4K9RA

Spore photoproduct lyase y98f mutant
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
340
structure length
340
Chain Sequence
b'KPFVPKLVYFEPEALSYPLGKELYEKFTQMGIKIRETTSHNQVRGIPGETELARYRNAKSTLVVGVRRTLKFDSSKPSAEYAIPLATGCMGHCHYCFLQTTLGSKPYIRVYVNLDDIFAQAQKYINERAPEITRFEAACTSDIVGIDHLTHSLKKAIEFIGATDYGRLRFVTKYEHVDHLLDARHNGKTRFRFSINSRYVINHFEPGTSSFDGRLAAARKVAGAGYKLGFVVAPIYRHEGWERGYFELFQELARQLEGMDLSDLTFELIQHRFTKPAKRVIEQRYPKTRLDLDETKRKYKWGRYGIGKYVYRDEEAKELEDTMRRYIEQFFPGAYVQYFT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spore photoproduct lyase
publication title A radical transfer pathway in spore photoproduct lyase.
pubmed doi rcsb
source organism Geobacillus thermodenitrificans
molecule tags Lyase
total genus 124
structure length 340
sequence length 340
ec nomenclature ec 4.1.99.14: Spore photoproduct lyase.
pdb deposition date 2013-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4k9rA01
3.80.30.30 Alpha Beta Alpha-Beta Horseshoe pyruvate-formate lyase- activating enzyme pyruvate-formate lyase- activating enzyme 4k9rA02
4FHFA 4FHEA 4K9RA 4RH1A 4FHCA 4RH0A 4FHGA 4FHDA
chains in the Genus database with same CATH superfamily
2YN4A 1GY8A 3C39A 3SZRA 2ONCA 3MAAC 3ZWVA 3GUVA 1U9IA 2CN1A 3QF7A 1H4QA 1OLSA 3OH8A 4OXYA 4D45A 4DY6A 4ETNA 1WCXA 1XQ9A 5EN4A 1M1NA 4R8MA 1XVLA 5KTRA 1UKVY 5KKNB 5DGXA 2FUNB 3M2TA 5CXQA 1QUEA 5FTNA 1X0VA 2BFBA 5TJ9A 2O2XA 3E81A 1JQ5A 2V7BA 3H2JA 4LDNA 3RAGA 2RHOA 4S35A 1L1FA 3ZGYA 3LUPA 3PD1A 4YJFB 1KAHA 2XHZA 3ZG6A 4EZEA 2DR0A 5IJWA 3TSCA 4RCZA 1XYVA 1O7JA 3E3LA 2PGIA 5F1YA 4WXEA 1C0KA 3VZSA 1K8RA 1JU3A 2Q3MA 4GGOA 3GZ4A 3N2IA 2XGGA 3RT1A 2EX1A 5BSKA 5YASA 1B7GO 5K2OA 3SQNA 5BR8B 4GVPA 2H2AA 1U65A 1V11B 4EFMA 5L40A 3CLRD 1EJ2A 5JR3A 4UJ5A 5KOJA 4NX2A 1X94A 2EJBA 4KE9A 4OF4A 2XQVA 4UD6A 4B2PA 4C6RA 2OWEA 1IK6A 1LU9A 1E0SA 3GVCA 4EO9A 4ETWA 1FC0A 1DC5A 2IZ5A 2OBLA 4FW8A 4I5FA 1G5IA 4LNUB 1ULSA 3LWZA 3FMPB 5JZ9A 2OBYA 4JI6B 5ILQA 1HA3A 2XQIA 2DPXA 4HCJA 4QELA 2F64A 5CU7A 3TL3A 3WLRA 3GLQA 1H6AA 3MZ0A 4JOCA 5B5SA 3AB8A 1H2RS 3RSCA 3U3OA 3VYTB 1E77A 5HKKA 4I99A 1DHTA 2V5VA 3VR5A 4X6UA 3W8EA 5KMGB 5LQKA 3TQRA 3R3UA 4HFNA 1TM1E 3T6KA 1QOPB 1YHNA 2YJNA 1HDYA 1U7HA 3HB5X 1OBOA 3INYA 4ODIA 1SCDA 1VZ3A 3D2LA 2QORA 2FXIA 5BRAA 1GTVA 1E9FA 1ZNQO 2GM3A 5ENZA 1P5HA 4Q1AA 1JJFA 3LKDA 4FX2A 4GBMA 3SCZA 4HWPA 2EWVA 3ORQA 2EFCB 2BW0A 3OQHA 4HJRA 1D8AA 1W93A 4NRDA 3TJZA 4DDTA 1Y0BA 1JT9A 3TAHA 3T35A 1AV6A 2GYYA 3IQZA 5IHXA 3MRSA 4MK4A 4B74A 2KBEA 1CY6A 2OK7A 1RYBA 2PLFA 4JLAA 6REQA 4NOMA 1LX6A 4RAOA 3ONVA 4CMBA 4DCSA 4ZI7A 3T1TA 2G36A 1NRJB 3SU8A 4E46A 1WP9A 1HE1C 2ON6A 4IWYA 4HKTA 3VC2A 1NVAA 1IY0A 4YASA 1VQ1A 2V7VA 3FYSA 5FHRA 3UG7A 1N7JA 2JS7A 2RG7A 3CN9A 2WSBA 2VT2A 3FOWA 3B78A 2YC2C 1P4HA 2OFPA 2WHPA 3BIJA 4HDMA 3GRCA 2YMLA 1R9NA 4H59A 2YYYA 4PAQA 1KMCA 1O58A 2CLOB 4DLTA 3PFKA 4EL0A 1QRRA 1WW3A 1ZC4A 5BQOA 1RYZA 3P8ZA 3HMKA 4BNTA 3JYNA 1GDTA 3FNEA 3D6HA 1N2BA 1W59A 4ZVKA 2GZAA 4BAZA 2GBIA 5FBRB 4HAXA 4B80A 3TRKA 3CEHA 3DHWC 3WYAA 1DDOA 3I5YA 3FOAA 1JHUA 3MCWA 4M0UA 4RKYA 1SBTA 2GQ0A 1T1JA 1A4XA 3BQNB 4RK6A 4P0PB 2P9YA 1FXSA 1PT6A 4E1BA 4QQRA 4DCCA 5A4MS 2EKQA 4IZIA 2AEJA 2X13A 2ZKLA 4PG5A 4C0QC 1MMFB 5CEJA 2HHJA 4OYLA 3FFAA 4RLSA 3GG9A 3KVYA 3GN2A 4PZCA 4D41A 2FWMX 3E27A 3GCXA 1DWOA 4HVAA 5JNTA 1G8KA 3RHTA 1PK8A 2GFQA 2KLHA 3HFGA 1G9SA 4MRAA 4UOQA 4PLPA 2W83A 2HCFA 3G0OA 4MAAA 1R1DA 1N1MA 5ALFA 5AXBA 4C3VA 4ESEA 5C35A 4KAAA 5KHOC 1QZZA 2WWGA 2CLHB 3HJGA 4L6AA 1G8JA 1MDFA 1WMAA 4LE1A 1AZSC 2QX8A 5FXMA 3QOYA 1J06A 5BRNA 3WGQA 1OLSB 2FX5A 2FFRA 2CBXA 1FP7A 4RKRA 1UM8A 1NUQA 2B1QA 1M1NB 1Z73A 2IHBA 2QGFA 1SU4A 3BYZA 2G0AA 4YEDA 1I2AA 5AM1A 4Z9XA 4AKHA 1IOLA 1ZCJA 1KC3A 2PSDA 1WUYA 2BFBB 3RJZA 1Q0SA 4N0EA 3TKLA 4AM8A 4CGZA 1XQ1A 3TFWA 3P19A 5H7XA 5E9AA 2QTRA 5DMHA 2INGX 4BE4A 5LL6P 1YL7A 3H9CA 3GUZA 2EHDA 3R6TA 2Y1WA 4Q9HA 3Q10A 3JD0A 1MW9X 2XXBA 1NFQA 3UUWA 1YB6A 2LKCA 3EVBA 4N3BA 5CVDA 4YFVA 4YMSA 1HLFA 3RUDA 2VYQA 3A10A 4YAIA 2MSEB 2FOLA 1YOBA 2C7PA 4KXNA 3CWZA 1F2UB 1DJOA 3U5TA 1G8HA 1LWOA 2W58A 2VDWA 2OLEA 3ROFA 2DOKA 3B12A 3BJRA 1JDNA 2C2MA 2HJHA 7GPBA 5KOJB 3AIMA 1V41E 1YBMA 1CNMA 2K87A 1QS0A 2FA9A 3DCNA 4QPPA 3TTTA 1RP7A 2EX0A 2P2DA 3I73A 3C16C 1J0AA 5DLYA 1ZU4A 3ANXA 1HC7A 4OHBA 1UADA 3N2KA 3WLTA 1JG7A 1GLNA 4MVJP 2HNKA 1HNNA 2FPOA 2R00C 3HRHA 2W6CX 2ZAGA 2FPPA 2Z4TA 4QBGB 1FS4A 4NP6A 4X7RA 2X5XA 3RRFA 2BM9A 4X61A 3X2EA 8OHMA 3NM4A 1YB2A 4FPXA 4KOAA 3T52A 5AM5A 4EI7A 3AVVA 3MMPA 1JYSA 3GK3A 2WYWA 2ID9A 3NOVA 1ZD2P 4LDQA 2FSUA 4M9UA 4PQEA 2HWYA 3SFTA 5KC9A 3UHPA 2OHXA 2ZR8A 1UPBA 2YWXA 4TGLA 4U2DA 2VH1A 5AO9A 4FN4A 2CBZA 3STVA 3WGHA 1VHJA 2R1TA 2SICE 4Q01A 4CKCA 1IUNA 1TL7C 1M2EA 2Q7OE 1GN8A 4WGFA 3EJWA 3V4LA 1A2QA 1TZKA 1H0SA 4D92A 4O1MA 4HT3B 1U2PA 1QH1A 1A3CA 1MH1A 3FJYA 2AEFA 5GAJA 4YXFA 4UARA 1Z82A 1SN7A 4JC8A 3WLQA 6REQB 5JHGB 4ZI7B 4LSGA 4D9JA 1GDHA 2DETA 3PNVA 4IF4A 4X20A 2C83A 4RL6A 3PENA 1UPCA 3TO5A 2FOIA 3B6IA 5AJVB 1W0JD 1Y8AA 3K0CC 1KU0A 4B35A 2YHUA 4BVJA 2WHPB 2FW1A 3L46A 4HDMB 4PAWA 4J03A 5JHHB 2I4LA 4HNSA 3FZQA 2ZATA 3OTGA 1LPNA 1G2IA 3SS9X 1NPTO 5E4FA 