR7A 4JEMA 1S2NA 2GXQA 3OIVA 5DYGA 5M3BA 5TGTA 3SFVA 4ARUA 5BR1A 2AZMA 2YOFA 2W8BB 2V7GA 4J2OA 3IHTA 3SY8A 1D1PA 4KN9S 1SQ0A 3ADPA 1VJRA 2FWJA 4KGDA 1NE7A 1QV7A 5LCXA 4BBPA 3EC1A 4YC7A 2QUAA 3R1IA 4U39A 1HSZA 4MINA 3CLVA 4C3UA 3JATA 3W05A 3JQ7B 3PD7A 3NC1C 3VNUA 3AIMA 2IF0A 1FS5A 3ZTTA 5I9IA 2NP6A 2PKWA 3DE3X 4Y9SA 5DX1A 3CJQA 4J0IA 3SR0A 2H08A 2JFFA 5FXMA 4QPNA 1VHLA 3A4MA 3ETEA 4EY7A 3I9LA 1E9FA 2BFFB 4YV1A 1UC4B 3JAWB 4MI3A 3UZUA 4ABTA 1XZDA 1VI6A 4UFNA 3RTDA 3VYRB 5JECA 1S2IA 2VJYA 1N0UA 4JLSA 1NBAA 4OCZA 1AZWA 4I5IA 3T9AA 1SBYA 2BGNA 4V1CI 1CY7A 3VKUA 2H85A 1M6VA 1G6Q1 2WJIA 3EHEA 2EEPA 2VP3A 3BMOA 4LC0A 2DKNA 4ESHA 2R2AA 5BQXA 1PJSA 2F1KA 1R66A 1XG5A 3KWLA 4I8DA 4UD2A 4WXPA 2FE1A 1YONA 1CV2A 4PLHA 3W2TA 5CFMA 2NAPA 1X7HA 1PW5A 5TJHA 2P2YA 1KK0A 4GI5A 4RX1A 4JY7A 1HQDA 2Q4RA 1Z0ZA 1EG2A 1KAMA 1J33A 4U00A 2EFDB 5CIWA 1J06A 2AN4A 1SU8A 1ZD2P 4X8HA 4XFDA 4RHCA 4JQZA 5HKAA 2H06A 1DTWA 5KVAA 1W6UA 3AUKA 2ORYA 2WU4A 4F4JA 4HQKA 1RM0A 2AA3A 1RKUA 1U4SA 1ZMTA 2RGYA 2W6IA 2XUHA 3FVWA 3IHKA 4JT8A 4PLWA 3L8ZA 3SJZA 2YWDA 4OXYA 2WIKA 3VVLA 4AJNA 2XLBA 1YBFA 3MS2A 4UTOA 2JA1A 3KQMA 4K6CA 4K6FA 4RF5A 8LDHA 4KRXA 1IB0A 4W7SA 3QTLA 5CLJA 1DXQA 1QONA 4HN9A 4QBHA 4FT2A 3U61B 3DMTC 3HDTA 4YEDA 4ZV7A 5DM70 3ZYZA 1X0XA 4AJOA 1OLUB 1JU3A 2FPWA 2BN4A 4AZ0A 5K05A 2GA9A 3AV0B 2ZJAA 4G01B 3EY9A 2YNMC 3CUVA 3PLNA 2H4XA 4POOA 5A7FA 4HUTA 1P73A 2J7PD 1RM5A 2AT1A 2CDNA 3OPVA 1C7RA 3AKZA 3F4LA 3S2FA 3D8BA 2YHBA 1WUYA 4J3JA 1KDVA 3ZE1B 3M4NA 5EGSA 4O4HF 1WCWA 2RBKA 2Z4RA 4RDIA 1GFZA 3ESRA 2E9SA 4OMCA 1T91A 2AMLA 5E6UB 4ZDJA 3DTVD 1NPYA 1FBTA 1NX9A 1HEUA 4KOAA 2FPXA 5F64A 1JEYA 1DAHA 2QRQA 2QZSA 3LY9A 5LUBA 4ZEMA 5JY1A 4HLUC 2XODA 1WPRA 1U1FA 2YFYA 4EY4A 1NSYA 1IN8A 1L4EA 4IDEA 2ZSBA 4H1WA 4PYIA 2F64A 5JG7A 3VX4A 4Z3OA 1E1NA 1ZZEA 2P6PA 1ORIA 2ZVDA 3V8PA 1WQ3A 1UOEA 3N2NA 5D2CA 2ODWA 1W46A 4FKBA 1YJAA 3LUAA 1T9GR 2RG1A 4IFEA 4OMUA 5D1NA 5F2OA 2IP1A 2JFWA 4PS1A 2QLMA 4AP5A 3K0BA 4J1SA 1JV2B 3WWPA 5BURA 3ZJVA 5IYZF 1WXXA 2FSVC 4JK3A 2PAAA 1XXLA 4L78A 1DV2A 1VP3A 4BKMA 1T13A 4HGPA 4OGLA 3S99A 2JFNA 1E3WB 1ORDA 1JIXA 3JPYA 3H5LA 1R7RA 4GNRA 2OFPA 1AG9A 1YNOA 3OWOA 1LLCA 3UMBA 1BYIA 2O7VA 5K6RA 3HZOA 4L8FA 2VF4X 4MUMA 3LLCA 3DHYA 1QHYA 3HKCB 1G5RA 4JI3B 3OE7A 3HN7A 4OH1A 4RF2A 1V3UA 2ISQA 2NO7A 1OZFA 2A0XA 2HBYA 1EWTA 1K4YA 2EKQA 4FCTA 3HXOA 4TS3A 3SM3A 3ME5A 2CB9A 1LNZA 1N7GA 3L4BC 4FQ7A 4B4VA 2JI4A 4CEHB 2J8ZA 3LLMA 4DUYB 3OLCX 3KHUA 2WKQA 4H0CA 1K0FA 4KXXA 3E22B 3S28A 1B74A 4DV1B 3TCKA 4CKZA 3FIJA 3WR5A 4B34A 5HKLA 3OZ7A 3F49S 1UWCA 4DN6A 5FOWA 2P9BA 2EAUA 2J07A 3SBEA 3IMFA 2EFYA 4PYKA 2A5GA 4EJSB 1L4UA 1R0LA 1S2LA 2C9ZA 3G6WA 3IA7A 4KNWA 2GN1A 3NC0C 3Q98A 3UMSA 5FFFA 2BDTA 4HAYA 2PUEA 1WDKA 2EF1A 5A9RA 4M36A 4G24A 1GLGA 5FPSA 3ENNA 3D3WB 1W36B 2PZJA 4HADA 4FFSA 3A1NA 1UWLA 4GPAA 2XGGA 1Q0RA 3HL4A 1R6UA 4QVKA 4L6CA 2WLSA 1G8KA 4IHQA 2Q3FA 1V9LA 1J2EA 4E03A 2IV2X 4FI3C 1Q2XA 2WZCA 1I4OA 1NUPA 2PCLA 1BEZA 4DXHA 1XAJA 1DELA 2EJTA 2VA8A 2XQIA 2Y0CA 4PGMA 3ET5A 4QLBA 3TKLA 4FYVA 4LS3A 3OPMA 5MFPA 3FYUC 4GWGA 1UMDA 3S8MA 3ZHSA 4Y0VA 2VAPA 4KFUA 4ENVA 4IDBA 1XTZA 3NPAA 5KNLA 2HHHB 3OOSA 1TJ3A 1PDOA 3RVMA 4JEUA 4TKVA 1P4HA 5BNZA 3UHOA 4ZYUA 4C5BA 5E9JA 2P7IA 1HMYA 4TTJA 1IPEA 3UXMA 4CIBA 2XNHA 1AZLA 3O1JC 4D74A 4O2RA 3MUFA 5JDIC 1IN1A 4CGYA 5CX1A 2FZCA 2E7ZA 4MXDA 1UDWA 4BLWA 3H99A 4KG7A 3CZAA 2PKEA 3L8YA 2QQ5A 3JAMA 1ZM7A 4GMHA 3F3SA 1WX1A 2Z0MA 2HHJA 2WWHA 1GITA 3ZXYA 3A9CA 3D2BA 4KBFA 4LTMA 4NSNA 4QXRA 3QKWA 4FIZA 1BRMA 1N75A 3LL4A 7REQB 5G4LA 2BFOA 3FOEC 1QYRA 1TYZA 1Y0BA 5K0NA 4I5EA 2P4UA 3OEHD 3VDMA 3UJNA 1T9CA 3H75A 2O1SA 3QBTA 4B6GA 1CF2O 3JQEA 3AR2A 4ZYWA 5ALVA 3C0KA 2AZXA 1V1JA 4IFTA 4KIUA 5DYIA 4C6HA 4OF4A 4XGNA 5EAIA 4WZAE 1H2AS 4BRZA 1KJJA 1YS4A 4TROA 2QMHA 5T3UA 4TYYA 4IVQA 2D13A 4DLNA 1PQ4A 3GELA 3LDGA 3CRMA 4M6WB 3TNJA 4AXBA 1F4PA 1QRRA 2I8AA 1S96A 3LE8A 3QPBA 5IC6A 2JI9A 1RPTA 1ZRSA 1MO6A 4MI6A 4YQFA 4AJ4A 3MERA 2WB4A 2X8JA 4LMAA 2HM7A 1Y9JA 1J23A 1YMQA 3GC6A 4MVCA 5IDVA 3V8MA 4DSUA 1N9GB 4BCBA 4D0NA 3GLGE 3JWHA 1QX3A 1VMEA 5ICSA 2CMDA 2R1ZA 4Z4EA 4N3AA 2CJWB 5TPWA 4ZIRA 3WLAA 3ZDBA 4BNHA 3DV2A 3PEWA 2DJ5A 4KX3A 2P9YA 3DE4X 3TIVA 2ZRDA 1X9IA 1SHUX 3H4MA 3L5KA 4GPTA 5CB8A 1NW6A 1VSUA 4QWMA 2GA8A 5EWLA 3K5PA 6ABPA 2PYDA 5BXYA 5BXQC 3A25A 1Z12A 1PEKE 3FB4A 3QPUA 2ECPA 2FMXA 5DSTA 4MKZA 1J5XA 4Q1DA 4ND8A 4K86A 2WZQA 3D6JA 4TLMB 3H2IA 3AEXA 3CRVA 1LH0A 