4RH0A

Spore photoproduct lyase c140a/s76c mutant with bound adomet
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
340
structure length
340
Chain Sequence
KPFVPKLVYFEPEALSYPLGKELYEKFTQMGIKIRETTSHNQVRGIPGETELARYRNAKSTLVVGVRRTLKFDSCKPSAEYAIPLATGCMGHCHYCYLQTTLGSKPYIRVYVNLDDIFAQAQKYINERAPEITRFEAAATSDIVGIDHLTHSLKKAIEFIGATDYGRLRFVTKYEHVDHLLDARHNGKTRFRFSINSRYVINHFEPGTSSFDGRLAAARKVAGAGYKLGFVVAPIYRHEGWERGYFELFQELARQLEGMDLSDLTFELIQHRFTKPAKRVIEQRYPKTRLDLDETKRKYKWGRYGIGKYVYRDEEAKELEDTMRRYIEQFFPGAYVQYFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spore photoproduct lyase
publication title Rescuing DNA repair activity by rewiring the H-atom transfer pathway in the radical SAM enzyme, spore photoproduct lyase.
pubmed doi rcsb
source organism Geobacillus thermodenitrificans ng80-2
molecule tags Lyase
total genus 128
structure length 340
sequence length 340
ec nomenclature ec 4.1.99.14: Spore photoproduct lyase.
pdb deposition date 2014-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rh0A01
3.80.30.30 Alpha Beta Alpha-Beta Horseshoe pyruvate-formate lyase- activating enzyme pyruvate-formate lyase- activating enzyme 4rh0A02
4FHCA 4FHEA 4K9RA 4RH0A 4FHGA 4FHFA 4RH1A 4FHDA
chains in the Genus database with same CATH superfamily
3DDWA 1OXKB 1RRGA 3E1SA 5ADHA 1X7WA 4GWGA 5AKHA 3W9BA 2OGWA 5KTRA 1SXQA 4TT3D 4DLTA 2DWUA 4L4UA 3MLAA 1BX0A 3OCCA 1IN6A 3KHUA 1RCTE 1Q0RA 4E13A 1SOMA 1EZZA 1G5RA 1TKBA 3B3QA 1EPUA 2DTEA 3TIFA 3UANA 1T3LA 5DK4A 1H2WA 1U1CA 2WPNA 3R8XA 2YDXA 3PQEA 4NAHA 5JTUA 2WFLA 2V8OA 2XDWA 2G25A 4KDRA 5DTQA 3CJQA 3U9SA 1RXVA 2OQVA 4DUGA 2YV2A 3ILHA 3JRXA 2IF0A 1OAKA 2F1KA 1Y5NA 4DARA 4KKVA 4GMDA 3LTEA 3PNKA 3TUJC 4CLOB 1F06A 2P75A 5KHAA 4BUZA 3CPJB 3WFZA 1N3LA 5CFRA 3GLIA 3BIXA 4LSMA 4QJ3A 2EKQA 1ACMA 1CQWA 1U8CB 2EKZA 3MWEA 3PCXA 1JHZA 4GKBA 3O84A 1U4NA 5CT4A 2Y92A 4R8KA 1NMSA 5D5HA 1HR0B 5C0OE 3WHKA 2HLHA 3F98A 