3A4VA 5KOYA 2HXYA 3LD9A 1W5TA 2HHHB 1T8TA 5JCJA 4Z0NA 5TT1A 1V45E 1IB6A 1WSDA 4G5GA 3CVYA 2GN6A 4UBIA 4M0EA 2WYHA 2WJWA 3RYHA 3PK0A 1JP7A 2HAEA 3EFHA 4WLFA 2OHHA 2Q6KA 2Y05A 4FQ7A 4PY2A 5E8JA 4FDTA 4YV2A 5JJCA 3L6UA 1JG6A 2GD2A 3TW0A 1QZUA 3WP0A 2A1TR 4FONA 2JK0A 3K2EA 3HSYA 1YFKA 2CL0X 3AZOA 1LK0A 2LVBA 3P0IA 2GEKA 4RPCA 3STHA 4A92A 5IC6A 1WXWA 3OJCA 4G07A 3SFVA 3JAMA 2RJOA 3WGMA 2WZDA 3AOEA 1G21A 1QVWA 4YT2A 3CV3A 4DXDA 5CIQA 5CDUA 1JH9A 4MP8A 3MWGA 4OQ4A 1I6KA 3V7NA 5LDHA 2CXOA 2PAFA 4RDIA 3W5CA 2C9DA 1IB0A 3N75A 2QZ9A 1I7NA 2YS6A 3I1YA 4G09A 1QV9A 4I36A 1SUEA 4Z7NB 4BNYA 2H2HA 2R6FA 3QF4A 4QULA 2AZDA 4D3ZA 5TC4A 3G2NA 1MRSA 2GXQA 1N3IA 3KE8A 4F2HA 3S2EA 1RTTA 1Z4MA 5HMLA 5KTKA 1D09A 2P3OA 3STUA 1C50A 3LDFA 1GZ7A 4JCOA 1IXYA 3UMRA 2XRMA 3FETA 4LE2A 2JKZA 3PPIA 3INTA 3C48A 2CLIB 2R4QA 5BSTA 4G4IA 2AX3A 2Z6UA 1GG9A 3UATA 5B6IA 3CRW1 1C0IA 1R6XA 2PUFA 2VDWB 4G1UC 4JODA 3LRTA 1JI3A 1XRPA 4TWJA 4W5OA 1PZEA 4P08A 1C3JA 5F9MA 3U4MA 3QELA 1QS0B 1KOFA 1F60A 4LECA 3CLKA 3FIJA 5EE0A 5EMNA 4KL8S 3N2KB 3L8MA 1TEVA 2QR3A 3L7CA 4I6GA 4QGGA 2JGFA 2IEZA 3MGKA 4DN6A 1GQYA 4AY2A 1DX9A 2G0NA 5DT9A 4K81B 1U81A 1G55A 3EDRA 2FPPB 4S2EA 2GBFA 3LVQE 5FWDA 1I2BA 4DPMA 1XZGA 2W11A 2A7QA 4OH1A 3IH5A 1B8PA 1RYMA 1S7CA 3AT1A 4QT0A 2JIMA 3U62A 1E66A 3GJ0A 4QX6A 5LOVB 3OP1A 2JLVA 3IQEA 2F4VB 4MVYA 4FLEA 4KSCA 4HNHA 3UK1A 3O4JA 4JSTA 5D3KA 3TXXA 3KM0A 1AY0A 3KSUA 4CKCB 5FD8A 2R1TB 3L43A 1YOVA 3OETA 3QTLA 3L06A 1US8A 2AE1A 3OD1A 3C3EA 4BNGA 4L15A 4IOMA 5CT9A 2V7UA 3H17A 4S0XA 2RHBA 2W8BA 1KEZA 1KI1A 3NV7A 1PFGA 4FXOA 4GR5A 5BWBA 4KR9A 1QH1B 3EVTA 1IM5A 4YJKA 3GLSA 3ZJVA 1NXPA 3UENA 1T1GA 1Y1RA 4AS3A 5K8LA 2ISSD 1V37A 1JE1A 1MZVA 3QP9A 2XB4A 4RHCA 3A32A 3QVSA 1IXRC 5FUWA 1I2ZA 5F77A 2D2VA 1OZFA 1P2BA 4H3VA 3QG1A 4X20B 3DTVD 3HP1A 4OCZA 3A06A 4PIVA 3WIOA 5ICSA 3RK1A 4O1IA 5ALQA 4LJ7A 4R9UC 2I34A 1VKOA 2VYFA 3BPSA 1C3VA 2YV3A 1QYVA 3M4XA 4MKFA 4KI7A 1EA5A 1THMA 4AG5A 3CZPA 2Q27A 4H9GA 1TGVA 4F4DA 5DRYA 3A1WA 1PJQA 2D0OB 4KX5A 4NJMA 2QN8A 4PXSA 4AICA 1TPZA 2XRZA 3EXFA 4B3SB 3RSZA 2ZJ0A 3AILA 2C0PA 2YY5A 4KRYA 5IM5A 4FT2A 13PKA 2BH2A 2DX7A 1PR5A 3CO0S 3RKRA 3RYHB 1ZVKA 3GFVA 3K9BA 3LKZA 4C5AA 4QU0A 4Z2AA 1LJUA 2WYIA 1Z34A 2A78A 3I76A 4I55F 1A4UA 1O5IA 1OA0A 4II3A 4AFNA 1Y3DE 4IOJA 2VWPA 2X42A 1Q7CA 3D7NA 4L7QA 3U7RA 3IDAA 5A02A 5BQPA 1TUEA 2QLLA 4XD2A 4XGKA 4BFZA 1K6MA 3KB1A 3FGNA 1KFJB 8GPBA 1ZIYA 3OUTA 3BCSA 4LV6A 3F3MA 3GFFA 4I1YA 1IHPA 4Q66C 1MEEA 1OH5A 1G21B 2HUNA 5EE9A 5ELLA 3U4GA 4ZJPA 5B7PA 2AW3A 1M76A 1U8CB 2A5FA 1C8LA 3HKBA 3JWJA 3ZHVA 2BM8A 4L2IA 4BLSA 5ANRB 2X1MA 2IXGA 3HH8A 3REFA 1V8DA 2ZTSA 3ILVA 1WF6A 2HRQA 2FGJA 3QKTA 3LUAA 4Q1EA 1X9IA 3QF4B 3MHTA 3HACA 5A3JA 1OXSC 1P2UA 2I7XA 2IYZA 5G4KA 2BTOA 3WLSA 5K8IA 5B3JA 1COWA 3HL0A 1A96A 5ALGA 3P0JA 4JC0A 4TXJA 4IH4A 2NV2B 4V2IA 2FPUA 1THGA 3GL9A 2XDYA 4EGJA 3ETHA 4RU1A 3C1AA 1U98A 1T8UA 5KNCA 4JEMA 2FMFA 3QEJA 1MCZA 1TQ2A 2C8JA 4UHBA 2FZEA 3OFKA 3WE7A 3IVCA 2FR1A 5AJYA 4H2DA 4DARA 4XCVA 4OK3A 3P0HA 4LI0A 5DBGA 1DMSA 2E85A 3QELB 3IBGA 4GLFA 4GWLA 2Q1SA 2JHAA 3OI7A 4RQBA 3TRJA 3N8NA 5CB8A 2I54A 2XZPA 1RYDA 3BICA 4CKEA 2EDCA 3GEIA 4IRMA 4JXJA 4OP3A 1JHQA 1S2GA 1Z6YA 2II6A 2DQSA 4CGYA 2X2OA 1E5VA 5HM8A 1ZUIA 3LLVA 5KI6A 4ZHQA 4ZO6A 2Q5LA 2XB6A 3L6DA 3I2FA 4GX2A 4BBZA 1ADBA 4R0VA 2R5WA 3FDZA 1H1TA 3U2QA 3ADOA 4AMYA 4QT4A 3PEWA 4BN0A 4OX9Y 1X42A 1ENPA 1QH9A 4I9UA 1FVXA 2IUEA 3CONA 4PXYA 3P9QA 4XUCA 1QZ3A 5DM1A 1HDXA 2JFBA 5FQOA 4DC9A 4DB2A 2C9CA 3RM3A 3LT2A 3OX1A 4KO2S 3GFBA 4R2KA 3CNQS 3MXTA 4TKUA 3T7KA 5E3HA 3GX1A 3HCAA 3NBMA 3MERA 1E89A 1YOVB 4Y1RA 5JY1A 3ZU6A 3SHVA 2FSFA 1E5DA 1MQAA 1US8B 4GMKA 4DE5A 3ESAA 5HQJA 1NPDA 2I65A 5EIFA 2R5FA 2FJ0A 2R7AA 2W8BB 1YDFA 1MJGM 4JOQA 5EXPA 2PT5A 4ZCRA 5EJ9A 2Q5EA 5C7OO 4YQYA 3DFKA 4JBHA 4EG5A 2XMRA 4FUQA 1OAOA 7ABPA 2PSJA 4RPHA 3IKLA 4FD2A 1IHDA 2ZETA 4A9AA 1O97C 4IHQA 4HQFA 4RL4A 1GO2A 4XFKA 3FCSB 3ITKA 2IYNA 3LHDA 3OU7A 5E4YA 4Q9LA 1E9BA 1X3LA 3ZLBA 3PDCA 4YRCA 2GB4A 4U4AA 4AG3A 1ORHA 1OAKA 2A9KA 4NZOA 1ISIA 1WCWA 3V4FA 2J6BA 4JI5B 3U37A 3WNZA 1M2OA 3A2NA 4KIUA 4KRXA 4M7OA 2Q5HA 4NJMB 4WFKA 4DIKA 2I4MA 3EXFB 4P4SA 3CO5A 1B15A 2O3RA 1UJNA 2HM7A 3ER9A 3NFRA 2AZ4A 3JCZA 5EIWA 2VP2A 1JJAA 3G5AA 4JUDX 2PS3A 1B73A 2GPJA 1SHUX 3KZNA 4TS4A 1GILA 3W5SA 2H1FA 3O8BA 4PZAA 1DV2A 3H2HA 3DOFA 3ZE7A 1AB5A 3RVNA 2HPVA 4ME6A 2NZ2A 3AVYA 4P84A 2ZRFA 3VYWA 1OE0A 1JKXA 1YK0A 5CFQA 1VMIA 2YN2A 1EFCA 4QOGA 5BR4A 3HBMA 4YMLA 4WFQA 1XMJA 2BJHA 2QQGA 3SQWA 1IVNA 2FSGA 3KXPA 4OYRA 3GJ3A 2XCTB 3GCZA 3S2SA 1FYWA 1QYDA 1PRYA 2PWZA 4G5QA 3RV3A 4BAUA 5IUJC 1M6YA 4BNJA 1YQTA 1P74A 4HYQA 1JHAA 3HKBB 3N39C 4L2IB 4GLJA 1RCUA 3DXXA 1A9XA 4WA8A 3QYPA 4GP6A 2GO7A 4MA4A 5EJ4A 3UMMA 3GLRA 2HBYA 2RDMA 3IPCA 4BTEA 1HOTA 1RZ3A 3DO6A 3NRJA 1GZDA 4Y9TA 5G4KB 3NBFA 4RKQA 1Q7GA 2CHEA 2QY6A 4NFLA 1I9CA 4K7JA 5GGYA 3GRYA 1HLDA 1XTBA 4C4PA 4L9WA 1P1CA 3W79A 1CF2O 3TLMA 2BGIA 3PHJA 1YS9A 3I9V1 2CLFB 1XTIA 5EQFA 1T26A 3I61A 1CR4A 1QRAA 2XITA 5HW0A 5IKPA 5JSKA 5IVPA 3IFSA 1JBQA 5LFAA 1TTPB 1XP5A 3M3HA 2AOVA 2F9MA 1B23P 4PX5A 4WLOA 1BKDR 4P6VF 4FINA 2R4UA 1KMMA 3KWJA 2QDXA 3HJNA 1K68A 