3PCRB 1T3HA 4LZJA 5LQSA 3T34A 2W2QA 3EE6A 1D8AA 1N5RA 5A0VA 4U0KA 4HWOA 1OXBB 5AICA 1Y8RB 2BR3A 2HCTA 3BJRA 3G2PA 4RPGA 4ICIA 5D3MB 5DCLA 4ZQBA 2XI4A 3GXBA 3WXBA 1E1YA 3W06A 2CMFA 3ONEA 1UOPA 4OG2A 3BZUA 2J5BA 3OQ6A 2VL7A 4E4TA 4FB5A 4BXOB 3WQQA 5IH7A 4II3A 4ZVNA 2XTNA 4IRUB 4M0UA 5DHAA 1Z6TA 4GH5A 2YWRA 3BBLA 2Q2VA 4W9NA 2F9MA 4CZ2A 3N86A 3QI2A 3WMEA 1M2FA 2Z43A 5CIQA 4TRRA 3GGCA 3I58A 2EC5A 1YZNA 4IH1A 4LYHA 3ZZMA 3DP9A 4PLCA 3HDYA 2QTVB 3ROGA 4F9FA 1J56A 5GZ6A 1TQ8A 2PHZA 2XQGA 3N6VA 5HJ7A 3IMCA 2DUUA 3TQRA 4LUCA 1PX0A 1WHSA 2WA2A 1JEAA 2ZI9A 3DBLA 3KQTA 4PZEA 2WABA 5CH5A 2HREA 4IOKA 4F1WA 2F3RA 1XD2B 1S4MA 2BV3A 1FNNA 1QTNA 2WVHA 3COVA 5FLKA 2F7SA 3LFHA 4FHFA 3MBOA 5GGXA 5I9TA 2BD0A 3L6CA 1N1DA 4EKNB 1XFAA 2Y6UA 3A7DA 4KIGA 2OMEA 2P75A 3JR7A 1K7YA 1Q16A 3D9QX 3TUIC 4O4HB 2F55A 2P77A 3HB9A 2OBNA 1T1RA 4AUMA 4EO9A 1UM9B 1E3IA 3QX3A 1G63A 2JZCA 3H9CA 2GEDA 3LRXA 3O9ZA 3H1BA 4I1IA 3E7WA 4X1YB 5LYJF 2C99A 4OA5A 1G7RA 5IM5A 4DWJA 5ARBA 4FQ8A 5JARA 1LGYA 4YPVA 1E5TA 1QBGA 4CLOA 1VYHA 4D6YA 5KTMA 1NR1A 2PRIA 4DRYA 1HTBA 4CIAA 5AHRA 3Q3EA 3RADC 1PQUA 1SCQA 2WAYA 1E1LA 1SQ5A 2OWEA 1KZHA 3W5SA 2R85A 5L7WA 5J4VA 2ZROA 1BOOA 2GDJA 1WU7A 1AY0A 1I9GA 2MR6A 5J4KA 1O4WA 5IYZB 2J9GA 4RWEA 2AJCA 3WZ2A 1EWQA 1KHTA 4GMGA 1GV0A 4G5HA 4KDCA 4HVAA 4U5XA 3ZU4A 2HK9A 4UHEA 4CQMB 1WXGA 1Y1SA 3Q9NA 1RHQA 3K0SA 1CUHA 4B0OA 3LA8A 3EWIA 5D86A 1CFZA 4EL0A 4MQ5A 4TS4A 4W9RA 3M1YA 3C87A 2OCBA 4M9ZA 3GRVA 1J8DA 3TCXB 3V8NA 1W25A 1IBKB 1TRKA 4RK4A 3HO1A 1M72A 3BIWA 3MCVA 5AM0A 3ZCSA 3ZCVA 1QYIA 2HX1A 3HJGA 1TF5A 2IEDA 2Q9AA 2VPXA 4LJ6A 4LRUA 4RCZA 5KNDA 3PDIB 3UG7A 1B6TA 1KY3A 1ZCBA 3GMDA 1KAOA 3ZH2A 4R2IA 4MPTA 1EP2B 1QG4A 2XWSA 4LI0A 1R6DA 2PK3A 2E4YA 3IJEB 2BSXA 2K2WA 4CQJA 1YDFA 4ML3A 3AKCA 2ZJBA 3W6NA 3G2IA 1TB4A 3FFXA 3BHIA 3LS2A 1YI1A 1L8QA 2FZKA 1H0SA 4LRSB 4RIFA 4B6RA 4IHJF 1JQLB 4BCCA 2PD6A 2O2DA 3U1VA 1XLTA 2H2AA 5FJJA 4AYWA 1OKKA 1VE1A 1PFUA 4H17A 4CG3A 2Y66A 1J0AA 1XGKA 3UYLA 3PF9A 3QBDA 1XWIA 2P2CA 2Z2KA 3CNBA 1CQIA 4MROA 2NPIA 4HQ6A 4AJIA 4KHPB 3KPUA 1NUSA 4C08A 4CKCA 2IXBA 3LT1A 3M2PA 4KQMA 5AI9A 3SHWA 3NOXA 3PA6A 4DT1A 3FXAA 5JD5A 3SQXA 3DAPA 5BNFA 4BVGA 1JEDA 5CA1F 1RWVA 3ADCA 1WW3A 3V4SA 3R76A 4C9BA 5HJEA 2IHKA 4C0SA 2JGFA 1CEYA 2I9PA 5DULA 4IGFA 3LZ6A 2HZBA 3PUWA 5JXWA 1GDTA 4ON9A 2VPYA 4IJUA 4URXR 2J9YB 3X1KA 2YCBA 3VBCA 4YAIA 4KLCA 4RHTA 3TXYA 9ATCA 2LR0A 5JC1A 2W48A 3GJ7A 4UVGA 1ZHHA 1DQNA 1CVIA 3ANNA 3ODGA 4K81B 1OXUA 3HCPA 1AQLA 3G1WA 4GMKA 1UADA 5IAKA 5JWHA 2C5SA 3P9QA 5IW8A 3EEOA 4K03A 4J29A 4TTSA 1Z4PX 5TLSA 4ZVMA 3D81A 2V1XA 5I6DA 1G3RA 4WASA 4C4PA 3CBQA 4H7EA 4NULA 2OZEA 4FJ0A 1VPVA 3JZMA 3CANA 3ZXSA 1M6WA 4RGBA 1QIHA 4IJQA 3BRCA 4LK2A 4NZMA 1IOWA 2BKLA 2FDCA 3R3VA 1MW8X 1CUCA 1TCVA 3MJSA 5G1PA 2NYAA 4DJFC 3QVWA 1PDWA 4KXWA 3TB6A 4B6FA 3MW8A 4ZCLA 2I99A 2HSGA 4J49A 4WOKA 1M1YE 4HQLA 1P0FA 4NYMR 3ZHVA 2XB6A 4FYJA 1UQUA 4HRXA 3TIXB 1H42A 3B2QA 1XT6A 4R1LA 4D82A 4KO8A 5SY9A 1FDVA 2YJ6A 4B84A 2AMYA 5JZ9A 1YQQA 2HA7A 3A3YA 4C20A 1XEXA 5FOSA 3W78A 1TZKA 2DHRA 2V74B 4RQTA 3SYRA 4C3VA 1QYCA 1QHHA 3V4VB 2XB9A 4QTTB 2ILVA 1IJKA 3L2OB 1ESZA 1LPAB 2CVOA 1VKOA 2PX4A 1KYXA 4ND4A 3CF4A 4UVEA 2FMFA 4KO4S 4G1CA 3JYNA 3RSOA 3ZEAA 2IXDA 4IKOA 4KR9A 2WY2D 3ZV6A 1NOKA 1Z6XA 3DUFB 2CXQA 2A84A 2HIAA 1BNCA 3TW6A 2GX6A 3OC6A 2V59A 2XMZA 2HMTA 2Q6OA 3BKXA 1ECBA 3KTAB 4RDHA 5BQ5A 3VRHA 4C4RA 4DSOA 1O6CA 3G9UA 2D8MA 4ATNA 4BRSA 3QVUA 2OM2A 4R0NA 1JDSA 1W29A 4C2AA 4QTZA 3JSXA 1I94B 2ID9A 2EJUA 2XD4A 4L7QA 4D45A 1JKIA 2HBQA 1ZH4A 4RTRA 3U3XA 3ZHZA 3K20A 1X9HA 2YS7A 3WHLA 3EN0A 1T8PA 4F8JA 2HA3A 1ECCA 4MR9A 5AM3A 4FFRA 1W34A 3ZQKA 3FKSD 3DLTA 4LDZA 4ZJUA 5KOYA 1U2EA 5EJIA 4GU5A 4IH9A 1VPEA 3Q3JB 3HU2A 4DC0A 4JWTA 2ZUUA 4C4OA 2FNAA 1CK4A 1ND6A 3O7MA 5HCUA 1O6GA 4MS4A 5J23A 1CERA 1W75A 1T4DA 3R9WA 5JHHB 1W76A 2VDWA 2DCMA 3FNHA 1VHJA 1EZZA 3P4XA 1XYYA 4O63O 2E5LB 3VBEA 1SD5A 2RFLA 4IIHA 4P53A 2ZJ1A 2GAFA 5BN3A 3S81A 2Q4OA 3MWEA 2QDKA 3QVOA 4JNKA 2ORVA 3HWRA 1BS1A 2XKKA 1L7NA 1UZNA 4MP6A 2B8NA 1Z45A 4LBZA 2EARA 2GEJA 4JV5B 3OZDA 2AOUB 3N59A 1JA1A 4TV8F 3B6EA 2HA4A 3SS8A 1T10A 1Y8QA 3H9GA 4LMPA 3V7YA 1YCFA 5BSVA 3U3MA 5CDFA 4NLLA 3WWCA 1SKYB 3E9EA 2QVXX 3RT1A 3SR3A 1OAOC 3FMFA 3LHSA 4EPWA 3RTGA 3LBAA 2Z9DA 1NTRA 1DJPA 5KYXB 4KQJA 1QV9A 3B6MA 1A9YA 3QP9A 4K9DA 4QNNA 4CKBB 5KU1A 3PQ3A 2Q28A 4JXKA 3RC7A 4GF5A 1I8TA 3IBSA 3WGJA 2PR7A 3ANSA 1FP2A 2JC3A 3NIFB 1FU7A 3NJ8A 4BNFA 4DHEA 5C8YF 3OSUA 5LYJB 1MAAA 5ADWA 3ICEA 3NWOA 3UF0A 1N8TA 2R87A 3WLHA 3ZVKA 4R69A 1BN6A 4OI0A 3DQZA 2XGJA 4C7XA 2EFHB 2FCAA 1R5OA 3HI4A 2OCYC 3PE4A 2ARKA 5TF4A 1XDZA 4E5PA 3I0ZA 4D3SA 5J5CA 3ZDYB 4DB2A 3OCXA 1ZISA 2FG7C 3G59A 3KHKA 1HDGO 2HRBA 4QWWA 4RIEA 1DKMA 1RPJA 1R16A 4QLOA 1DJMA 1QAOA 3X2EA 1MX3A 2OBFA 4GMFA 4D9KA 1C29B 1M8GA 3AUFA 4LRQA 1C9KA 2GH1A 2BONA 1TTPB 2N0SA 3DFMA 4QJ5A 5ER9A 4D2IA 1G9XA 4GXRA 4NS1A 2VBGA 1ZOPA 4IDCA 2Q1YA 5CG2A 3ER6A 3HNPA 2QSYA 2E3JA 4E07A 4EPTA 3U48A 2BI8A 5KSYA 1CUAA 4M1EA 4M1MA 2DPYA 3IPXA 4MV3A 2XUIA 3PUIA 5T67A 4XGKA 2W43A 4KVFA 1OFTA 2P69A 3CY6A 3C6YA 2W98A 4Y2QA 2QRKA 4L76A 3R74A 3UAVA 3V2UA 3LL7A 5JROA 1A5ZA 3ABZA 5ERXA 1EVQA 1DINA 1ENYA 3QF7A 4QDTA 2QRVB 3WTCA 2HTEA 1JECA 5AJUA 3KR2A 4BO3A 3C6XA 5H83A 1TW3A 1GCAA 3AETB 3IKTA 3BTOA 1B6RA 2NZJA 1NFFA 4G4SP 2PIAA 3D8SA 3VH3A 1YE5A 2UXBB 1YR9A 2QN2A 2VSQA 4P3PA 4X97A 2XEDA 4OKNA 3KUDA 4K9LA 1F12A 1VSTA 5EIOA 2JBWA 1IBMB 3HVJA 4MSUA 1Z08A 1NFQA 3T7IA 2Z1MA 3VTAA 1STOA 1CP2A 1UZAA 1CHDA 4Y8VA 4ZAZA 4Y6PA 5DV9A 1JT2A 4XVRA 4Q3BA 4QX6A 3BCUA 4W6QA 5DHRA 1OR8A 3RUHA 3SBOA 1GYPA 4TQGA 2NTJA 4CI9A 1QMPA 3ZIAD 2YY7A 3FLBA 4PZCA 2QX4A 6LDHA 2ZIXA 1D0SA 3TG2A 1B93A 1NAHA 1CZUA 3GLFB 3EOZA 2J9FB 5T8KA 4K9PA 4M76B 5CA1B 3UYKA 5I9MA 1P45A 4W82A 3DF9A 3M2TA 5KQGA 3H6GA 4O59O 1Z7YA 2Y93A 3D1VA 1E1CA 1NULA 1V0JA 3QNUA 1F51E 4IIDA 4XCQA 5ILQA 4DMHA 2X7XA 1HWYA 1N2CA 1XBTA 4H7DA 1L1FA 2DKOA 3LVQE 3OZWA 4B6PA 1ZXBA 1ENZA 2HR1A 1KP3A 5F2NA 3QELA 3GLIA 2ZBDA 2R68A 4WA7A 3SIWA 3ZZNA 4BJ5A 5ELXA 2P1DA 1K1EA 3ZY5A 2Q62A 4RY0A 2YHUA 1V43A 1G8PA 2C82A 2D0OB 5FO1A 2WUWE 2VJQA 5AJXA 4PZAA 3IE2A 4J90A 3ZY3A 3BFKA 1EDOA 2HRZA 1D8TA 4UM9B 1RYEA 1NVVQ 2V6FA 4ZVOA 4LCJA 2PZLA 5HKBA 1SKBA 2FPGB 5FD8A 5IVPA 4FOPA 2PTGA 4EHNA 4LQLA 1IEQA 3D2AA 4I9UA 2A67A 4C0HA 4HNVA 1W44A 1WVMA 2NXNA 5CX4A 3RTAA 4IQ0A 4MVJH 4CF3A 2I6XA 3A36A 3IT1A 5LP6F 4A82A 1R6VA 2FOLA 3MCTA 3HA5A 1KORA 1P1RA 1ZJZA 3ZN2A 2M32A 3ZD6A 3MAGA 4J94A 3CPHA 4L2IB 4P92A 5FEMA 3LTNC 3QU5A 3E9MA 3EFOA 3LTEA 1I13A 4G1FA 4NMWA 5H9WA 2YNMA 2XOKD 5AW5A 1KEWA 3HXLA 3ZGVA 3VH2A 2ETVA 5FBQB 5TQ2A 3AR4A 4NMLA 4EHJA 4ENUA 1SBQA 3E9RA 1BU5A 2TSYB 3AFGA 3NTUA 3DEYX 3OPQA 4N5HX 2FZ5A 5C4GB 1V8BA 4II2A 1ECGA 4XE5A 1EUDB 4DQKA 1XRMA 2D0DA 4QE3A 4FD2A 4O8CA 2WVGA 3AVQA 3BPSA 1MO5A 1XTJA 4QDXA 1QGOA 4MQEB 3SZUA 1NMSA 1H8ED 5ALOA 5BNIA 3KYJB 2Q8NA 2RGUA 3K5IA 5AT1A 1YJ5A 1BO6A 3NWPA 4RPIA 2AXNA 3Q40A 1HYEA 1E69A 1PR3A 2YVQA 4QPCA 4DXDA 1PI3A 2Q2OA 2CXOA 5MN5A 1U8CB 3LSYA 4R71A 1ZU4A 4ZCRA 2ODQA 5CIYA 3LI2A 4FN5A 1U3FA 2J0VA 3I1YA 3QF4B 4YQYA 3PHBE 1F9AA 1IHOA 4FEEA 4EW1A 1BC5A 2H4FA 4BV2A 2V55B 1U0FA 4L9AA 5JSZA 3LQQA 1U2DC 4NABA 3H86A 4MGIR 2Y0PA 4HFRA 5C7OO 1IBLB 1TUGA 1Y3DE 4MWCA 4WHMA 5A9SB 1PWHA 2OAQ1 4YJ2F 1MX5A 2ODBA 4KSBA 2VTDA 1Z62A 1HZZA 2OYCA 1FB5A 2R8OA 2LDXA 2AHRA 4HWTA 1M2VB 1JIJA 1XFDA 1BVRA 4U9UA 2VJNA 4JP5A 2GHTA 3OIYA 2G80A 1H9AA 2A4KA 2QR5A 2WTXA 5JYCA 1KZ9A 1JHAA 1QJCA 1KOFA 3ER9A 3MJEA 1BCSA 4CEJB 2BR5A 4RHFA 4R7TA 4LDQA 2B36A 2I29A 1L5GB 3B5IA 4YP1A 4EG5A 4A27A 3QMPA 1AK1A 1WSDA 2QW8A 2R7NA 1AKRA 2Z3WA 4MVJE 3O4GA 5EJMA 3VU9A 2XHEA 4UC0A 1TUIA 3AJ9A 3FYSA 1ZNQO 3M82A 3AF3A 2IPOA 2OZKA 2ZBRA 4G4GA 1YZLA 1GZ6A 4C4SA 5CNJA 5JNWA 4EQ6B 1QE0A 4Z7OB 1P6UA 1AB5A 2ACWA 4WNIA 2Q3BA 3RUDA 2YRXA 3TS1A 7MDHA 4WW0A 3LT0A 1F8FA 3PTLA 3GDOA 4O33A 4P82A 2Q5CA 4EGCB 4GSYA 2ZTHA 3QLUC 2C9MA 1VZ3A 3ICQB 4TKUA 5AM4A 1HE3A 3PL5A 2BZSA 3U7RA 2OSVA 3O8OA 3MGBA 2HI0A 3K3PA 1IHYA 1KK1A 1T8TA 4BO1A 1EM8B 4CFSA 4RULA 3L92A 5JRZA 3NHFA 3NW9A 1N0HA 4ISBA 1U2SA 4O4JF 4ZOBA 4FCCA 5ALSA 3DNPA 5D6OA 5C7IO 2VSFA 2ZJ6A 3EA5A 1QQ5A 3IUEA 3PDWA 4IAOA 4LJLA 1SC9A 2C2XA 1A9PA 3G02A 3PPXA 1I1QB 1ULBA 3B9PA 4X45A 1Y4SA 5C8YB 3ACBA 5LIRA 5CCXA 3TG8A 4W1PA 2PL9A 1NATA 3L0PA 5SICE 2XUGA 4E22A 1QK3A 3AEKA 1Y7PA 5FIUA 1QHXA 2C07A 1PD0A 1NN1A 4PSCA 2ZYGA 3ENWA 3SX4A 5HCIA 4JFRA 2Q9CA 4DNFA 5KYYB 2AIRA 1KOLA 5ICMA 2P9TA 4IJKA 4HT3B 4ZCTA 1W30A 5JBQA 1DC4A 2I7VA 4GKBA 2AF4C 3D4PA 4M0FA 3GG2A 4KCGA 1ZCFA 3LX4A 5DWDA 3IVAA 4LJYA 2G0TA 5DOZA 3HGQA 5KNDH 4Z0HO 3HZRA 3OLXA 1I1NA 3V42A 7GPBA 3P2EA 2QVGA 1UK9A 5REQB 2VSYA 3W9SA 4YRCA 5K3SA 3TBFA 4DCOA 4NBKA 3EGCA 2B4QA 3IP1A 4XYBA 3WLTA 1UBEA 1RYZA 3ZNPA 1PFKA 4N0DA 1JKJB 3QVGA 1CR1A 4KJZA 3ACDA 3TAHA 2ZAMA 3THSA 3LXXA 3IOYA 4UU1A 2B8TA 2CD7A 4HI0E 2IUUA 3THYA 1WWKA 3ILVA 3HTXA 1E7WA 3HS3A 2Y0DA 