4KWTA 5IDQA 5I8ZA 2AYYA 2ZDHA 3C3YA 3D8NA 4CKEB 1N1EA 1GVHA 4UQLA 1ZUD1 3OZEA 3HBLA 5J2UF 3Q3VA 1JLKA 1T0BA 4KN6A 3T3MB 2O2CA 4AYXA 3ZZUA 1Q7BA 4PYJA 5KS2A 4TL6A 5KNBD 2J31A 4ZHQB 3QSYA 1P17A 3NNNA 3WO0A 1V5GA 1TU4A 5K0CA 1P80A 1ZNWA 2Q99A 3FDZB 4D0GA 2DP4E 2Q8QA 3W5AA 1W88A 3DOJA 2PWAA 2Q4DA 5CJJA 3D4OA 3ZV7A 9MHTA 1FVFA 1Q0ZA 2ICAA 4GYKA 1DBSA 1ORRA 4HAUA 1PJBA 4KK4A 4R0NA 3UT0A 1FNNA 1JHPA 1G20E 1HI9A 1JW9B 4TKUB 1NF2A 4Y1RB 3ZOKA 2ZVPX 1WEKA 1W46A 2QPOA 3AZPA 4WD3A 4DM4A 1P3JA 5EHIA 5GPBA 3ND5A 2W2LA 3LUFA 3ONDA 1YL5A 1UC5B 2FU5C 4LY0A 4QYMA 1Y89A 4TRMA 2IYAA 5KNDH 3G2PA 4KXYA 3KEMA 2VJAA 5ALZA 1P5ZB 1J20A 2OM6A 5EHNA 3E7WA 4IL5A 5EWLB 3ZXIA 3GAZA 4M88A 2QJOA 3T0IA 5A0TA 5ADVA 1LBSA 3FOBA 1FBNA 1VIYA 1QGOA 3MS2A 4G9BA 1ZG3A 5EE1A 1LDGA 1NV9A 5KYWA 1FP6A 4EY4A 2PXXA 4E5UA 3RT9A 2PJRA 5THXA 3I4LA 1K98A 3I9LA 1ZRNA 4TM7A 1K0UA 3O9ZA 3L40A 5JRZA 2CCKA 1G42A 1L5RA 2H8GA 2J32A 3KT3A 1GVNB 3ORYA 4NMXB 4FW9A 1W4LA 1K97A 2H52A 1M2OB 1C30A 1RQNA 2AE2A 4MUKA 1F17A 1KDTA 5H68A 5CIYA 1LTHR 1XDSA 2AOUA 3KQOA 4P4SB 4W7SA 1WE2A 4GLOA 3X1MA 1LZKA 1Q83A 3F97A 4FMDB 4IJKA 4Z1OA 1M7HA 4R1NA 4LGMA 1T3TA 5K99A 5JE8A 4OMFG 2IYWA 3HYLA 1AKTA 5FYQA 3GNTA 5DRTA 1CDOA 2XUZA 2JFOA 4Y6SA 2ZIAA 3KHTA 3QPVA 4KDCA 1WXQA 5EEHA 1D7AA 3IJRA 1ZGBA 2BEVA 2R1UA 5EIBC 1EMDA 1EXWA 1NW9B 3Q3GE 1GSIA 2I33A 4TTVA 3B2QA 4ZQFA 2B0CA 5H5JA 1CDDA 1MO2A 4PNPA 3BMXA 2PRYA 2GCGA 4WNCA 3HXKA 5DCWA 2VHEA 5TS3A 3UKDA 1AGYA 1I3MA 3G6KA 2J4CA 3IE0A 5LP6B 4QU8A 4MR9A 1T9GS 3JARA 1OLUA 1RXSA 4I4IA 2OXRA 4IF6A 4D43A 1FTYA 4UEKA 4Q37A 1RKBA 2W6NA 1A9XB 2J7KA 4P7GA 4FHGA 4BO8A 3UMGA 2QXUA 2PT6A 2ZXFA 3GELA 5EJMA 3RT7A 4YDSA 2LBPA 2OCLA 2ID7A 3L1HA 3PIDA 5EHGA 4GECA 2ZRKA 1HURA 2ORIA 1MQ8B 3LVRE 4QTTB 5I7SA 1XPOA 3IO3A 3RAPR 1AK1A 3DF7A 4DDMA 1PG0A 4DLWA 2ECPA 3AH8A 1FRQA 1Y9DA 3VBEA 4BUJA 5AHXA 3UZUA 5J4LA 2HJRA 2X22A 5H70A 2GTPA 1GLVA 1SXJE 2WYUA 1CJKC 3A9TA 3O03A 4D97A 2ZB7A 1NNSA 3CHYA 1RCFA 5EJ5A 4A5OA 3ZV5A 1JJIA 2X76A 4KR0A 3V7UA 3NC4A 5LXTA 1KDPA 3BKXA 3DQQA 2ZWVA 5G0UA 3C7AA 4KODA 1OZ0A 3IUMA 2QA5A 1RAAA 1DIRA 2GN0A 1N5KA 2PUHA 2CXUA 2YNMC 3IAS1 2PZ8A 4BAGA 3FUCA 3QUBA 4AMVA 4EITA 2AQHA 2V3VA 3PKJA 3O47A 5FX2A 1M72A 5TS2A 5AT1A 1SKYE 1L4LA 3C3XA 1X70A 2HYDA 3PQ3A 1C9DB 1ZI8A 2B2CA 2FZVA 2XUAA 4M1ZA 4MUEA 3DAPA 3DWFA 4U2EA 3GJTA 4MCJA 1RT9A 1W88B 1W4AA 4QDXA 3LKBA 4POOA 1JALA 2C58A 5JPCA 1UJ4A 3D6NB 4DMHA 4OMDA 1U99A 2RGXA 2FFBA 4MQUA 3V4ZA 3CEAA 3A6PC 3KOOA 4Q3CA 3FVWA 3HVUA 3UTDA 2FLVA 3W2TA 2QW1A 1Y8ZA 3PVCA 3RPEA 1L4MA 2ODBA 1OTXA 3LBYA 4DYDA 4QNNA 6PFKA 2BMFA 4QJ4A 2RHHA 3EAGA 2VN8A 2QPTA 4FFNA 4JJKA 3F8TA 4ND1A 1ZOSA 2DQYA 4C76A 1RZRA 2H2GA 1QUFA 5BO5A 3TLEA 4CIDA 721PA 5CDFE 1MRZA 3QX3A 3A6GA 1LK7A 4ND5A 1V8BA 2V4MA 5JQGA 4Z4EA 3WDLA 1EDEA 4KTVE 4ENTA 4NFSA 2X1HA 4URHA 1LDBA 1IOZA 5AVVA 1KYWA 1C30B 3IUJA 2AOUB 4E33A 3GRZA 1BGXT 4E5SA 5BQFA 1EFRA 1FFYA 3VPCA 2ZVDA 2B0JA 4M8NE 5I01A 5JATA 4AP5A 2XGJA 2C5SA 4PPYA 3U7QA 1F6BA 5KSWB 2B30A 3QNWA 1VCOA 5JCPA 3L41A 5D7BA 5KKAA 2TRSB 5ALRA 1WHSA 2BEVB 3ITDA 2AJBA 4CR6A 1TYCA 2OFXA 2EWMA 2OAEA 4MB6A 4DANA 4PIMA 2JIPA 5DSZA 4QPZA 1U2TA 2BKEA 1M6WA 1Y42X 4XD7D 2J41A 4MIOA 5I9IA 1MC4A 2R85A 4P33A 2AKEA 1LPOA 3URMA 2AD1A 2PGNA 5LQJA 2G8LA 1RLIA 4IEFB 5E9QA 1DGQA 4MR9B 4L4SA 3JARB 4UDXX 1OLUB 2NAPA 2V55B 3WOHA 3X1JA 4B1FA 3NT4A 3T5MA 4EQZA 1SHLA 2CXHA 2L19A 4ZVPA 1JIJA 5AFSA 5L7TA 4LF4B 5P21A 4B34A 3K4HA 4US2R 4X60A 3UBMA 2E48A 2ZBEA 2VDLB 4OHXA 4YPFA 1C0EA 1G6HA 1XLTC 5D5PA 2D2XA 2ZM5A 3SYRA 3TZCA 4MJ7A 4X24A 1L5HA 5B3KA 1JL3A 3VSCA 1MABA 3LCMA 2RJ3A 4IJVA 3NB0A 3HCWA 4FE3A 1JVNA 4G1BA 1E9SA 3F6YA 4V38A 2X6QA 4DHEA 3I45A 1CIJA 2NQ8A 3AM3A 2OY0A 3L2OB 1OA1A 3R0JA 3NDIA 4M9SA 4BFUA 5ALWA 3AF2A 1TE2A 5K0LA 5C1BA 2Q4BA 3IEKA 1WCV1 4ERNA 4JQOA 3WLLA 2VF7A 3HY3A 2VHJA 5LXTB 1HNWB 1AKVA 3CMMA 4K9DA 4GM4A 1BHO1 3O74A 2ZYIA 4OU4A 5J58A 1Y4ZA 3H1AA 1P9RA 1GD1O 3I32A 3WFZA 1EQ2A 2KMLA 1RQLA 1DKNA 3HYTA 4LJYA 4Q3NA 3FCUB 3U26A 3AETA 4F3RA 1BX3A 4R2LA 1A8IA 1Q20A 1YJBA 1WZEA 2JGAA 5FV7A 3V00A 1F4LA 4TL9A 5JECA 1VJ0A 3VKWA 4Q3EA 4HV4A 4ZHSA 4RF4A 4G0OA 2F59A 1XFDA 3VGJA 2OPHA 3ZK8A 5AVTA 2AHRA 1RJ9A 4JLPA 4UCXA 4OP1A 3KOZA 3IDSA 2IE8A 3CW8X 5FTMA 1O87A 2BJWA 1GTRA 3GAAA 3IBTA 1PWEA 3ND7A 2VG8A 3AK4A 3WLMA 1Z83A 4NCNA 1JAIA 3UB2A 1APBA 3H86A 1UEXC 2Z8YA 3FOCA 3GH3A 4P0TA 1UXOA 1X39A 1Z0UA 4NULA 1IZ9A 3SLRA 3WLFA 3WRXA 3JQFC 4ZYXA 3FDXA 4M98A 4FZJA 4U02A 4OQDA 3TVTA 3UVEA 3SXPA 2X8JA 5CG1A 2Z43A 1RRMA 4Q24A 1JLRA 2BPOA 4QOSA 2OYCA 1X7DA 3O8RA 2Z4RA 3IUEA 1BNCA 1YS1X 3D4NA 3RJ9A 1WV1A 1F2TA 4PYRA 1I13A 5K51A 1OCEA 3IB6A 2R8ZA 4NCHA 5E2BA 4EYEA 3IX7A 4ARCA 1TA9A 1BEEA 4NFHA 4YAUA 3A05A 5JQGB 3CRMA 2CD9A 2NT3A 1NW8A 4I1OA 4PCLA 1N5LA 3PPXA 1YONA 1GA1A 3HRKA 4D9HA 3RS2A 3ZEAA 1NUAA 1J2UA 2XIQA 3R6WA 2TECE 4A26A 1GV1A 4DABA 5KQGA 1D1TA 3CLSD 2OD7A 2VSXA 3LGSA 4BLOA 5TLSA 1FNSA 2XGOA 5CDTA 1LI5A 3CT6A 4XWYA 4U7WA 4OO3A 3U7QB 2R8OA 2PBLA 1YRYE 4EHKA 2B9EA 4GZ6A 5FPQA 2BMEA 1EFPA 1Y7HA 3EHDA 4JP3A 1WHSB 4QA9A 4B4UA 3GLFA 3I04A 2CLEB 4EY5A 4QOFA 1KGDA 3AEUA 1T24A 3FPFA 3LA6A 1QTQA 1MPTA 1RR6A 1KJZA 4N5IX 4TSRA 1E2KA 3NPMA 3UNXA 3ZTYA 1IBKB 9LDBA 1UKBA 3PWTA 4QICA 4MVJA 1KZ6A 3P2KA 2YZ7A 4LF5B 5JISA 4FGSA 3NNSA 2JVJA 3PRHA 1J8VA 2XADA 4AXXA 1HKHA 2YWRA 3C1UA 1XTPA 1QK4A 2GJ9A 5LBTA 1XLUA 2V9CA 2FWBA 3KWMA 3QBJA 4MA0A 4EUEA 4W63A 2C5AA 3QQPA 5DLPA 4ABTA 1Z6XA 3A0RB 4YPVA 4PTYA 1Q21A 3GGOA 4C1BA 4GR4A 2ACWA 2BGUA 1X7HA 5FIUA 2JFYA 3T7AA 3UB4A 1BU8A 1U7TA 4P36A 2WJIA 4CM6A 1ESMA 2OLJA 4CT5A 3KVVA 3PWSA 1L5HB 2YJTD 1BCSA 4CW7A 1Z6ZA 3LVFO 1BFUA 1MABB 2VTVA 2YJ6A 5CXSA 1ST3A 2FTKE 1E2GA 4D99A 5ELXA 3LLSA 1C9YA 3N76A 2GRUA 4JIGA 1EX6A 2GCNA 3OKFA 1E2EA 4ZGBA 4ECAA 3OOEA 2D5LA 3Q7RA 4QD3A 3CX7A 1JR3D 4JGIA 2EBUA 2HPHA 4IJUA 1JXOA 3LX6A 3DMFA 3VO9A 2Z57A 1NBMD 2ZR0A 1A88A 2A92A 4A6DA 5JH7A 4MW7A 3HUTA 2OVBA 1NVVQ 2LW7A 3AETB 2HLDD 3Q9NA 2JIQA 3DLIA 4JYBA 4S1PA 1P9LA 1P1RA 3C7TA 4B3CA 1PLKA 2IBMA 4HADA 3IDOA 2DU8A 2LD4A 4B3HA 1JQEA 3VHXA 4EELA 1JB1A 4AUMA 3W1VA 1TYDE 1RJ9B 3E3OA 4CFSA 3G9ZA 5ADUS 2O0LA 3G6WA 2D6FA 2FZCA 1CJSA 1UXJA 2KM1A 3IILA 3VUEA 3VYSB 4UBKA 5SZHB 4EO7A 4FLFA 5DWVA 5AW8A 1RAFA 3P2JA 3UV7A 3NPAA 3JVUA 2XBMA 1P19A 1ABBA 1SXHA 3DLTA 3GGGA 2ZVQX 1YQXA 4KZKA 4Z0HO 5JW6A 1OYWA 1VL5A 3R3VA 1JA9A 2J9ZB 3FRIA 5DYTA 4OIFA 1CTQA 2OC9A 5HS6A 3ZVNA 4OFZA 5CVVA 4D1YA 4R1QA 2X8JB 1CUZA 1ZVMA 1M0TA 5KTSA 2G80A 4TLCA 3GARA 3NHMA 3PQEA 4EPRA 5H59A 4RZ2A 3ZKWA 1NVVR 1MJGA 1V6SA 2LTAA 3O8DA 2JF0A 4G1MB 5FUBA 3H2IA 2OXEA 3JQBA 3VKVA 3WL7A 2BR3A 5J4YA 5MN6A 1FW8A 4ZU3A 5IJZA 1MT0A 3GUYA 4EK9A 1F2TB 1NVMB 4PC6A 3WLJA 1U3CA 4DEVA 4PGAA 3VSBA 4V0RA 4E94A 1BXZA 2V7QD 3GW8A 3TW4A 3GUCA 4UQOA 1GPDG 3KYBA 4DR7B 4X44A 2XE7A 5D3ZA 1ONSA 5DI9A 5AXAA 3KZKA 3WJAA 3Q3IA 1E62A 5AOVA 5EE3A 4ZTUB 1E99A 1NZJA 2X2FA 4X1KA 2A9FA 3DB2A 3Q5GA 5AI8A 2FMUA 2PKQP 1FP2A 1BXRA 1YA8A 2AR7A 3MF4A 2VR1A 3H9QA 4MKXA 4XGRA 5AH0A 2I3DA 1IATA 2WUGA 3EVZA 5C7YA 1D2HA 1ZL2A 1EFPB 4KUEA 1YQQA 3GLFB 2YJ5A 3AEUB 1PFYA 4N4AA 2JFUA 2JD1A 3CINA 5D86A 3BXOA 4BNDA 1VL0A 1XTUA 3CH6A 2YZNA 3HNPA 3NBZC 4HRYA 1Z4QA 5ALKA 5LMNB 1N6LA 3S4YA 2ZYSA 4CL3A 4G5XA 5CH5A 2VL7A 4LRYA 5A4JA 1ESDA 5H02A 4G2NA 4ZEXA 4BKMA 5H3CA 3DOOA 3UAZA 1JFTA 3D5TA 3AQIA 4Q5IA 2HU7A 3NMUF 1WZ2A 2OORC 3HO8A 4MGIR 5C8YF 5JRJA 2QL7A 4DR5B 3BFVA 4MVJI 4KPYA 4KDEA 2C5EA 4BIIA 3EPLA 1KJIA 1FVHA 1RLUA 1QTNA 1UBTS 1OBHA 1E6EA 3CX6A 3A9CA 4A23A 1BCSB 1CVLA 1O6CA 1NVDA 3K6RA 4TL8A 3COPA 1I94B 1WOMA 3SJZA 1HK7A 3PGLA 4HI0E 3EULA 3HV0A 3K16A 1PTKA 3IAM1 1X1EA 5L7WA 1PSDA 2G9RA 3KTOA 4P35A 1P1IA 4NCBA 1PHRA 3D31A 1CHDA 1GITA 1Z0AA 3RUPA 3TRDA 1P62B 3X1WA 5C4IA 2H2IA 2XOEA 3I2IA 5IT5A 1FFBA 1BEUB 2IV2X 4TYYA 1CZOA 4HBZA 3HXMA 4EX6A 4WH0A 3I9FA 3DUWA 1CQIA 4QC2A 3NTLA 5JH7B 1LXCA 4EYOA 1OXUA 5E7MA 3IVRA 2JHGA 1GNLA 2NAFA 3FZNA 2GBGA 2D8AA 1HDOA 5HTKA 4U9HS 1GDDA 4M53A 5JTUA 2O3QA 2AQIA 2AFIA 4WKPA 1UKEA 3VHXB 4CQMD 3D7LA 3R3XA 5A9RA 5AW6A 3LW7A 3I6QA 2QTVA 3OQ6A 4YTEA 4HP8A 3RAFC 1PU2A 2AN3A 3GNLA 5JSQA 1IHUA 5CRIA 3I42A 1B1AA 1R0ZA 3D4BA 3HR7A 2Q8NA 3TBFA 2VOEA 3FLEA 3U1TA 2OOKA 3NFYA 4DREA 2XWQA 3O84A 4LJ6A 1K6JA 4D9CA 5C31A 5HTOA 4URZR 3KQNA 3L1VA 3PC3A 3PNMA 3LFTA 3K96A 3KB8A 1JT2A 1LKZA 1Z12A 2ECOA 4DDUA 5B4VA 5KQLA 2PX5A 4IJMA 3BRQA 3MGGA 4TTJA 1XD9A 2BYTA 1JHVA 3DEFA 4QATA 5KTOA 5KYGA 1EE2A 1EWTA 3ZKWB 3SSMA 3HDYA 4DLLA 5IWAB 3IEVA 4CFZA 2ZUSA 3GAFA 1NW6A 1WOYA 1ZUNA 1FUYB 2J9RA 1PTJA 2GJSA 3SS8A 2XCOA 1WMBA 2Q5QA 3M6FA 2VUSA 2JAOA 1L1QA 3RW9A 1I2MA 5CFMA 1J22A 3GPLA 3M49A 4GL4A 4LGVA 3BHJA 3WRYC 2IZZA 2WJ6A 1E2IA 4LBZA 3OQMA 1KJ8A 4CMKA 5AI5A 2LCIA 4QTXA 3JASA 5BSRA 1WX1A 3T7SA 1VBNA 4EF4A 2DQZA 3NAZA 1N7HA 1NX6A 1XX6A 4X1KB 2J67A 4E09A 3RK4A 1FTNA 2J0UA 5AW0A 1U0OC 1RWMA 1BXRB 5A0FA 4FEAA 1Z4LA 2F3UA 1G17A 3D6UA 4Q9NA 2VP5A 1U7UA 1F51E 2YMPA 3FVTA 3SYMA 3UHOA 4M22A 4L3WA 1DU4A 2M6KA 2OZPA 4DC1A 1YO6A 3WP1B 4XIGS 3S29A 5CDHA 3HNRA 3CVUA 4RS3A 3LYHA 2P75A 4BNDB 4P93A 5HRAA 1YZTA 3TAXA 3H1BA 1FMTA 1KMQA 3UV3A 1XMXA 1GU7A 1SO8A 1TA4A 4HYTA 1IMOA 1KH3A 2VQ6A 5G1NA 5C2JB 1PZXA 2CGEA 3DVQX 4KR6A 4PSCA 1Q5PA 3QOFA 1D6SA 1TM2A 5IDWA 1KU6A 4NPCA 1E6UA 3DLBA 1VCHA 2H9YA 3FSGD 4E1VA 3WNQA 3E3MA 4AJKA 5C1DA 1N5MA 5INTA 3FLBA 1NJFA 1EEXB 1YR1A 3NWOA 4Q1CA 3W4JA 3ELBA 3HI6A 1YB7A 2Z56A 4XLZA 1KPGA 2BISA 2QAIA 1XK6A 1NVTA 2GZ3A 3OA0A 3RVDA 3SICE 1Y8CA 3AWDA 3DCJA 1AO0A 4LCEA 1KVRA 3D6MA 3WHKA 2C4KA 2O7VA 1XP8A 4XRGA 3IE1A 2A0YA 3VOTA 3P9NA 1SXIA 2GFIA 4NHOA 4XWAA 3PNYA 2RHRA 1YGYA 1KSGA 2PQ6A 1VLJA 1YS6A 1SD5A 4XYGA 2DHRA 4J0HA 2VT3A 3DT8A 5IBQA 3R4CA 3L7OA 1V48A 1UM9A 2RB4A 4JBGA 4AIIA 1TCBA 5K0GA 3M4ZA 3QE4A 1WB9A 1R4NA 3SHOA 1UODA 3IBCA 1ETHA 3PB3A 3W3AH 2WHRA 4CWAA 3ZZNA 4B43A 1CQIB 2C2BA 3E5RA 3ESZA 2BJVA 4HWRA 5K3AA 1CEEA 3HLYA 3LX8A 4M1SA 2Y76A 1IE3A 2G76A 4BASA 4A15A 2J0VA 4RPIA 2EIXA 4J76A 4C2TA 2G70A 2B2NA 3Q12A 2DECA 4DPKA 4EY6A 2AFIB 4MSUA 3K6KA 2ZLBA 1AV7A 2XKJE 2QTVB 1QIIA 2ZVJA 4QGAA 1YIOA 1XNHA 1CUJA 4U7TB 5A5VA 2EGHA 2OYRA 2W98A 4PLTA 2JZCA 3EIXA 5NLLA 2XAAA 4KP7A 5EXXA 4G1FA 3K1ZA 1V96A 2WNHA 4FI3F 2J48A 4O29A 2NSYA 3TZLA 3LLMA 4AKEA 3SVTA 1E1DA 1BCRA 4ZC8A 3BSYA 4EBBA 3UPUA 2F1OA 4Q21A 1L6RA 1P77A 4G6ZA 3NEPX 3T3PB 4F92B 3VJLA 3D7SA 4IIJF 4M9CA 4WI1A 5CJ2A 1L4GA 3OLYA 3VU3A 2BBWA 3TL2A 4N0DA 4QYTA 