1YC5A 1YTLA 5HF5A 1N0WA 3P7MA 3L1HA 4EFDA 4D8VA 5C5DA 3GVHA 1V1MA 4I66A 1U65A 4R9NA 3ROKA 5J4HA 2RGCA 4POAA 4QTXA 2HV9A 3DL0A 5AESA 3WMXA 5IKEA 4RMIA 2OUIA 1BEEA 1SB9A 5FWXA 3DBRB 3MJCA 4DIOA 1JR3E 4YAUA 2FW1A 3R8CA 1TPYA 3B8EA 3QITA 1EA7A 1RFGE 5D1HA 4KMRA 5KS2A 1JIQA 3WNVA 3RWBA 1XMQB 1NVWQ 1RPNA 4FMBB 3KUKA 2ID8A 3B7WA 4OB8A 5DMHA 2ACKA 3N2ZB 1A95A 1XTQA 3SQLA 3UK0A 5LD2C 4EP1A 1AQYA 3P0FA 1L5FA 1T9HA 1TXGA 5G3YA 5HF6A 1UT8A 1WAMA 3QUCA 3REOA 4UOEA 4UQLA 1YZYA 2UZ0A 4WN3A 4D3YA 2HBZA 3EIOA 5GP1A 3AY7A 1HKUA 4IIUA 4MRMA 4UPEA 1NR7A 1JQKA 5HRUA 3C7TA 2LNDA 3R3XA 4Y2JA 3JQGA 2YW9A 2H3EA 4HP8A 4CL3A 1US8A 1XZFA 1N25A 4Y2UA 4ZI5A 4ANFA 4B8WA 4JXXA 4QFBA 1ZPDA 1T3ZA 3ZWBA 5BUZA 2DFVA 4D9IA 2ECQA 3FCYA 2BFAA 1KJNA 4EX7A 2QUZA 3NZEA 4IX1A 2DHEA 1NUAA 3HV0A 3GMIA 2X5XA 1SXPA 3LBNA 5DHFA 5GV8A 3PQ6A 3TF5A 4OJKA 4WXEA 3TPZA 3GGDA 1IUPA 2KPOA 3NYQA 3BCSA 2HW8A 1BEUB 4Y7CA 3UMRA 1DMSA 1F8YA 1NFRA 1V6SA 2WFZA 1VPWA 3JD3A 1TJYA 1XZ8A 5B1SA 4D4GA 4EGAA 3HA7A 1G2IA 4JYBA 2BKEA 1ESEA 1L2TA 2NOAA 2X6QA 2HV8A 3OZBA 2BFWA 4G8BA 2HMSA 3I6MA 4M7PA 4W8GA 1Z6ZA 1X7XA 2PG3A 3A11A 4X3CA 2P2SA 4DG9A 4O4IF 2J6CA 1MJHA 4RD2A 1Z5UA 2IK8A 1CY0A 3JU3A 2XXAA 3NWJA 3WYFA 4BO6A 3K0FB 2CMHA 3OJCA 4Z1MD 3QYPA 1M2EA 5ELMA 5ESWA 2H4YA 3SVZA 4PHHA 4K87A 3PIIA 3C14C 2IGTA 4QDUA 2FN3A 3U26A 1OBFO 2C94A 1KJQA 3DEJA 3E3AA 1ATZA 4LHSA 3ROZA 1OXMA 4XUEA 3FPSA 3JQAD 3KTFA 4P3KA 3ITEA 1BE6A 1MB3A 1XWFA 2IEYA 5IJXA 3SF8B 2D3WA 4TUYF 1HE4A 1T2AA 3AG5A 3EVGA 3P8ZA 4JLDA 4MUNA 4A73A 4BYMA 4NAHA 3OHMA 4RHYA 3ASZA 2QM0A 2QW0X 3OIUA 3E7FA 3WHIA 4Q82A 2JCBA 3N75A 4Q21A 2ZQYA 4CM9D 2XA1A 4C78A 1WM1A 1TGVA 2IPNA 3N58A 4P4GA 5JTUA 1WL8A 5L40A 1JI0A 5EMMA 1TJ5A 1BJTA 3CKKA 1RCTE 2OXCA 5I8WA 5IJWA 4D81A 3UGKA 2LP4Y 4WZAA 2ZYRA 5KNBA 4OJMX 2GXAA 5LZ5A 2C4UA 4GX5A 4JH0A 4YLYA 2OVFA 2I8LA 3LC7O 4MLPA 3HJFA 1IVSA 4B3SB 3W3AA 4P36A 5SZJA 4EI7A 1E2KA 1RS0A 5B2FA 4MVJG 3G85A 4YT2A 2IP4A 3IV7A 1ZNZA 2GPSA 3PK0A 2WVAA 4KQ6A 3KC2A 4N7MA 4A8JC 3OWXA 2QPOA 2H6EA 4PNPA 1WUJS 3EUWA 4V0RA 4TQ9A 1ZZGA 3B89A 3ND8A 4JJZA 5FI3A 2FJ0A 1W49A 4CFYA 3GEDA 1SWWA 2IYSA 2MMGA 3USZA 1X92A 2ZYTX 2W2NA 2BGWA 3O0TA 3C15C 1JHVA 3A2MA 4JUDX 4WXRA 1OX6A 3QE0A 1TKRA 4XM2A 2FUKA 1H94A 1ZOOA 4Z8XA 3NEAA 3KLPX 4AN0A 4MUGA 4R8SA 4ADSG 2EP7A 2PSJA 3O4JA 3RIMA 3BDVA 4DA9A 2D2EA 3B70A 4RPJA 1E3LA 2Q27A 5KNCA 4QXQA 3RWOA 3ZLVA 2C2WA 3REQB 1FQWA 3E2IA 3CF2A 1M2NA 2F9FA 3D43A 4Y2YA 4DILA 4DVJA 3F6YA 2K87A 3B3FA 1H6DA 3WB1A 1O96A 1SVIA 4YP0A 1RHRA 3R3ZA 2BMFA 2XB8A 1VIYA 3EXEB 1II8A 3PTZA 3LCRA 4FZ5A 1WIWA 5B7NA 2CLOB 3K4PA 4OHZA 5LZ4A 2JLWA 5IF9A 1VECA 1MKYA 3MLAA 4PLZA 4B3FX 1KMQA 4MQMA 5IDXA 2AN9A 3VR5D 3UTCA 3DO6A 5THKA 2W0SA 3FHJA 3RAGA 3ZNQA 4E4YA 3BXHA 3Q8XB 4YUYA 2BH2A 1C2TA 1T5IA 4GKVA 4PO1A 1T9AA 3RUPA 3ZU5A 2R8ZA 1EJ6A 1YBVA 4QT4A 1B23P 3QKUA 4X7RA 3CPSA 2Q2NA 3I9KA 1FJXA 2QQGA 3FFBA 4L0CA 5K2MA 4JC0A 1KYIA 5IKOA 4E4RA 4YRAA 3Q3VA 1B15A 2EU8A 1GZHB 1QFXA 3BDAA 1ARZA 3CCCA 3GPBA 3LXMA 4KSYA 4XDHA 5DISB 2NU8A 4EI9A 3ZHUA 3PHIA 2CT8A 1L8XA 2BFEB 1XZMA 5B7PA 1HFEL 1LPSA 1UPCA 3L8MA 3LYUA 6GPBA 5A71A 2RHDA 3VVMA 5C4IA 2BFPA 3HKBA 3KXDA 4DTCA 4PFSA 5JCOC 3B36A 2CNDA 3JD0A 1FMLA 3EOBI 3GWGA 3QEMB 4KYTA 1QGDA 4O4JB 3WRYA 3KJXA 1PW7A 1OAKA 1Z2OX 2AGVA 2VC2B 5FPQA 3KB8A 4L16A 3HN2A 1QPGA 5U4XA 4ZTZB 1UFRA 3E9CA 1YA6A 4PYRA 1ILWA 3BWXA 2I2WA 3OF2A 2EYQA 3KZOA 3A1TA 3I23A 4WXYB 2PMEA 1O54A 1BXRA 4J0JA 4QXAA 4AKEA 4Q9AA 4DM3A 1KYTA 1D7AA 1SUEA 2R6CA 1EE9A 2ZFUA 3DPUA 4JYCA 1RPAA 2R8BA 5ALGA 1K5HA 1JX6A 4KWIA 4J7AA 2X5KO 2D5LA 3PHCA 3WSVA 1UQTA 4KACA 4FW9A 2O3SA 4WFIA 4CU2A 2R5WA 2G09A 5KTRA 4YRSA 2Z6UA 1SM4A 3G2KA 1RC0A 4Q3NA 3F46A 4INPA 2FFAA 3HABA 3REGA 3AM3A 3EVAA 4TTPA 4BOYA 1KYQA 4EEXA 2GCNA 1XJ0A 4ZI7A 3OZTA 5AVOA 1ZHOA 1PU2A 3Q6NA 1Q0QA 1ZR4A 4AECA 4FR0A 5EKXA 3H1AA 4WY8A 1NM5C 1M34A 1FUYB 2B94A 3U4CA 5A2GA 4MR8B 3T5MA 2N42A 4WBNA 5L3QB 5AOCA 2CJXA 2XMRA 1SBTA 3VZCA 4ZOLB 1F20A 1DCMA 1SQGA 1W47A 2WUEA 4AL4A 1A3CA 1K0UA 4DF3A 2PQ0A 3R0IA 4CM6A 1ONOA 5JS8A 1EVEA 4L50A 1A96A 5JNUA 3DZHA 3NAZA 3MJDA 2GZ1A 3OBIA 5E6SB 5FLEX 5HS4A 1B43A 3JZDA 3HJUA 2ZT7A 4QSHA 4B4UA 4BQIA 3IXLA 2FSGA 2NMVA 2HQ1A 5JEDA 1I0IA 1NX6A 1O9GA 2VDVE 3A27A 3O6VA 4AP6A 4GRAA 1KZGB 2VQDA 4XCXA 5DE3A 1C80A 1TU4A 2A35A 1EWRA 1R4MB 3OTHA 5HRAA 2EIXA 4BV9A 3GPLA 4HB3A 2EGHA 1EFPA 3HLTA 4DYDA 1SCNE 1BJRE 2F90A 2E4AA 3G0CA 4ZOAA 4QVIA 1GFSA 4KI7A 5KC8A 2TMDA 2WNSA 