1XA3A 2QT0A 2NADA 3BF7A 2J7PA 2FI1A 4KIFA 5LLDA 2PZLA 2D06A 1D04A 1ZUNB 1C0PA 2C88A 2FEXA 1SXJC 3DAYA 1G8SA 1ST2A 3GNQA 4KDRA 4MXDA 2NVBA 4Q12A 3TX2A 2O8CA 3KSAC 2OO5A 3DM9B 3A0UA 1DV1A 3L8CA 4INAA 4CL2A 1Z8DA 3FPLA 3OQIA 5TVKA 1MIHA 2A94A 3FWNA 2I76A 4FFPA 3OOYA 2RK4A 3SDBA 2ZAYA 1ZGZA 5J43A 2HLDA 3CZCA 3ORRA 2OG1A 4UUNA 3ZIAA 4EVQA 5F73A 5KYVA 3L05A 4YALA 2P30A 3JASB 1QHFA 2YIDA 1WSAA 5FR1A 3N0XA 3FAKA 5KCMA 5FFMA 3KOXA 2J0UB 2VAXA 1GU1A 3ZI7A 2GAOA 4A1FA 1WSBA 1OV4A 1EFTA 3DXYA 1L4BA 3TNDA 1T2VA 1A5SB 3ITNA 1TEZA 2A1UA 5DI3A 1XQVA 4QWWA 1YB4A 2O06A 1U8UA 2DG2A 2W6IA 2WLTA 5LN1A 1QIKA 1SNYA 1K2VN 3SIRA 1UMDA 4CPDA 5K8CA 2DSTA 2Q0HA 2RKBA 2VSOA 4RXUA 4GOJA 4CU5A 5F7OA 4BX9A 2VBIA 4X66B 1JLHA 3EBPA 1UC4B 3DE0X 4EI2A 3VDNB 2W7TA 3TLZA 1T4GA 2FWNA 1XMVA 2N42A 3CNHA 1TA0A 3TOZA 3NTXA 3ASVA 1T36A 2IZOA 1U0HC 1ZIXA 3QIVA 3U61B 1JN0A 5JALA 3DFMA 4BZXA 1GPAA 2ZQ5A 1I2DA 4DJFC 2IHJA 2XYHA 1DXQA 3D8UA 1CETA 4QTZA 4E5VA 4Z3KA 4ZDIA 5LYJF 2FZ4A 4XFJA 1FXUA 4QLAA 2GBLA 3RASA 3FYUA 1G7TA 2E5WA 1EHYA 1BG6A 2WJYA 2YC4C 5DHRA 2B92A 2FY8A 2N75A 4YJ3A 3VNBA 1PS9A 3E5HA 4KXUA 5BNFA 2JEOA 2P7HA 4J1QA 1N0VC 4FFBA 1EFDN 1E32A 4Q03A 3AIOA 3ABRB 4U9IS 1UM9B 1MHPA 4GVLA 1P61B 4JLMA 4TROA 5AKJA 1KL7A 4G5FA 1KWKA 2HIAA 1OGIA 3P96A 1R4NB 3PBKA 4DA8A 1S8FA 3KQKA 5EGNA 1XROA 1QO0A 5EAIA 3ZGOA 4LIPD 3QVUA 3ZUGA 4MQ4A 2CHVA 1OXXK 1ULBA 1V5WA 1TC1A 4YAEA 3T7RA 3P9IA 4N01A 1IQ0A 4MWGA 4TWBA 4CF4A 2BIFA 2HIHA 1H2ZA 2QROA 1G60A 1TIBA 2P9TA 3C3DA 3EJ6A 4CL0A 4ND2A 1K7CA 3A4NA 2ZWMA 4FDVA 4DMMA 3K0EA 2OM2A 1LGYA 2DHQA 1O5TA 1ICEA 1G18A 1UK6A 3D54D 3K09A 1F9EA 5B37A 4QUEA 5IPFA 5JNLA 3I30X 1UIMA 2KI5A 5A9TA 2RH9B 4DQ0A 5BPHA 2QP9X 4RZUA 4F45A 3CYFA 3TUJC 4KGDA 3T1YB 4R6WA 2ATEA 1FTGA 1G21E 5K3EA 5E2AA 1SBHA 4GUDA 4HN4B 5DLQC 3O4FA 1YQWA 3FPHA 2R4TA 1V8OA 1PV4A 1NLYA 2BMWA 1BCRB 2IS2A 4OOEA 5B2EA 2ZSKA 2VPXA 4WUVA 3Q7PA 2PEZA 1VIMA 3QH4A 1Z3IX 3JTMA 1G9XA 4K6CA 5D01A 1W1WA 3BD8A 5IT9A 1RDFA 2AEEA 1G8PA 2Y2VA 1RRPA 3PHIA 4Z8XA 4QHSA 3RGGA 4P3NA 3D4PA 4EKIA 1EJ6A 3I12A 2OILA 4INJA 4N76A 4BNLA 3D7MA 1K27A 4I4CA 4PPGA 3O94A 1R6BX 4MGYR 2O8CB 3PEVA 4MAFA 3RS8A 4LHZA 2ZCUA 3DH0A 5M7EA 4PFSA 1I10A 1NLFA 1ZN7A 2FMXA 2V0NA 3IQGX 3OQIB 3ZDEA 1TYBE 4H0CA 5THQA 1I1HA 2G9UA 1GNRA 4O4JF 3ZQ6A 1S1CA 4HG2A 4PRLA 1DRUA 3I3SR 4Q3OA 1XAGA 1T9HA 3KRTA 1C3OA 3KJEA 4OLBA 3G8YA 2NMVA 3SOZA 4L8GA 1Z38A 2C8LA 4JYMA 2OCBA 4KR2A 3KR9A 4LJ8A 2Y1XA 2X7XA 3PR3A 2AB0A 4RUKA 4U1RA 2A1UB 5JFGA 1BQ3A 5DI3B 5FPHA 1BC5A 4MA5A 4FOOA 1H4SA 4PAMA 5FA6A 3B85A 3KTFA 4K6KA 4O5OA 4XR9A 2Q9BA 1UMDB 4OXRA 4MUGA 1UDRA 3WLHA 5AK6A 2A6PA 5BT9A 1PBTA 5AVWA 1DOHA 3GJYA 1S89A 4FYMA 4D81A 5LWQA 4TZ0A 2H06A 1XRRA 2R8YA 3TQCA 1XTZA 5IAAA 4UCWA 1TF7A 2FPRA 3K9FC 4O4LF 4FT4A 1FFSA 3HYSA 1G8YA 1U0RA 1U5AA 2RH8A 4PQGA 1E79D 3MPUA 1XQWA 2P0EA 1M2WA 2C20A 4DKXA 3TFQA 1T36B 2B5VA 3H3JA 1JMVA 3H84A 3I72A 5TDHA 1CZHA 2XMCA 1SWVA 5HQ3A 2AL7A 3RNLA 4HGZA 3IR7A 2YBEA 1DQPA 1MAVA 2ZSIA 1MEOA 2PZJA 2BZ0A 5LC1A 2X0KA 1PWXA 2JASA 3GVPA 3AU9A 1FIUA 1VRCA 3RVPA 5F7ZA 5BYBA 3JQ9A 4A5SA 4DQDA 4D82A 3FYUB 1XTTA 1Z5VA 4JYAB 1WMSA 5M3BA 4YJ3B 3KX2A 1RPJA 3TZEA 3UOWA 2QP3A 3AM5A 1EG2A 3DKKA 4FFBB 3O8LA 3ZYZA 4D6PA 4JC5A 2VHZA 4JJZA 1EWKA 2GKOA 2W2NA 1M73E 5CW2A 3JD2A 1AGXA 3KE9A 4HPXB 4NH0A 4EYQA 5JJKA 1JG4A 4UTOA 1NBHA 2ODNA 2C0QA 2WUVA 4M54A 2QMOA 2CDAA 1R0XA 3AFMA 5EA2A 4FBGA 3JZIA 1DI0A 1J42A 3ULKA 4R71A 4Y0AA 3SDZA 2IU0A 4JVMA 2G28A 3LK6A 1DC6A 3N7TA 5TEVA 2OQIA 4BBJA 4BB5A 2D1YA 1Y1LA 3NBYC 1PZGA 4RW0A 4HAVA 4G4GA 3QOXA 4NOLA 4ZT7A 1ZHHA 3CNOA 1PZNA 1YUBA 1FUUA 1W52X 4OJYA 1M1UA 4IIGA 1W0CA 3OE7D 4PAGA 3T34A 1U3WA 1IK4A 1WUJS 2I03A 3DZBA 5K0EA 1TF5A 3M1IA 4X6YA 2WQ6A 4KAJA 1CRQA 2WNSA 4RA6A 1QVRA 5EPOA 3SS7X 4MLPA 4NQRA 3ZU5A 4BV8A 1AKRA 5AM0A 4HUTA 3UMFA 3R75A 3U4CA 4EB6A 1EWVA 2I0FA 5FPTA 1R5JA 4F2GA 4JEIA 4I2VA 1F20A 1OH7A 4YRGA 5F1OA 1GGFA 3RVBA 1Y5NA 4EAQA 3U56A 4MW2A 2C42A 4WJZA 2C4MA 2F1JA 2EVWX 1DJNA 2PV7A 2Y66A 3FR7A 5H16A 4IINA 4WOBA 3IV9A 3LDUA 4X71A 3RVOA 3OZTA 5LZ5A 5LLSA 3EUFA 4U7HA 5DK4A 1ATZA 2PGOA 3M33A 3SC3A 4C29A 2H08A 1LJLA 3QE2A 1S2LA 1D7OA 3WK7A 5IANA 1XRLA 3VR4D 2C5GA 3D43A 4XYLA 3MN1A 5AD1A 2B8JA 3S27A 2YQZA 1Z2AA 1P4AA 1W75A 4Z99A 5TV2A 2FW0A 3SM9A 3ZDRA 2E4XA 5DW3A 2VUTA 4F06A 4LHSA 4YN3A 1CF4A 4JUFA 3HJHA 3GDOA 3VPGA 2P4SA 3DOCA 1PYDA 1C3OB 3HVKA 5F52A 5EJ6A 2GZSA 3PWKA 5LMUB 5E6UA 1NZDA 1R8QA 4CN8A 4FWTA 1KA9H 2OT3B 3ZVKA 2FXVA 1ILEA 5CURA 3VO1A 2J0QA 3KJIA 2VWHA 1HT1E 1KO1A 5DO9A 3WHIA 2JFZA 2EFYA 2GVDC 1KSFX 2O8VA 1D4OA 3JALA 3P20A 2XXAA 1GT6A 1CU1A 3SY8A 4QZVA 3GGDA 5HHTA 4QARA 2Y3IA 4M89A 2CZQA 1KEVA 1NMZA 2FW8A 1JEOA 1L7BA 2EG5A 4WLVA 2EZ9A 1WMDA 1MA0A 5CA0F 4A36A 3ADBA 1NUUA 5ES3A 4BB9A 2NU7A 2DMRA 2F90A 1R0BA 1DTSA 1KZ7B 1QNFA 1H8HD 1U6KA 3O3OB 3OJEA 3PXXA 4GU5A 4LYJA 4YAOA 4ZVQA 1KJWA 2HK7A 8AT1A 5I4IA 2WAYA 3FX2A 4LRQA 4CIXA 1IHYA 1E8MA 2HX1A 2XBLA 3L4EA 1YZLA 3QEMA 4IM7A 1IPEA 4PEVA 4WK6A 5HQ3B 3DTYA 4Y8VA 4ZXPA 5FH9A 2YOGA 1SBYA 2WMDA 2RHMA 2POQX 4MYSA 1LS1A 1NN0A 2J6HA 5G1PA 2QI9F 5DYNA 1ND6A 3D3NA 1ODSA 3SX4A 2QNRA 3IHLA 4FMCF 1KZ4A 3G68A 4J0IA 4RD0A 4F85A 2NZUG 