5A4DA 1U8AA 4ARAA 1BGWA 1DQPA 1D4ZA 2JNWA 4ZQHA 4QULA 3RRZA 2A14A 1U2GC 2FZVA 2WZDA 1SK9A 3AFNA 1ZRMA 2DQYA 2VRCD 3DDSA 2PLRA 3BICA 5B4TA 1A4IA 4LQ4A 4Q47A 1FPQA 2V8OA 3GLKA 1T9GS 3KOUA 3E1GA 2FFQA 1T26A 3E5HA 3GT7A 2NVWA 1T8SA 4K7JA 2QNIA 2LE0A 3ZQJA 2FW9A 1Y9AA 2WJ6A 3G2QA 5ENDA 1QZTA 2JJ1D 1IXZA 1DGQA 4I9FA 1JG3A 1TYAE 5FUVA 2F8SA 1J9EA 3GPCA 2O3UA 3P9SA 2IPLA 1TUEA 2NU6A 3P0JA 5JZSA 5KTYA 5HQJA 3T3IA 5IZ4A 3HBLA 3KKPA 4LTDA 2XYQA 3AINA 1KWKA 2QAGB 1Q84A 1NKTA 4XYEA 3T1YB 2BFBA 4PCUA 1WUHS 1TYDE 4C0WA 1P7ZA 3I52A 4DE5A 2HTFA 2O7SA 5EUBA 5BW6B 3TAXA 1W5TA 1QFMA 5FBRB 3G8AA 5EOVA 2A5LA 4H3HB 1MDFA 1DAKA 5TS3A 3HJCA 3NTLA 4QBIA 4EDHA 3OCWA 1UR5A 1IM8A 4PG6A 1YL7A 2I4LA 4KKXB 1ZEMA 2O6HA 3H4VA 3OQBA 4S35A 1PV1A 4L95C 2L2QA 4YRNA 5C9ZA 1PVDA 1ABBA 5A4KA 3SZMA 2II6A 1Y3BE 4RY8A 4QKQA 2G4CA 1QU2A 2E37A 5KJ6A 3PNMA 2BGJA 3FGPA 4U7DA 3K70B 1V35A 3KSAC 3S68A 3OAAA 4JGBA 4BFZA 3N8NA 4AM8A 3ABSB 5B30A 1CDEA 1EFCA 1WV0A 2XYGA 4PX3A 4KLZA 4NJOA 2JDIA 3QY0A 3AI1A 3ND7A 3QG1A 4RZQA 1GT6A 1OFGA 3P0RA 3MXTA 1OAOA 4HLDA 1A5SB 3VMFA 4BMVA 2JPDA 3BGDA 3FGOA 4TUYB 4YAEA 5AP9A 2DHCA 3F7OA 3GR6A 1L7QA 1R4NB 4KR2A 2HK6A 2M6LA 1LC3A 4RPLA 2JKZA 2X0RA 2PKXA 4R2WA 5TVGA 2ZETA 2O54A 2XCUA 3HPRA 2PZKA 4AJLA 3F6EX 3QMWA 2Q50A 1MOQA 5EQFA 5EIEA 4OREX 5F7OA 3FTPA 1IQ0A 1YBMA 5TB5A 1JQEA 2DPXA 1UJ6A 2AC2A 2HSEA 3HU1A 5DK4A 3K6JA 3ABIA 2HEGA 2ZVQX 5DW0A 3TW4A 3EARA 1N2CE 2ENUA 3D4BA 4XSVA 4B33A 2BP7B 4OA8A 5GIPE 5JJ5A 4LC9A 4J1TC 5FYDA 3N7UA 1AQ6A 1P5JA 3HADA 3RVRA 1VBNA 2C5LA 1H93A 3W8FA 5FTMA 3GPIA 3JW8A 1YRLA 4YMUA 3MTGA 2DLNA 2W6JA 4QDJA 5EWJA 4D9GA 3EWAA 1ECPA 1WPQA 3FD8A 4ZAVA 2QTHA 3CF4G 3R5XA 4B87A 5HOEA 5BWMA 1MJFA 2O59A 1H3NA 3GEHA 2EOAA 3V7FA 1FYXA 1HG0A 3GMSA 2GXSA 1POWA 4N01A 1NQXA 1X1EA 2UDPA 4BNYA 1IJEA 4RMHA 3A7EA 4YRTA 3W5HA 1VLLA 2DTEA 4G0UA 2PGLA 1R88A 2DWUA 2NSYA 3F96A 1QS0B 2GBPA 3ER8A 4N6OA 4X65B 1X7GA 3C1OA 2Q3DA 4HK4A 5C0OE 1DIRA 3NP7A 5J4YA 2BL4A 3EGEA 3LJKA 1M1ZA 2CFSA 2Q6KA 5JE8A 3WWOA 3HI6A 5AWFC 3AHJA 3IYLW 3V5NA 5K8UA 1RWMA 4PHFA 1M1NA 1RRMA 3RO7A 4WLFA 2FCRA 3E3OA 3PUKA 3A4TA 2IHTA 4OYRA 2QMQA 2RB5A 3SHFA 4HPXB 3PGJA 4IUBS 4H4CA 5EKSA 4O2AA 1W36D 3ZC3A 2QF7A 2XBLA 1QH8A 1RJGA 4BEBA 1RMYA 1QYXA 4BNUA 4TRMA 4HUJA 4ETWA 3C3KA 2C8VA 4GP6A 1A5AB 1KI4A 2YWEA 2IHZA 1PJAA 2IYNA 2QRLA 3CT4A 3P26A 2GN6A 2GZSA 4OM7A 2I76A 1LBSA 4IX9A 3UT5B 3C48A 3RFUA 5AVTA 3TR5A 1AA6A 3I01M 3DCYA 4L5BA 5JYBA 3CG4A 1WETA 1NY5A 3BMQB 4A2QA 1YQ9A 3F6RA 1EX6A 1GPKA 2HCFA 3W6PA 5KYWA 4H77A 5CAEA 3THXB 3C45A 1E9SA 3UJ6A 4H27A 1G19A 4E2YA 1C30A 2JS7A 2H1HA 1E0DA 5AM1A 3GDFA 1T35A 3W5CA 3TXAA 2ZVPX 3EMDA 3PB3A 1VYVA 3SMQA 5IJ0B 4ER0A 2HCBA 2BTEA 4IJ6A 3LOQA 4PRYA 5HBGA 5CNKA 1V41E 4UFPA 1KRWA 3CR3C 4WVFA 1DJQA 1FVFA 2R4QA 3N2EA 1YTUA 1JLMA 3UAZA 1NVEA 1FP6A 4JMLA 1A1VA 3SQOA 3T9EA 5J3JA 5KOIA 1VCOA 3M3HA 4GI3A 4W8OA 4E5DA 3HCNA 2J4CA 5KREA 1TA0A 3TLXA 4QG7A 1PJLA 3F3YA 1WMEA 2E85A 2W4QA 2Y1CA 5T6MA 4BNTA 1G59A 1T43A 5E6RA 4YMTA 5AUNB 1KJIA 1G8SA 3GVCA 3UMCA 3PFKA 4AS3A 3FLEA 2ZWPA 4RA9A 1O94C 1KRHA 1TE2A 1X2EA 1GSOA 1OZHA 3MILA 4TN1A 4JX8A 1BD4A 4MYSA 4QUEA 3GMTA 1C9YA 5DXFA 1UPFA 4YAGA 3D6MA 1S3IA 4BRWA 4TTAA 3OMXA 3K0KA 3EIFA 1KJWA 3DCJA 1MB9A 2PWAA 2O7QA 4BJHB 2FPUA 1NNEA 3J81k 1EK0A 1T8WA 2LKCA 5EVCA 4GI2A 1KI6B 1TCUA 2Y67A 2RK3A 2ZXUA 4ZEOA 3M8KA 3DZFA 1OGIA 3IL2A 4HRAA 1VRVA 4KFTA 1TMOA 1EI9A 1NPTO 1D0IA 2BRUA 4M0LA 4YXWA 3WKDA 1JEOA 3R9XA 4KE6A 3WKEA 5A5DA 3EAGA 5KX5F 3D0RA 1QB8A 3EVZA 3FZQA 4YK7A 2G67A 2V3WA 3D7KA 1JDTA 4X3PA 1UH5A 3R44A 4QO7A 1ZM4A 2P9GA 2VYVA 3FHOA 1T1SA 4OV6B 2H51A 4AKHA 1PJ8A 1C7FA 3IEMA 1TMGE 3PHLA 4P54A 2IS6A 3ZDQA 2F48A 4GXQA 3PFHA 4LSWA 2I54A 2DWCA 1J5EB 4M0DA 4EG6A 5DNYB 1PR1A 1H85A 2VHVA 1M2OA 3LU1A 1LA2A 3M9LA 1TVEA 4BGVA 4L9SA 4PM4A 3K05A 4W5OA 4MV6A 2YMPA 3KJIA 1R5BA 1DFIA 1UBNA 1ZUIA 3GRCA 1RLOA 4N8DA 3K9FC 1XDUA 2WINI 1K2VN 1HFWA 1QHIA 1TDJA 2OR3A 1FS6A 2YMLA 1NNUA 3M49A 4Z6KA 4QUJA 3RYHB 1UCFA 1UAAA 5JUWA 2H8GA 4CETA 1F0NA 2A57A 1X1RA 3JVEA 3MBKA 1ZI9A 4BV3A 4O5AA 4R3NA 2IU0A 1HL7A 1VCNA 3ZW9A 4C4TA 2YFHA 3OQPA 5LXTA 4J07A 4OQPA 2R1TB 4HUQB 2KE5A 4B48A 2GZ2A 3AEQA 2PWBA 1VPLA 3S1AB 3HVRA 4DR6B 4UHBA 2IL1A 4H18A 2IH5A 2FX5A 2ATEA 4J16C 1R15A 4UPVA 3QX7A 2VHEA 2OCPA 3WKCA 2H59A 2BGRA 3AR3A 2Q5QA 3QBJA 4P3NA 5CLQA 3GLGB 2VF8A 2OBMA 1H1LB 2PH1A 5FV4A 4OP3A 1JR2A 4PICA 1B73A 1XUOA 1Y5RA 2MT9A 1UWVA 2ET6A 2XDQB 2C84A 3FVTA 