2HQRA 4C30A 3WL3A 2DLNA 5EG5A 1KI6A 2WKWA 5I9LA 1ZQ1A 2YYSA 5IULC 2QTGA 4FOPA 3LHSA 1USIA 1J6UA 4DDVA 5GTDA 2VJNA 2AJDA 3PGXA 4LVUA 4OJNA 4Y2RA 2FWRA 2WIFA 3CR8A 3O82A 4LYEA 1IQPA 1PO7A 4DLXA 1NN3A 2DT5A 4ZVNA 3QWAA 4YIKA 4GT1A 1UEJA 4QG7A 3UJ8A 4EW6A 4HAOA 1F5SA 3F2VA 4QODA 3FWHA 1LBEA 2JJ1A 3N70A 1T9KA 4HX5A 3GIDA 3CXUA 4AY5A 2KPOA 1K8XB 3CUKA 4YP7A 1J2YA 4L5BA 5C53B 3GPDG 4B7XA 4IH9A 5KC8A 3RSSA 1Y9EA 1B26A 3VPAA 1MB4A 2DWCA 4JHLA 5GIPE 2AMYA 2PVPA 1DKQA 2IOYA 3BHMA 3HY4A 1OFVA 2E18A 1RE0A 2WMOB 3QSGA 1RXEA 3QNUA 2PFKA 4HC4A 4WESA 5B55A 4E0BA 2VH5R 1Y1QA 3QMWA 4RA6B 3ZI4A 1XN1A 4V0KA 4F5EA 1GIAA 2XRYA 3MJVA 1YF3A 1O54A 1PJ4A 4TZTA 5J1TB 5E1OA 2Z5GA 4OH7A 4TV9B 2F8MA 1KVSA 2OQRA 5SZKB 1N8KA 4X1YB 1LLQA 2VJDA 1MB3A 2IEAA 3FNIA 5GONA 1K2WA 2ZB3A 3DDWA 1I3KA 2Y1EA 2ZUWA 4NBTA 1K8QA 4BMNA 1U63A 1DEAA 3EVDA 1JQ3A 3A11A 3TGLA 4HQNA 5LDDC 1WDTA 1CLEA 3H6GA 5JAIA 3ASZA 3G2KA 3T5CA 1ZR2A 1R5OA 3QZUA 1KFBB 1QYCA 4XA8A 2NSJA 4Y9SA 3U3KA 4IIUA 2PH3A 4RY8A 2FR8C 2BI4A 1KOJA 3HC7A 3ZXXA 2Q5FA 4AY4A 5C1OA 1QHEA 1VPTA 4QDZA 2CUNA 2R7LA 4LPSA 4FMBB 3T1QA 5JS6A 1BOFA 1AXRA 4GVXA 1IN7A 2AUTA 3IAFA 1AKUA 2VHUA 2A86A 4C2UA 2RAFA 1MIOA 1WULS 4IUYA 4B6OA 4FP9A 4HGPA 2XUOA 5E6UB 3Q1KA 2Q28A 4MNTA 5FCDA 1P60A 2DQ4A 2OZEA 5TARA 1T1EA 2IL1A 3L7KA 1Z6QA 3IVXA 1ZM4A 1DEHA 3UCFA 2R3SA 4V3BA 1R0YA 4AWBA 1GV0A 1EP3B 2OGUA 3HVJA 4GPAA 4QFMA 1GGKA 4KWEA 4RPKA 3B52X 4C0XA 5ERGB 3JALB 3MJRA 4Z9FA 2XXAB 4PCAA 1YJXA 5LWHA 1MUUA 3DMNA 4KGVA 4M8KA 2FN7A 2C1EA 4N3NA 1I7PA 4YV7A 3MW8A 3I2GA 2Z1MA 4PRZA 1KO7A 4ID9A 4C4OA 4QJ5A 3RS9A 5BY2A 1HE3A 4JJEA 4WW0A 3FIUA 1NYQA 2HIMA 4FKBA 2IXFA 3PFFA 1NAIA 1KAQA 3CURA 3RTDA 1XVTA 4FB4A 1U9IC 4QUAA 2NU7B 4YRLA 3TEFA 5KU7A 1O6FA 4GOXA 1EIZA 3DOIA 3HMQA 5D87A 4MWDA 1JRLA 4Q18A 1ECBA 2FMKA 1PFWA 3LOQA 4UDOA 3RRMA 2UZ4A 2HQOA 4N65A 4QECA 3QEMB 1UJBA 1DRKA 1URPA 2ISCA 3EE6A 4TS1A 3T7CA 2R00A 1T34A 1XZMA 4C3UA 5KSPA 3O1JC 3WQSB 3EISA 4H18A 5EXTA 5IM4F 1Y8QA 4IWXA 2KW5A 2NYVA 1F8XA 2GN2A 4AD8A 3UFXA 2VPPA 1DFIA 1KI6B 1ZW1A 5EKTA 1E6CA 5TPZA 5C34B 2OK8A 2GFHA 5H3LA 3UEOA 2QQFA 1T8SA 3E9CA 1O77A 2GWRA 5KHLB 3A9UA 4AF8A 1ZH0A 4P54A 1KRHA 3F1LA 1MD9A 1OW3B 2ILVA 1TVCA 1UAYA 3CRNA 4LQDA 4TUYF 2VXYA 3EIHA 3EYAA 4R3UC 5AKHA 2WQ7A 5JJIA 1AH2A 4L76A 2BL4A 3P5SA 4EYSA 2YWBA 4PSAA 3M3DA 3HUDA 4MS3A 1KQ3A 1SOUA 5T4EA 1G7RA 1Y5MA 1ZVJA 2N46A 2PRJA 1JDZA 3FBWA 4FIZA 4UBNA 4YGXB 1VLLA 1G4UR 2JLSA 1KI4A 4LHWA 4NCKA 1PFKA 4LZLA 3SZ3A 5KNCH 4FM9A 2FUEA 2BFOA 4LVOA 4Y67A 3SJUA 4LK2A 4P34A 5TB5A 3F7NA 2YWCA 3D6JA 3F5FA 5T4BA 3CKMA 2P3LA 4UE3S 4ND8A 1E5LA 4NK4A 4F3TA 1KJ9A 1E9CA 2GRJA 3BTUA 3SHTA 4WESB 5DASA 3MCVA 5EC8A 5HUHA 2FKAA 1UBJS 2D0PB 3NHFA 2JLAA 1UBLS 4XOIA 3NUZA 3U9LA 2EZ4A 3TZHA 4D4KA 3SMQA 5DNVA 1LNQA 1KE2A 5AK0A 3HVRA 1YVUA 3IGFA 4OHFA 1YASA 4ZICA 4D9MA 2C3YA 4FX5A 2X86A 2ZUDA 1J90A 2B78A 2H54A 1Q50A 3IMEA 3FKSA 3KU1A 4KIWA 3UPDA 4BUCA 2GK7A 4D8YA 1D3AA 3BC1A 4MI9A 4FCWA 5GONB 4CU2A 1VPDA 3KSMA 1NMSA 3F3KA 2V8OA 1UJ6A 4QDOA 4IIEA 4X3PA 1QIJA 4Z2YA 5AVKA 3WSTA 4YMWA 1F12A 2PWPA 3KZVA 4P80A 2VP9A 3CRVA 3DE7X 4HVTA 4QYSA 1CV2A 3H9JA 3RWBA 4WZAA 4BVGA 4JJAA 4G4JA 1ISJA 1OFUX 2NV6A 1WR8A 4WACA 1T9GR 2HL6A 4IHAA 4OBWA 1S2DA 2OAP1 5C1IA 1UMKA 2G1JA 1Z5OA 2VP4A 3KYCA 4NARA 4QPJC 3K73O 2IU6A 4FSHA 2PUJA 1DKUA 4UREA 1MIOB 1VSVA 2AJ8A 1GPWB 2CB9A 2F17A 1HFEL 2WKRA 4RWEA 5DK6A 1FFHA 3D6VA 4L8WB 3REQA 1HYQA 1UBRS 4H3SA 2J3QA 5CYGA 1EJ0A 2B20A 3DAFA 3SQMA 4D9EA 4YIHA 2ZTLA 1FSGA 1FX0A 4E5YA 2QM3A 4Z1MD 1MB0A 3PE4A 4PW0A 1QFYA 4BFTA 1DUVG 3BAFA 3UW1A 2GD6A 1WPGA 2Y9PB 4AL4A 2MSWA 1A82A 1WD7A 1GG8A 4ONEA 4S1NA 1T5LA 4ZCPA 5AHWA 1W96A 1E98A 2JK1A 3UMCA 4GE3A 4F7WA 4YUAA 3M5CA 4TKMA 4W9NA 1ULTA 3TJRA 1X1RA 4Y2HA 1Q0LA 5HM6A 1KR5A 5FWNA 4KAFA 3ESYA 1XDDA 2BT4A 1B1CA 2P40A 2V4ZA 3UQZA 1NUHA 3VSAA 4KNVA 1YZNA 1AKNA 1I7DA 4ENQA 1I0ZA 3BT7A 2O59A 3WLEA 5I47A 1UT6A 1RXIA 3IEIA 4AJOA 2I8CA 4JI0B 4EECA 1QCZA 1Y8QB 2J5XA 4W1PA 3WZMA 2XCSB 3E18A 4M0MA 2V96A 2X23A 3OMLA 2HCJB 4MMYB 4XE5A 3UFXB 1NU6A 4FUTA 3NBQA 1U3GA 4BO4A 3NP7A 1SXQA 2ZYGA 4ESOA 4N7MA 2VTEA 2LP4Y 5T4FA 2E82A 4ZPXA 1RWPA 5AKYA 1Y7IA 3VH2A 4OJTA 1JDUA 4TV8A 3RSFA 4I08A 1TCUA 2VCHA 1L6IA 3ICOA 5EMHA 1WTCA 2JD0A 2OCAA 4MS3B 4RSHA 2BKUA 1P1JA 2WTAA 4CLHA 3HXLA 3V97A 1HXHA 3Q0IA 3WNBA 3WWYA 4CG2A 1H23A 1E1MA 2J6CA 1JQBA 4HMPA 1AHPA 1V1RA 1OZHA 3CEMA 3NHYA 3J81k 3ZWBA 2UZ1A 4KO8A 1H8HA 3EOAI 4ND8B 2Y92A 1IH8A 3BJIC 4MO2A 1VLZA 1YHZA 2QD3A 2BFDA 3E4CA 3HN2A 1EDDA 1JAHA 1I1OA 1Q77A 4HF7A 1JVSA 3OQOA 3LWDA 4HYYA 1JLLB 2PX6A 4A2WA 3G23A 3LL4A 1T2AA 4G01B 4JELA 1ODLA 4XVCA 1KI9A 2GTIA 4DVGA 2I1LA 2J5QA 2VF4X 2WF5A 2B6HA 3AY7A 3L18A 4YWHA 4DUYB 4CRWB 4OQEA 5AUNB 2RKOA 4KMRA 4IVQA 2VSNA 3ZXYA 2PS1A 2XE8A 3H4TA 3AONB 1A7JA 4IV0A 1ZD8A 3DE2X 4GSYA 1RLMA 2QZZA 5LQUA 2RH5A 4NYMQ 4WZAB 4EBFA 4V0OA 1ONPA 4ZO8A 5C7LO 2J0SA 3JQAA 2BCJQ 3SIWA 3U80A 2HNBA 1REQA 3VH4A 4BQFA 2Y1KA 4I5EA 1PWYE 4YHHB 3ZTWA 3UMJA 2HHLA 4BO2A 3KYCB 3WWCA 1U8FO 4HVLA 3M6XA 2N1MA 5D85A 2GETA 3NEJA 3HM9A 1E6LA 1QVAA 4JXKA 3HY6A 2GYUA 4KN9S 1QWSA 2V59A 1XZIA 2Z04A 1Y6JA 1UOPA 4TMWA 3REQB 1X1BA 1XB2A 3BGOS 3CE9A 