3FW1A 2HMUA 1GOTA 3PGLA 1E3TA 1XPJA 8OHMA 2I1QA 4OPMA 4LFBB 1E61A 3CEJA 5C5IA 3QEBZ 4W5NA 4H1VA 2VG8A 4O4LF 3CF0A 5FYQA 5JADA 2JHCA 3E9DA 3FMOB 4D92A 1KKLA 3U7FB 4UU7A 4B73A 1JFFB 2BHSA 2X9QA 3ETDA 4GXNA 2TYSB 4Q7EA 4LQCA 1UK8A 3UAWA 1N32B 2BGIA 1NI4A 1E9CA 2RKWA 3BXGA 3QLUA 2F1HA 2ACVA 4GT1A 1RBMA 1JKXA 3OZEA 1M10A 5KNBH 4JX9A 5LDHA 3O3NB 2W2KA 4PTZA 5B1HA 3VV2A 3CUTA 4L3OA 1T6XA 3HSYA 4BNXA 4MGKR 3GA7A 4E3WA 2D0PB 4M98A 5H5JA 1W88B 2X2PA 3P45A 1J8YF 1RAGA 4GM1A 1ZI8A 4LHVA 4QEZA 3WRVA 4DMUB 5HK9A 3D5TA 3GGSA 3GEEA 1C81A 1TM1E 4PQEA 3TLKA 4EPRA 1S5PA 4TLBA 3IV9A 5LQAA 1A50B 1A8SA 1PE0A 3PIDA 1V4VA 3CZQA 4GECA 2XCIA 1W4BA 2O3RA 3IELA 4F4CA 2IQ5A 5TQJA 4RK1A 1XJWA 3IB6A 2QLBA 3NIBA 3CEHA 2CZQA 4QBTA 1U8UA 2YUIA 3TW8B 2OKCA 2YY5A 3RANA 4KDFA 2Q4TA 2GHQA 2HDNB 3FAZA 4OHWA 1IM2A 5IAEA 1PZXA 4BVAA 2ZUFA 4OQYA 2B5OA 5BUQA 3OZVA 4S2UA 2G1UA 2FZGA 1Z6PA 3EC7A 4X1KB 1I3OA 1M5UA 4NL4H 2J3EA 1THTA 2HY7A 3LZDA 4JBYA 4R84A 3FDZA 2IW1A 4MS3A 1FFBA 5H9VA 3PC8C 3T9FA 1SOUA 3COPA 4DXAA 1D2MA 5IJAA 1T29A 5BV2P 3LLSA 4K6KA 4ZT6A 2JLZA 1GUDA 4CRWB 1C3OB 2RGRA 2VN8A 1SZPA 3EH2A 3FYTA 5FI1B 1RFLA 4HAOA 1JNYA 5PGMA 2YYYA 1P9NA 1XROA 3HE3A 2KI5A 4JLMA 4LHXA 1T8RA 4PQYA 2XUAA 2FK8A 5FKJA 4D3FA 3E27A 2RAVA 2CB0A 4CCWA 3A1CA 3PX7A 1UDAA 3RJ5A 3VJKA 4KW7A 3GZJA 1OI4A 2AK2A 4Q9DA 1JWAB 2R6HA 2QG9A 2QZPA 2WIBA 1LSOA 2XIJA 1G20E 3RTCA 5CD9A 4C88A 2E87A 5DMXA 1O87A 2AXEA 4R01A 5AHXA 3MB5A 1QJ4A 3AI3A 3NIWA 4MVJP 2DT8A 4Q6WA 4ND6A 4JJFA 2QGQA 1WRBA 3CVVA 3IAS1 3NNSA 3G1TA 4GP9A 4LWOA 2H54A 3GJ6A 1CEEA 4TPKA 5CXSA 1G8MA 2VJKA 3P96A 4DR2B 3U44B 4PVCA 2A3NA 2PMBA 1KJ8A 2CJFA 3NH6A 1WKCA 2ZJ2A 1BN7A 1MAWA 2CKMA 3I4FA 1VL6A 2LIVA 2VH2A 3R3YA 3IIEA 3ZWAA 1RM3A 1YRYE 3MSCA 1AS0A 1Z7EA 1Y7TA 2EJWA 4Z0TA 4FGJA 3P9RA 4V3BA 4BX0A 3A70A 2IYWA 4MV0A 4ZU1X 5I5GA 3PNVA 1UBGA 2GN0A 4NPAA 4Q12A 3LXRA 1MR3F 2WF6A 1TK3A 2C88A 2HAEA 2OL4A 3E1KA 4Q02A 2QBYB 1BCRA 5JVDA 3AP1A 1SBCA 5GJVC 2ROQA 3CRRA 1YWGO 2HC9A 4F06A 2C3PA 3T12A 4K3UA 2IITA 1JTVA 4QPJC 4CMIB 4ZXFA 3THWB 2QR2A 1K63A 4RPKA 1B8UA 1DAFA 2ZB2A 2G1JA 4A8TA 1GTSA 1A4RA 1I3CA 1ODSA 1ZM2A 3JALB 3UMYA 3HJTA 1GL9B 2PMFA 3WYEA 5LBUA 3A6PC 1M2HA 1PR9A 3M9WA 3PUXA 3O94A 1VJ1A 2GJKA 3B3JA 2R7KA 2PSFA 5CJ2A 3KVOA 2EYUA 4I8IA 1RE0A 3AR5A 3G88A 3M5DA 2EBWA 1PNTA 4HL6A 1TQHA 4JUAA 4S1PA 4Z9XA 5K3CA 4AZ3B 4D57A 2C5AA 4MCAA 2H5JA 3L6RA 3G5LA 3AW9A 3FPGA 2Q29A 1FYWA 1YB4A 3PICA 1FUKA 5BSUA 1U0BB 1XLVA 2QRMA 4PAQA 3UXYA 1IY8A 1I7NA 3KTDA 3P0HA 4GYYA 4R2KA 1TVKB 3GLHE 4RESA 1YIDA 4ZQIA 3RIGA 4NCAA 1E7YA 4MV7A 5CH8A 3C1AA 2G04A 1IXSB 2RHOA 3B2EA 3BHNA 3LQFA 3ELBA 4LMRA 1KR5A 4GVLA 3ZK8A 1O7JA 1T1GA 3UJDA 5JR3A 1CRZA 5KOHB 5BNWA 1O94D 2PT6A 4D9JA 3IRUA 1KY5A 4BFXA 3BHJA 5BMOA 2PLNA 1XU9A 5AJWA 1FFXA 2QUBA 1E4OA 3FPCA 3I42A 3T7TA 3TBKA 3TO5A 1HO3A 4KAXA 5LB2A 1NASA 2BI7A 2ERCA 4PG8A 3I8SA 4K5QA 4TVBA 4E6EA 2I3ZA 1X1TA 1WCXA 4UM8B 3AVPA 1KS2A 1ZSYA 4TLLB 1NNLA 1XP8A 3BIJA 3AQ4A 5K8IA 2M2IA 2Q46A 1B76A 4ZALA 1NXPA 3PTAA 4W5TA 1KRXA 2ON6A 3RVNA 1DRJA 3L41A 3BJEA 3MTDA 4YJHA 3RFCA 3E9ZA 3O0DA 3EXFA 4F6RA 4LWZA 3QWHA 1PFVA 4F5DA 4IKEA 4BTEA 4R81A 2EL7A 3IQZA 1CUUA 3HJBA 5ETJA 3QUAA 2ZITA 4YDSA 4L4YA 5I9NA 1LDEA 2ZKLA 3ZLJA 1NL3A 2P4EA 3BAZA 1RLMA 3DEKA 3GFBA 1M1YB 3ZJTA 2O8EB 4LY6A 2CY0A 4YCJA 4EY8A 3GCXA 4MUJA 4CEIB 5B12A 3FH0A 1DP4A 1XZNA 2OEPA 2VZEA 1UK6A 3KXIA 1P3JA 2R8XA 5B6IA 1XTTA 2AQIA 4Q1VA 1XF1A 4OK3A 4D26A 2C3OA 2NT4A 3TI9A 4PIVA 4WY5A 4BEWA 4EIWA 1CTQA 1RD4A 3SZGA 2SCUB 1CS4C 1U1EA 2K2QB 1A7KA 1E1QA 1R2QA 2VNIA 4IDGA 4RK5A 4GSLA 5FL3A 1HG1A 2G5TA 2ZS8A 4U7WA 4WN9B 4KE9A 5UKDA 2VH1A 3MINA 4MOWA 4UJ3A 5KHAA 1CDDA 1UFVA 3KXLA 3DMHA 3SD7A 5NLLA 3WL4A 1G5FA 5IKMA 3P4YA 1DB3A 1R27A 1GDDA 1QIIA 2XADA 4KQKA 5E1BA 2A9QA 4ZT7A 1DLIA 4F3CA 1V37A 1JAXA 4AU1A 3DMGA 3GEPA 3KJEA 4IGKA 4X92A 1FNDA 4GR5A 3VOTA 1GHTA 1JIUA 1KEEB 3RLFA 4CQLA 4O4LB 2FHSA 2B30A 4JI0B 4FLEA 4ALIA 3Q7PA 4KPEC 1BVYF 3H5RA 4ETIA 2QE6A 3GFRA 2RI1A 2CFTA 4JSRA 2X0DA 4B09A 3WGOA 1EFVA 1TM4E 3WGGA 2Q45A 1MABB 2EATA 3AEUA 2ZDQA 4ISCA 4NVRA 2JJYA 1XXHA 2L17A 3OT1A 3O9MA 4XLTA 2Y68A 1EUZA 4RD1A 4F12A 3I37X 3SN6A 4BJ1A 1V45E 3VKFA 3WIBA 2IOHA 2EBFX 2GN2A 4ERNA 4YRGA 5AOVA 2W11A 3V80A 5FT9A 1L5HB 1OZAA 2ZI4A 1HBJA 2BKXA 3SAJA 1GRRA 3TE6A 4I6EA 3ZGNA 1CUVA 1RJDA 1S9DA 2XH8A 1WF6A 4ZC1A 3ZWQA 1W8IA 5JS6A 3T15A 3NDBB 4RFSA 1WXDA 3NIDB 1V16A 1D6MA 2AE2A 2C57A 3AL3A 2NLOA 4XQCA 2LCQA 1TZJA 1Q14A 5GADl 3L8CA 3MS7A 1ZQ9A 2QX8A 4S0XA 1AGPA 3MHTA 1C1XA 2EERA 2YJZA 4AG5A 4DDMA 1KO1A 3L7NA 2X0JA 2GM3A 3DYBA 5DHSA 3I9V6 3L0ZA 4MEJA 4R54A 4EYEA 1CUBA 1WP4A 3M33A 3MSXA 4C2TA 2HJGA 4JLJA 5ESRA 4GMDA 4N7JA 3H83A 2NSHA 4AXXA 3CE6A 1XZHA 3K15A 2QXYA 1F9EA 1X1DA 2JJMA 4RNDB 1IAVA 4YALA 3VR2D 3VX3A 2PAFA 1IOVA 4JB2A 4RKQA 3QOYA 3WMWA 2N1MA 4C2UA 4B6SA 1AQUA 3EX7C 1M6VB 2QUHA 2JH9A 4UHKA 2OVBA 5BVGA 4XUDA 4KRYA 5LQJA 2OECA 5JU6A 3ABQB 2GEKA 2XW6A 3TRFA 4XDGA 1UDRA 2BUCA 5FI0B 3T0FA 4U6QA 3WQBA 4BAUA 1IE3A 3DZGA 4WBXC 3CVJA 1A2QA 1YU6A 3NB0A 4LE2A 3RHTA 2BYTA 1Z18A 1OH5A 3X1JA 5EYPB 1IH8A 1P1JA 2GLXA 1KOJA 1TEVA 1DTWB 1CLUA 3B1KA 1JLLA 5T4BA 2AZ4A 2X1VA 1XEWX 4G8CA 3RC2A 3KR1A 1GAXA 1U7WA 3MWJA 4F45A 3DV0A 2ZB7A 2XE4A 3S55A 1KSJA 1DG9A 1SU7A 2JF0A 3AH8A 5IBQA 3SIPA 4AWAA 1EESA 5CBKA 1V2GA 1XRLA 2QT9A 3EXHC 3PR1A 3ZV7A 1TVCA 1DO0A 2DECA 2CVFA 3D2CA 3T8YA 4BC0A 3N3AC 3R5SA 4NX2A 2CE2X 2XYHA 3N3BC 3BL5A 4WT7A 1MV8A 5GJWC 1NQTA 5LP6C 3F6BX 4KSCA 4ZVRA 1N2EA 1B8VA 1XWWA 3HLYA 4HGZA 2G9UA 2IBMA 4NV0A 5GY7A 1U3GA 1DAMA 1E8NA 1N3YA 2UUPA 4GM0A 4IIFA 4Q3CA 3S2EA 3U13A 4W5RA 3ORRA 3ADBA 4KGXA 2BM8A 5IVHA 4G4IA 4E30A 2A1UA 3MS4A 1SAYA 4QEDA 3AU9A 4R1QA 2C20A 4DY4A 2PJRA 3ZWCA 3OEYA 3R6GA 1T2DA 1UKBA 2RHBA 3C3EA 3WIEA 3KEGA 3VKHA 4TKMA 5H0IA 2O14A 2PUTA 4IJMA 3RB8A 1N8SA 4B79A 3NP9A 1F5SA 1VMKA 1S3FA 4RVUA 4GOXA 3W5DA 1LQUA 3EDQA 5CLIA 3RASA 1L7DA 1Z15A 1Q91A 4XWYA 2HNKA 3V8RA 1N1EA 4EB8A 1LDBA 1JE0A 3G7NA 3TEFA 1S7CA 2B98A 4KBYA 5KINB 4JQCA 1ISFA 4J7XA 5F76A 4RY2A 3CF6R 4QRHA 1YBAA 3IS3A 2V9CA 1AUXA 1FBNA 3F6PA 2WE8A 4D0SA 1L4YA 1XD9A 5D00A 2WTAA 1X1AA 5DHUA 5EWMB 3SEAA 3KE9A 4UCWA 4EKDA 1T9ZA 4H59A 2FEMA 2FRDC 4HN4B 2OXIA 1V8PA 2AWNA 2F6RA 2I7XA 2Q0XA 3Q9UA 4K2AA 5CLGA 2QXUA 4MYUA 3HYCA 4PXAA 3E9NA 3CW9A 3DHEA 4RXUA 3SI7A 1QUFA 3JCZA 4C4AA 1N78A 1PKEA 5K2OA 2MCFA 1AUPA 3I2JA 1Z5OA 5IAAA 2FX3A 2NYVA 5IP5A 2L19A 4BU0A 1U2QA 1L1EA 3MOIA 4FB4A 1WW2A 1UJNA 1Z2PX 2QX7A 4L08A 1FNMA 4S04A 2PQ6A 5DX0A 2Z6VA 3Q5DA 2B21A 2O23A 4A2CA 3WLEA 2HRQA 1BS2A 3JVDA 1HDXA 2YV4A 2ZANA 3AWDA 1R8SA 2E82A 2X42A 3BJMA 2JI7A 1G8JA 1C4XA 4GWLA 4CJXA 5AM2A 3KELA 2Z98A 3FOCA 4RHXA 1FNCA 1YL5A 2I55A 1FYVA 1BX3A 3GUHA 2EL9A 4AS1A 4XJVA 4ZWNA 1JDUA 2M1XA 3A26A 3AEZA 5CT5A 4KMOA 4IGAA 5EXEA 2H7XA 2JIDA 2Q5JA 5AKLA 4EHKA 2BBTA 4LI3X 3A8TA 4OSEA 4QARA 1QFZA 4EZIA 1WPGA 2Z2IA 2GNAA 3JQDA 5DLPA 4YGYA 3W04A 4UNPA 3RQSA 2IZZA 3VR5H 5K9ZA 3D59A 1EXVA 3AHDA 1UXJA 3COWA 3O9VA 4M46A 2G28A 4YA6A 1QO0D 2QLNA 4BO5A 5JYDA 1WDMA 3FCXA 3EIEA 3M4YA 4DR4B 1YK1A 1DPGA 1UBMS 4BE9A 3DC2A 3TQIA 4ZT2A 3NBMA 3WGUA 3K9GA 1CIJA 1QZ3A 2EW1A 2HIHA 4JR2A 2A30A 2P6RA 4BVFA 4V2UA 4EHHA 3D5QA 1JFRA 3TIFA 3GAAA 3QPWA 4NBWA 1P39A 4RLSA 3ZCXA 3E82A 3HLKA 4GE3A 4UNRA 3QBVA 3OJLA 3EXAA 3LV8A 3CISA 4I6GA 5ED4A 2CF6A 3KYCB 4LDRA 4QUHA 4S12A 1VXOA 4QBKA 3VR1A 4BMCA 2HMVA 4XVHA 4JI5B 5KQRA 1TO1E 3K5HA 3TD9A 4OGFA 4RS4A 5FHRA 3UUGA 1DEAA 2MYTA 1M0EA 1FP4A 3IQFA 2Q0HA 3KSZO 4URFA 3FTEA 3E23A 4I4TF 4CIWA 1O95D 1ZCAA 3O4RA 4XPIB 4Y2XA 5K0LA 1V7QA 4O1IA 3ZDXB 1JHYA 3AF6A 5CX1B 4QDKA 2C9OA 1F1BA 1EQAA 2G8LA 3C5VA 3V2GA 3OQNA 3S7TA 4DQ0A 2DVMA 3U4QB 3H9JA 3SLRA 2FGJA 4C06A 1OOEA 3IUBA 3ZY2A 4I5DA 6NULA 1RHMA 4FDTA 4QU5A 1FCJA 1UINA 3RD5A 5FDFA 1EHCA 5FB3A 4M2LA 3JQFC 5EJ6A 1ST3A 1L3IA 5EQJB 1PN3A 3GVXA 3NWBA 1BU8A 4EW6A 3NATA 4KQ1A 4CDRA 5AVWA 5BR8B 2IYZA 3ITDA 3ND6A 2J08A 2Q3LA 2WM8A 2QE7D 1SXJA 3PGA1 1G8GA 3U7GA 4ER3A 5JXHA 2GVZC 4DIBA 5FOTA 4YMSA 1KZYC 1ZAKA 4FFNA 2NUTA 3WOHA 5I4KA 1IZYA 4DMKA 4KX5A 4L8YA 1PL8A 4X3OA 1CUDA 3H5VA 2O3QA 3U4GA 4OLJA 2ZSJA 3RI3A 1ABEA 4F85A 2RDMA 4NICA 5HJ5A 4P35A 1YS9A 3OECA 2WTBA 3LCJA 4GOKA 2MIIA 5DLYA 5A6SA 3K9QO 1GPUA 4TYNA 2QVCA 2WV7A 3AM5A 3UJPA 2X8JB 4QOSA 4WOPA 4YCNA 2Y4NA 5CG1A 1C4WA 4RIIA 3MBIA 1T5DX 2CDCA 3O3OB 1P7WA 2CK3D 4I9GA 3ROFA 3C3XA 2NO1A 2ZSDA 2XSZD 3DAOA 4QDZA 5TPWB 5L95A 4BZPA 4PSVA 2DBYA 2XVMA 3W2IA 4MLCA 3A10A 4DLWA 5GPBA 1G4HA 1P60A 5EWLB 4EEKA 3HB7A 1T4MA 3NX4A 5TPZA 3DBHA 1KC1A 3C4VA 1JILA 2C00A 3DDWA 4BP1A 4EW3A 2OBXA 3Q3GE 5CVUA 1TAGA 5CFZA 4LV8B 3RQIA 3OOEA 3Q7QA 1SNYA 2D2FA 2A58A 1RMTA 1QB7A 1CJUC 2QAGC 2QSJA 4RVNA 1CBUA 1J99A 3NVAA 1IMJA 5ULLA 2XTAA 3CNHA 2FQYA 3RNOA 3UV7A 1QLWA 1RWKA 2FVXA 3FZNA 4J3NA 4BO2A 2F3PA 1PTKA 3S3TA 4DGSA 4NE7A 4Z5XA 1XQYA 1MT3A 1SCDA 1Q3TA 1Z0FA 2B83A 1GGVA 2WWGA 3D6FA 1U4NA 3GJYA 4WK6A 3RJZA 1GP2A 4B76A 5DXAA 3ZPXA 1QF6A 