5JVDA 3BGIA 3NC1C 3R0ZA 2PIDA 1Z4JA 4JL6A 1NBIA 3LBIA 1I0IA 1I6LA 2G63A 2BKLA 4O0LA 4ZVRA 2OZLA 1FX0B 2BN4A 4X97A 4BFYA 3CUUA 3DAOA 4F72A 1FFEA 2C7QA 1JLSA 1MX1A 1Z7EA 5DBIA 2PUCA 3DP7A 1J7KA 2PJZA 3GJ6A 3PDUA 4JI4B 1W2HA 3ROEA 2MSKA 2FX2A 3WB9A 1H66A 3VC1A 2OL4A 4OXNA 1ATIA 2FQWA 4IG9A 4IJ5A 1H9BA 2B5WA 2XUIA 4PHCA 6CHYA 1R6VA 3E9EA 4IEIA 5T7BA 1PGPA 1SWWA 2PR7A 3LOPA 4ER5A 5GADl 2WW8A 1ZH8A 3L07A 1YJCA 4I9GA 2JLUA 1WXGA 3FNQA 3EZ2A 2LCQA 4DQKA 2QRLA 3BIOA 3K15A 3NHRA 4CTMA 4CKZA 3W3ZB 5JAMA 2Q2VA 1UJMA 1P0QA 1LQTA 2HBQA 2PKWA 1NW4A 4RVUA 4QXAA 3P71T 3PXDA 4OQNA 3DG9A 4W99A 1RPTA 3QBTA 1IBRA 4YJGA 3SYLA 2ERYA 5DCLA 2GEDA 2ZT7A 2KX7A 2G9VA 4M0DA 2WUWE 1YZKA 3CPSA 2QVZX 4JGGA 4BKRA 1AU9A 1K9VF 1IHXA 3KL2A 5K01A 2Z2IA 4NMHA 1SVLA 3SVLA 1ZUWA 3RLIA 1JXQA 4OQPA 3WB2A 3THWA 2YUIA 1PX2A 2BR5A 3B9QA 4JP1A 2QN9A 1ESEA 1QC5A 1RKUA 2BHNA 1DADA 4CQLA 4TV8B 5KDOA 1JKFA 3CW9A 3IKTA 3RE1A 2XF2A 4KX3A 1WU8A 2O8FA 1QK3A 1RHRA 4HGOA 4DR6B 3KLPX 3UWKA 1YE3A 4J7AA 3VTAA 1V1RB 2XT6A 3GLFE 4YCSA 2CYBA 4K2HA 4FYVA 3KOYA 4MWCA 3TQHA 1BTOA 1KXJA 4EGSA 2UZ1B 3B7PA 4PPFA 2FSVA 4YO7A 2HTFA 4P7JA 4ZODA 5AJXA 4E15A 4HO1X 3K1TA 1B0AA 1A9QA 3CFYA 4WK2B 3LHKA 2BFDB 4MVJE 1U2GC 1UCFA 1AJEA 4PQFA 3K3PA 4TTRA 2JFXA 5CDSA 2ZW9A 2CCGA 3TEJA 5JNWA 2APJA 4LJKA 3HDVA 3ECCA 1OBVA 1G98A 4R8LA 5CLGA 5TJHA 2B4TO 1S1MA 5AK3A 1A9PA 1JIKA 2C4VA 3OM0A 2GDZA 1QDUA 1RYNA 1IXKA 3V48A 1EHCA 2AJCA 3AY3A 1MVLA 4WNAA 1YQ9A 2NNWB 3B9RA 5KAPA 1BHSA 1EI9A 2FFHA 3B3AA 3CLRC 5DHUA 3LW8A 1MU0A 2JFFA 3M81A 5BWLA 4PNHA 3O4GA 3J80A 2ZB4A 3JQAB 1BAPA 4GIBA 1DJPA 1RBYA 3CLHA 1REQB 4XH9B 1NBWB 3BH7A 3F8WA 4M9XA 3TNLA 3PLRA 1A72A 2Y2UA 3OEHD 2P9JA 5IH3A 1AMUA 1JA0A 3AC0A 3W2HA 4M9ZA 1H2BA 3HBFA 3AP1A 2RHJA 1JKMA 3EUWA 4G0YA 2FUG6 5FBQB 2H5JA 5BN4A 4TT3A 1R88A 5LR6A 5K0JA 3CGWA 2HSDA 5JVDB 3WGTA 1YKSA 3LBHA 2P2LA 5CT6A 4BNMA 4DW8A 2F8SA 2CMFA 2VAVA 1N8NA 1ZNZA 2NPIA 2B98A 3GEMA 3KVOA 2OZLB 4YCJA 4E5NA 4UM9B 3T8YA 1QK5A 4EUSA 5LMZA 2ENUA 4DA9A 2Y9MB 2WM8A 4QUBA 2NZJA 1TTTA 4RADA 2BRUC 3MGCA 1TB4A 2VSQA 5A5GA 3A3YA 3DR5A 1R27A 2QSJA 1VHLA 4KWCA 2H4WA 1XCPA 4YAWA 4NDZA 5F5LA 2AOTA 3HXPA 3F46A 3GRVA 1XWFA 4RGYA 5C37A 1C5KA 4IQGA 2HA4A 2PH5A 4LE0A 4P4LA 2XWSA 4X62B 2I2DA 3IOEA 2P9BA 5L3ZA 2X2EA 1ZCZA 4L85A 5ALLA 2ZI9A 3RFTA 2Z58A 1DXHA 5B6PA 2AMLA 3RSQA 4IBOA 1I24A 4J16C 4OXQA 3NXSA 3OHPA 3I0ZA 3R7LA 4RNCA 4QHTA 4EPTA 3TIVA 1ZOLA 2R7KA 1VECA 1T29A 4JUIA 2CVQA 3AKYA 5JNUA 5M2QA 2DBZA 4U7PB 4YJGB 5IUNC 5E1BA 4M4SA 4J0QA 1SHJA 1OFHA 1T2FA 3Q40A 4WX2B 3VV3A 1E92A 4D57A 3X2FA 4EHFA 1XTJA 3WQRA 1UXIA 4URXR 4DIBA 2XUFA 1O0SA 3OZ7A 4C6TA 1XE3A 4DWOA 3DDCA 1GPMA 3OICA 1SB8A 1TK2A 4RZSA 3S99A 4E31A 4CE6A 1W36B 3V34A 1JQKA 4YY3B 3SYKA 5BYKA 3CVVA 2ZK7A 1MB2A 3F4LA 3OLZA 2IYQA 2ZCVA 3THWB 3OM9A 3H6HA 1DX4A 2C54A 4V0NA 2D54A 4MUMA 1OJLA 4CF3A 2AHOA 1QC5B 4CQLB 2R1VA 3EWSA 1S3SA 4TYPA 4Z1MA 2QUJA 4Z0PA 3TQQA 5JBIA 4R9RA 2PRIA 1DC8A 4B0OA 3EA4A 3SSOA 3R0QA 1RKQA 4K46A 3WGOA 5JMWA 2O8FB 4YCMA 3O93A 4YO8A 1Y80A 1Z7GA 3VYVA 1SPXA 3WJ7A 4BB6A 1DRWA 4OLJA 3RTGA 5HUQA 4ND3A 2H1LA 2P3QA 2P6PA 1RHJA 1ZJ6A 2R62A 2XMGA 3Q9SA 4LZJA 3LV8A 3SI7A 5JYCA 3NVKI 1GSHA 2D3TA 5ISMA 4O25A 3M2PA 2YZMA 1GNQA 2P3SA 3ASUA 1D2RA 2O2DA 4KG7A 1UANA 1YR7A 5ICFA 1Q44A 2I4OA 3CBGA 2ZE7A 2WUEA 1PV2A 2PLWA 2V7XA 4O2AA 3GGSA 3M4JA 4QNRA 2EP8A 2AV6A 2YWJA 1KQOA 1RSZA 3L4KA 4UXHA 3BZBA 2AI2A 5ER6A 2I7CA 1U7DA 1XVIA 2C5LA 2BMJA 2HSZA 3LU1A 2ROQA 3O2SB 5FL7D 4F1JA 1Y6FA 1RPZA 3HJFA 1JXMA 2IPNA 2ZBPA 4FC7A 3KSBC 3Q4GA 4WNAB 5CITA 3G8CA 4ILEA 1Y6ZA 3UG6A 4BUZA 5FTWA 1KR2A 1AA6A 5ED4A 4PWYA 2OV4A 4F4UA 4I9NA 3X2SA 2O3JA 4V0ME 3V8EA 4YDQA 1V1JA 1PJTA 2QRPA 2Y6UA 4E1AA 1IRXA 3ZD8A 2JB9A 2OOSA 4F11A 1A77A 2C82A 2D1RA 2W0SA 3BSSA 3AL0C 1H3NA 4XLTA 3I92A 1CJTC 1YZUA 3DEKA 4RJ2A 1NQVA 4Y18A 5JAUA 2OKGA 3ANMA 3HCPA 3NYQA 4JQSA 3BE8A 3M1YA 2IYVA 5HK9A 2BSQA 5BN4B 5IARA 4BTLA 1DG9A 4UQPA 5KNLA 2G1UA 5AOCA 1S8OA 3PKZA 5H81A 4MQLA 3E8XA 5KTMA 4JI8B 2ZZNA 3CUTA 4G0WA 2W2KA 1UJCA 1A5AB 1PT7A 1S3FA 2O20A 3ACBA 3AF0A 1GYPA 3LF1A 4MVJG 4ZVSA 4IHJA 3B60A 2ODQA 2V97A 3U6BA 3R24A 1VIAA 1KC1A 1T43A 2AFIE 2CVPA 3OECA 1IRIA 3D6AA 3LZ6A 3NORA 3PVZA 1IJBA 2L42A 4Y2YA 3QW4B 3II6X 2CJWA 2C5BA 2XWJI 1WDMA 4PAOA 1XGKA 1PGJA 2AOTB 1SB9A 3HDHA 2D7JA 4PHTA 1HX7A 2RH4A 2ZJ4A 4DLYA 5CEFA 1GL3A 3VR2D 2CXQA 2J3DA 2WTUA 3E1SA 4GRIA 2C8VA 1QPBA 2G07A 1RXCA 1EGMB 4W7HA 3UKJA 2XMZA 2YNMA 1E9DA 3WGYA 1X15A 3ZWOA 2UUCB 1HEIA 5I5EA 2UKDA 2VNSA 2J5RA 3N59A 4FYYA 2QBYA 4IV8A 1NVWQ 3HCCA 1NXQA 3PUYA 4GWKA 4W8OA 3A1VA 3T41A 2W4MA 5SY4A 4QBKA 3JD1A 1KMIY 2QDKA 2SNIE 3IV7A 1C9MA 3OLWA 4MVJH 1USWA 1Q2UA 2SHKA 4H1HA 4ZDWA 3S2GA 4DNQA 5TIIA 1P9NA 4FIDA 3DBIA 3DHNA 1NQOA 2KB0A 3BWMA 3KB6A 4GX0A 4LKOA 1SR8A 4ZCTA 5KEIA 1SBNE 5EJ2A 5I7RA 4YP5A 1IG3A 2ZIGA 2H3EA 3R5JA 2FEMA 4R01A 4C6TB 1YAHA 3OUUA 4E30A 2WJVA 3BD7A 3U9SA 2H5LA 4FNGA 3WL6A 3TTWA 4F71A 5SYMA 1N8SA 3D3WA 4NAUA 1HRKA 3UXEA 1VDZA 3BFJA 2Q3DA 3UC9A 2DWQA 5IDVA 3R7BA 1VL1A 3MAGA 3TG8A 3I9OA 2XT0A 2ATXA 2MMCA 4MGHA 1GPBA 4DZTA 4J0EA 4ZT6A 2R1VB 5HR5A 1YTUA 4JYCA 2G06A 1NMQA 2YVUA 3BCRA 5E3IA 3GXOA 3ROQA 1WLYA 2IQIA 4GQIA 1QP7A 1KYIA 2FZWA 3E9ZA 5BXQC 5I51A 3BJZA 3FCEA 1YFLA 1PQ4A 4YONB 5JDCC 3F9IA 1D1QA 4FJ0A 3F98A 4H08A 5L9AA 2JLRA 1IBMB 3KT0A 4ISCA 4Y2VA 4N54A 1NJ6A 2B9VA 4I66A 2NZ8A 5ULLA 3VNSA 3ZHSA 1DG3A 1ILWA 4JP8A 5KQPA 5TF0A 1NW5A 3DO8A 5DNEA 2O8DA 1G2OA 1AN9A 5EWJB 5K0NA 1FZTA 1OGJA 4RESA 3L7LA 1B8VA 1XHLA 2I7VA 2CNLA 3G5MA 4UNRA 5BMVA 2GH1A 2MU1A 1T1IA 4O2AB 3PV0A 2QX4A 2RHWA 3M5DA 2N1BA 3ZXSA 4XSGA 4M3NA 2C84A 5CH3A 5A6SA 1FEZA 2JAPA 4OUKX 4ZALA 1JB9A 1VL6A 4MLZA 3S2ZA 1ZX1A 1GRVA 4ZKEA 3OZWA 2AG1A 2ECKA 1PD1A 1HL3A 3C6XA 3LYUA 1G5QA 1X3SA 5T4HA 3MWLA 4ZZ0A 2I1WA 1IEQA 3OIWA 3A1DA 4JA2A 2PNJA 5AICA 3PGA1 3ILXA 2RE8A 3KG2A 3USCS 4UUOA 1K5HA 1JNXX 4GPBA 1CRPA 3DVLA 4QU5A 2IPOA 1CQWA 1DAHA 1NHWA 1YS7A 1ZICA 1YU6A 3OLXA 4ZVUA 1ADCA 5A7FA 4HWSA 3O8CA 2XYRA 1Z2CA 3KCNA 3K0HA 5FUXA 1SQ6A 2OTCA 2WJ3A 2VUIB 4DG5A 1E1RA 3N8IA 4CT0A 2ZU6A 2YWDA 4MEJA 3HP7A 5HQTA 1MOPA 2BFNA 4XLLA 4ZARA 1XLTA 1J25A 1QGAA 1SG0A 1Y9JA 3ND9A 4HQLA 1LLFA 2W2KB 4IGFA 4KNYA 3WKAA 3MYYA 4LOJA 5DOZA 4IHJB 1R15A 4MUHA 4GXTA 4QREA 2W6JA 2EC5A 2YJ3A 4WBNA 8ADHA 4KVAA 4X85A 1Y3CE 1PFQA 1MOZA 2P6RA 3T3OA 3D64A 2ABWA 3RH0A 5AI0A 3KSRA 2VZLA 4FYWA 4QXMA 4TKZA 2CJWB 5BSWA 4KKXB 1I4OA 4RPLA 4Y9UA 3BK1A 2WILA 5A62A 1ZN2A 3FZEA 3NOOA 1IQUA 1DRJA 1T2DA 3TZ6A 1R9JA 2YR0A 3CEPB 4LXYA 4ZCQA 3AUJB 3D2AA 1KQGA 1J00A 3QPUA 3JQGA 4A16A 4DCTA 1I80A 2IYFA 1GTZA 3NTVA 4I1PA 4RD4A 4ZYZA 1XXHA 4HVCA 4CT4B 2RFLA 3OKCA 2ZJYA 3DJYA 2QBYB 3H8VA 1UJ5A 4GLLA 3HU2A 3WNCA 5JWRA 1LDYA 2RBKA 1FY2A 3M34A 1XZPA 3VPDA 3ZN2A 1BD3A 3NH6A 3AX6A 2UYOA 4WY8A 1G1MA 1RI3A 3DONA 1ENYA 4CTNA 3UH0A 4XJTA 1ORDA 4Q4AA 2JJQA 2N47A 1PNVA 4GKKB 4KQIA 3WQQA 1VC2A 1DKLA 2GOYA 4HLNA 2JH8A 1A97A 2G6TA 3D3WB 5HE8A 3NIDB 2REOA 5CX1A 3PL5A 3X1DA 2OPBA 4O2BF 1DINA 2YH2A 4U7GA 3SJBA 4ZDKA 5BWNA 3GG2A 4O8ZA 4UTNA 2QSYA 4X84A 2FMHA 5EHQA 5HJ2A 5F9FA 4I0WB 2BMVA 1Y5LA 1TU0A 1UWCA 3K71B 3DCIA 4X95A 4RTMA 2LRHA 3L0BA 4IFIA 1GPUA 4YLGA 3ABZA 4HNTA 3JATA 1VMKA 4C3ZA 1IEXA 1M0SA 3H9GA 2OCXA 3TRIA 2EBWA 3QXHA 3MBIA 4F86A 2ZJZA 3SJ7A 1BDIA 4V0LA 4ZVOA 1B8OA 4KO3S 2EAUA 3Q3CA 3F3SA 4PVDA 3V7WA 3WLPA 3BL8A 3GFSA 4AK9A 2PU7A 2WHQA 2HDOA 4MHOA 1ZW6A 3HDJA 1Q3HA 1KFEB 2BFWA 2H2FA 1KZGB 1KIFA 4OI0A 2XXJA 5AHKA 3LUBA 1YQUA 4XQGA 4C2AA 4JU9A 1Y81A 4PQYA 4JV5B 1NE7A 5IEBA 3UCXA 2C3UA 5C8DA 5J4VA 1IJEA 2O9JA 1OYYA 3CY6A 3ZDAA 1UC9A 2WABA 5BMVB 1C9NA 3PGMA 2LKDA 3KTAA 5A6SB 3K9LA 4OFXA 5BSFA 1HZZA 4H6XA 1P7CA 1CJBA 2QE6A 2RG1A 2A1IA 3U48A 1LBQA 1VJTA 1ZU5A 3R09A 3H1EA 5LOVF 2X8WA 1YR3A 2KE5A 4RY0A 2I99A 3GJ5A 2BI7A 2IXDA 3RROA 2EJUA 1YE8A 1VL8A 2TSYB 3ZWKA 2IZ1A 2O4CA 5K6RA 2NN3C 5F23A 3RVKA 1GGNA 4HDRA 3FFWA 3WOVA 1ZD5A 2P1DA 2OE2A 1IPFA 1PWZA 1VE1A 1VLMA 3MT7A 4JEUA 3TSOA 1FDUA 3DV0A 3G7NA 2CFCA 4NABA 4P92A 1JFVA 1UH5A 1J0DA 2QV0A 2A9RA 3PHGA 1CC1S 4LXXA 4UW9A 1QIEA 2XQGA 2M6LA 2NG1A 3OQBA 4TVKA 3VOAA 1AG9A 3ENZA 3V1YA 1JYEA 3OEEA 1JHOA 2WKSA 2HQSA 5GQSA 5FOXA 2FPWA 2I6GA 1YHYA 2AFHA 2VJCA 2GK6A 3KJGA 1UZNA 1L7MA 3LT4A 4FFOA 4PBSA 5ERYA 5FBWB 4BJ1A 5ENDA 3O90A 4WBNB 1O9GA 3PGKA 3ROMA 1KY5A 1ZINA 2CNOA 1X7YA 1FP1D 4W8GA 1OV6A 2P68A 5UKDA 1O2DA 1MH9A 1PJLA 1EDZA 1WIWA 2Z5FA 3NGMA 4G5HA 4Q3AA 1XZ8A 2O3SA 2V03A 3ZCQA 3L7JA 3BORA 3L1JA 4M1OA 3IT2A 5FPSA 2PUDA 1PDWA 3CM0A 3BRWA 4FR0A 4BEJA 4BO6A 3JQGB 3NANA 1X13A 3T9CA 2TMYA 1ZEMA 1XXHB 4KYTA 3ZHBA 3FFXA 4Z49A 2B3DA 5G0VA 5SY6A 4NKRA 1H6BA 4OVKA 4FWIB 3PD0A 4N3CA 1RRKA 3IAXA 1QMGA 2FN9A 3MB5A 4LXGA 3TE7A 1USUA 3CC8A 3FHLA 4ZCSA 4AF6A 2BKXA 4S2UA 3LL7A 2ZGVA 5JMTA 3FCCA 4BPBA 2X7JA 2H1SA 4CNBA 5BW8A 4BX3A 4MAMA 3QTTA 4HLCA 4ZJYA 3ERCA 1A8PA 1QR6A 4Q4AB 4DR3B 5EEGA 3EEBA 3PCRB 3H97A 3PUJA 2IJGX 1IEVA 1N2CA 2BOVA 2XDAA 4ML3A 3SR0A 5AXDA 1ZN9A 5CX1B 4ZI5A 4J4BA 5JU6A 3Q0EA 4YRZA 5JS1A 2NW6A 2GPNA 3FMFA 5DFAA 4ZOEA 1XPRA 2TMKA 1IYZA 2H5IA 2NXNA 2VNIA 2E4UA 3A1NA 1DBRA 1SZDA 4MP3A 3LC7O 2HGSA 3DNFA 4M6WA 3RRXA 1BOOA 2E4WA 3AXTA 4FBLA 4KSYA 4R5MA 3KPYA 2O23A 3ZHQA 3C97A 1C3LA 3JATB 1RMTA 3ZNNA 2ZYAA 2GK3A 2MWMA 3O2QB 4LOAA 1R6DA 3RU9A 4YR9A 4D9IA 3H0CA 1AHIA 2BLLA 2WWWA 3PC6A 2FW9A 1IY2A 2ZYDA 3QPAA 4R31A 4OM7A 1XKLA 3SKVA 1E58A 4LQCA 4EEKA 5IXJA 5FKJA 4LMAA 3CWQA 5FPYA 3H1FA 2OCPA 4YLYA 5FI1B 1E2MA 2WVHA 5JJBA 5KWEA 2FN3A 1KY3A 4XGIA 1DEKA 1HQCA 3WJ1A 1ORWA 1GPLA 2PUBA 4QUHA 1ESCA 1XNGA 2OMKA 3OCUA 1KYZA 4U63A 4JLSA 5LBIA 3WRXC 4BZWA 2GM9A 4DV4B 1W25A 2NTEA 2ZIXA 2YFYA 3JYOA 4HAYA 3V46A 2GR9A 4C2BA 4EJ6A 4W9MC 4CF5A 2UU9B 4B75A 5LZ4A 1O08A 1DBPA 2RMKA 2KJQA 3KTAB 1I6MA 3N0WA 4MDEA 3TMKA 4BTVA 4TZ6A 3MSXA 1NXVA 1UPXA 7YASA 1JMKC 3JSXA 4U00A 2UXDB 4MRSA 3USZA 4FSDA 1XRNA 4MQ6A 2JW5A 1UFRA 2JCBA 2V7PA 3A1SA 4NBLA 5ER9A 1KI7A 4AECA 1IL0A 2O19A 3ZK7A 1DDIA 2VPTA 5GJWC 1VGQA 3BB4A 4ZT3A 3E3AA 1DIOB 3ZWXA 5IK2D 2Y0PA 4GICA 3GFGA 2GA8A 3BWEA 1BVHA 1FJHA 3K6JA 4OX9B 4HDRB 5C80A 1SIWA 3VNQA 3EDMA 2FMTA 1Y9AA 1KIMA 3DV0B 5EZ5A 1PEDA 2BM0A 2VUUA 3LQQA 3OWXA 3VNVA 4GYWA 1SUSA 2XTJA 4IYRA 3KQVA 1WF3A 4HWTA 4O3MA 2AZXA 1N2OA 4UU7A 1Q7TA 1Z2NX 4A73A 3R0VA 4AJ1A 3ML1A 3L84A 4ZIRA 3IUNA 3TLGA 5BUCA 2QD1A 5H0IA 2GERA 2H4XA 3L8EA 1WQ4A 3VR6A 1H3EA 3WYFA 3ZDXB 4INPA 4N3AA 3QX8A 2QRVA 2BDEA