3QLTA 1CS0A 2Z2XA 2DY1A 3LHIA 2ZIAA 4DMGA 3DEFA 1CRPA 2D59A 4IIJF 3HKEB 1ZW1A 1E2FA 1NE2A 2I80A 4QPPA 1AS3A 3LWBA 1LPMA 1DKRA 3S29A 4LXXA 1KAHA 3DBLB 3K7EA 1P61B 4HAUA 2OXRA 4RTNA 4EYGA 3QVVA 2D7JA 3GVPA 1QDUA 5JZOA 4O3MA 4OQNA 2IYOA 3NOQA 4P7GA 1EHYA 3T7SA 4UTXA 5IWAB 1D4AA 2CHGA 3DOJA 3FNQA 2DH5A 5CEEA 4YJ3B 1I1HA 1LFDB 1OXVA 1WBDA 3BEOA 3OG9A 2CNKA 2JAHA 3Q5GA 2IYXA 4UBOA 1H2RS 4LJ8A 1ZK4A 5FQOA 3TTWA 5K0BA 4J3FA 5TIIA 2IYEA 4M7WA 4LHZA 4QUKA 5FFNA 1V5IA 5JH7F 4IJ5A 3IPYA 3ZH9B 4BFLA 4NY1A 3ZHOA 2ZZMA 1HI9A 1ZWKA 1XEFA 1VFPA 2BT4A 3GLRA 3GYGA 4AF7A 4CPDA 2RGEA 4IOMA 4BB5A 4YT8A 1K2WA 1CUXA 3SLKA 2BFDA 1GY8A 2JHAA 4BV8A 3KQSA 2I3BA 3QVTA 1G5QA 4NOJA 4J16A 3KAKA 4JLKA 4BNKA 3FUTA 3WKAA 4TT8A 4NNPA 1H9BA 1RQGA 1THGA 5LQKA 2DERA 1TU0A 4AY5A 5JRJA 4GRDA 2VTBB 4XVQA 4U2FA 3ZKWA 4E09A 3DZBA 3T7RA 4O29A 1P0QA 3DLHA 1KA9H 4ZJZA 3EWSA 2IYLD 3R0ZA 5GZ3A 2BBSA 4ZZ1A 3RG2A 1XQ1A 2HT6A 5SY4A 1NMQA 1JTFA 3QZUA 1JHZA 3QOWA 4OTZA 1D2AA 2KWIA 4K6MA 4JI6B 6PFKA 4NFYA 4P9NA 1H2BA 4E21A 2XQFA 4EO4A 2VHTA 5EEGA 2W8ZA 2AJLI 4HWGA 3O2JA 5JOQA 3FNGA 4DSAA 4NU5A 4IILA 4EYOA 1WCIB 3L4KA 2F3QA 2R6ZA 4OK6A 4DV7B 4PYQA 4D5EA 1CUYA 3DVAA 3OBBA 2H0AA 5DCYA 2OHJA 3ZCQA 1E6MA 1XV5A 3ADOA 3MJTA 5C31A 1A8PA 3KFLA 4TWBA 1PGQA 1C8LA 1E79A 1EK5A 1FMJA 1NDUA 1TGYA 2PGJA 4OHVA 3WDMA 1LF0A 3WKBA 3IKVA 4D97A 4WEOA 2OXFA 5HUHA 5HZGA 5IT0A 4IMJB 2HA0A 3GZNA 2N47A 1JAIA 1COZA 1C3JA 1Z82A 1B0UA 2ZRQA 4DV5B 2HJVA 5U1PA 1KAEA 2COUA 1UMBA 1RXSA 2QDXA 2REBA 3MT8A 5HTOA 2DR2A 1D07A 4JUCA 3SXPA 3IBTA 2Z83A 3AXTA 3PWKA 2W6ZA 4MR7A 4XASA 1ETUA 2AJTA 4KN8A 3WV4A 2WOOA 3OE4A 1JQAA 1CDOA 3MT9A 5CK5A 2BFCA 2D62A 1HDYA 1ZK2A 2NSDA 1TUBB 5JNLA 4F91B 4YAKA 3VAYA 1TK9A 1NI5A 4HYYA 5D5PA 5GOZA 2EW8A 3OD5A 4NV3A 2X4DA 1NV9A 2Q5HA 2JIRA 3QUTA 1YHZA 2HSJA 1WB6A 5FHQA 3TL2A 2O20A 1Q3HA 2WLTA 3X1DA 2OFXA 2WFLB 5ALTA 1THZA 3HCRA 5E8JA 4CBVA 4N76A 3UK7A 5IKPA 2O8NA 1T2UA 1JYEA 2VUIB 5HOQA 4QTYA 3FWNA 4ZT4A 5CURA 3PPWA 3AF1A 2C4WA 1ZGAA 5K7SA 1VJDA 3CONA 1B8NA 3TJMA 3MTEA 4ZYZA 7YASA 5EJ7A 5LPNA 1FQJA 2X6RA 4XR4A 2NO0A 4ZZIA 3ICPA 5DT9A 5IBPA 4BU1A 3W5BA 2B7LA 3Q2IA 1NXVA 4JD5A 3FPHA 4LYDA 2Y77A 3D4LA 5H1YA 3R3WA 2FSSA 4ZK6A 1HC7A 4Y1FA 3TPFA 5LB4A 1EUCB 4P8RA 4NPHA 4RM2A 1G5IA 3NRCA 2X5NA 4J4TA 4I55A 2OILA 3DQQA 2XNCA 1YV9A 3LDHA 4I4TB 1NR5A 2JW5A 5I4BA 4OUDA 4XLZA 1U5BB 2CHUA 2R00A 3IR5A 3QU2A 2CXSA 1AU9A 4I1YA 3UMGA 3CSUA 3GZ4A 3KHSA 3PYXA 2AF3C 3H9BA 1V4NA 4MS1A 1ML3A 4F11A 1BRTA 2KBFA 3I01A 4NZZA 3L04A 1QP0A 4HNRA 1JMYA 3U19A 5KPDA 3NWEA 5CLHA 3V4LA 2NG1A 3MTQA 3NHAA 3LUFA 5EJ8A 3DTVB 4NV1A 3OFND 4IHAA 1LUAA 4DLAA 1CDZA 3K1YA 2H1FA 3OU7A 4AY6A 1BKSB 2X77A 3L5OA 5C5EA 1GNLA 4R1OA 1RRGA 3KAQA 3WIOA 4DLTA 1W7AA 2VDRB 4DIDA 4Z2AA 2ZUCA 4AF8A 1JEQA 1SHJA 2VDOB 5KUTA 2I7DA 4IHKA 1I4WA 3ECCA 1QHHB 3NAGA 3ECAA 2AWOA 4D4LA 1XSEA 3HM2A 4B7UA 4NNOA 2JH8A 2NYRA 3UUFA 2IYRA 2PXCA 3DSRA 1Z3CA 4COOA 3U62A 4U2EA 3L9XA 4UNQA 5BWNA 5HDQA 3ZU6A 2FUG6 2J5RA 2AOTA 3R0QA 5IN5A 2DFNA 3FFTA 4IV5A 2R66A 3GFVA 1OX4B 4BZXA 3TTVA 3OQHA 3F1LA 5FBHA 2PUFA 5F3RA 3A3NA 3I04A 2HD4A 4ZI3A 4Q3AA 4EI2A 4KZPA 4R1PA 1CJTC 4YTEA 2XKJE 1B2RA 3JWPA 5JIBA 3P9IA 4ZYVA 2CGEA 1IHXA 3LC1O 4FNAA 1NJ6A 4M99A 2PGOA 4XIJA 1PR0A 4NZOA 3ZV5A 5A04A 2PTHA 2P9JA 1RYHA 3LBFA 4J4BA 2ZW9A 4N65A 3RS2A 1V71A 5AO9A 3K9LA 1X7WA 4Q3LA 4CT4B 3V1TC 4OHRA 1JHPA 2FRVA 2H7VA 4FQ5A 1G8HA 1ZBDA 2PUHA 2R1VA 3O92A 4MR9B 3FNRA 4UFOA 1DS6A 4B6JA 4R2XA 4DHWA 2DBQA 3WMFA 4NBRA 2DR3A 4DDUA 5DH9A 2OHIA 4UNNA 1PVOA 4KYVA 3EH1A 1BA2A 2RI0A 2Q49A 3IKLA 1KPIA 2QPTA 2C3MA 3ULKA 3C1UA 2X4LA 2XQKA 4P98A 1E2GA 5G0VA 3GG9A 1U02A 2JBHA 2TMKA 3BRQA 4P1ZA 1Z5NA 1XNJA 1ZH6A 1KETA 4OVKA 3U3JA 1FMTA 1R6AA 3EPRA 2XRMA 4LTNA 4ETNA 2QNRA 1PT5A 3QENA 1A8QA 1KZ4A 1E3SA 4F5EA 4IIJB 1ZR2A 1CZKA 4R16A 4LX8A 1YDWA 4MW2A 1N2HA 4KUHA 2PL5A 4UXHA 5AKZA 3NUZA 5KJEA 1Q1QA 1NRWA 3VI3B 5BT8A 1U9IC 5ALRA 2BTQB 5L3VA 3RAFC 3A2KA 3AQIA 1YS1X 2P27A 2NU9B 1NJ8A 3N39C 2XMDA 4NJMA 4Y7DA 4I50A 1O58A 2FSPA 4DPLA 2ZJFA 1CJKC 1F60A 4Q05A 5D5HA 2XWBF 1E7RA 2IEGA 3F2VA 3AZQA 3FA2A 1R10A 3PCXA 3PUHA 2FF7A 2JIOA 3SG0A 1QKJA 5DM60 1NJ1A 1YMVA 4XXHA 4XYMA 4B3DA 2FEXA 3A1VA 1IZ8A 3E7DA 3MZ0A 4S3MA 4X41A 1VOTA 2OHGA 3PUYA 1N6IA 2Q41A 2Z57A 3JAKB 4G65A 5JH7B 1EU1A 1VBMA 1BX1A 1AKQA 1HFJA 4IL5A 1KEZA 3IIIA 4GUDA 3CB4A 1AZSC 2XHZA 2A9OA 3DH0A 1CFJA 3SC2A 3JASB 4FI3F 2HK8A 1SUIA 2CXTA 1ZJ4A 3RW9A 2YV1A 4B8YA 4D0RA