3KOOA 1Z62A 4QFMA 2VYVD 1MMFB 5JD6A 1OH7A 3EK2A 3DNFA 1EMDA 2QTGA 3C16C 5TMEA 2ZPTX 3IMKA 3JRWA 4TL8A 3ZWAA 1FYVA 3RUFA 4BKQA 3HYRA 5EJ8A 2WTBA 3UJCA 2WYWA 3TW8B 1K7CA 2PH1A 1HLPA 2FJ0A 2D5LA 2XIQA 3Q72A 3RLIA 1R8SA 1GITA 4EUKA 1EXDA 3E7FA 1IBRA 1SY7A 2K2QB 2XGGA 1AKMA 1G8SA 4FIZA 4LHYA 2PMFA 2R48A 2VXCA 3KTOA 2AG0A 2FSGA 1U04A 3C87A 1UM9A 3EMDA 2R7LA 2PWAA 2XTAA 3HI6A 1L7QA 4MEBA 5AFSA 5I7SA 4Q03A 3SJZA 4F6CA 2BF7A 4YP1A 3DMTA 5DWQA 1QG6A 1L7DA 2Z0MA 2WSMA 3R7DA 2C7OA 1E79A 1N2CA 1V1RA 1ZJ4A 2BC9A 4KQCA 4M9XA 5D3MA 1FFXB 4D9HA 4QPZA 2H4XA 4OHYA 2C7VA 3U7QA 2BEWA 3WIEA 2XA9A 2FSPA 3U6BA 4MKZA 1J2EA 3ZK8A 4J16C 4FBMA 1I7SB 3PXXA 4OI0A 4QDTA 4RKRA 4W6ZA 2WUEA 1NLUA 4B6FA 2BLNA 4LX0A 2Z08A 7MHTA 4RS4A 1BMDA 3UN1A 4BNUA 2E6UX 2PHZA 1O2DA 2P8SA 3PFKA 4NE9A 4PR0A 4IV0A 4R69A 4AJPA 4ALIA 4UHEA 1GIAA 1E1CA 1O54A 2A0WA 2QLFA 1PR5A 3GJXC 4NYIR 4PZAA 4BZXA 4MI1A 1JMVA 5IF9A 2VTDA 3MMNA 3WGYA 1VYHA 2D2XA 1U8ZA 2GKSA 1M83A 1VJ1A 4ML3A 3EUAA 3RM3A 1CEEA 1TTTA 2R6AA 2NO4A 1UOQA 2JBAB 2QL5A 4RCVA 3M3DA 5CH5A 1M3SA 4OXQA 1OWLA 3TQCA 1G17A 1KJJA 5IBQA 3FMVA 2BHSA 5AXAA 3ZV5A 2VAXA 4EA6A 2LD4A 3GLHE 2G40A 2XAAA 3HA2A 3K5IA 3VTFA 1GNRA 1RXSA 2QK4A 5AM5A 2UXCB 1LDMA 1W9HA 4A9AA 3ZVNA 4NH0A 3CANA 3WX0A 4MB2A 2XUAA 5A62A 5A04A 4NXNB 3VPBA 4RVCA 1LQ2A 1NAHA 1XUOA 3UT0A 1AZTA 3H9BA 4KXYA 4RV9A 1S1CA 3GGPA 2ZIEA 2ZBFA 3EG9A 1KMCA 5EKDA 3W5BA 4MWZA 4F11A 3HJHA 2HJSA 3HNOA 2IYZA 4HDSB 1BVRA 2H1IA 3X1XA 1JHVA 2IYUA 4PLZA 4EDHA 3IMFA 4TLCA 1KEPA 2AFIA 3FHCB 1W5TA 1QH8A 4YVFA 4Z8YA 4BQSA 4KRYA 4PYMA 3UICA 1GNVA 1P2BA 1GGNA 4PVCA 3S44A 4A27A 3SIWA 4LK3A 5EUBA 1NVEA 2SKCA 2H1CA 4XQCA 4XQ9A 5D6OA 4PHFA 3V1NA 1G6Q1 5LZ7A 5JSUA 1RLOA 1FNCA 4P38A 1WCV1 3NHYA 5IH3A 5GJVC 4BVEA 1YFJA 4W5OA 2CZGA 2I65A 3UAYA 1P1KA 1A98A 1DQNA 1E77A 1WZUA 2QU7A 2BP7A 3BIFA 3GT7A 3HCBA 5G1OA 5I9MA 2X9QA 4GS5A 4RPIA 3U1VA 3JWHA 4LC9A 4S0ZA 1ZCAA 5CVDA 3SFVA 4BDTA 1NWCA 3QVSA 3MRTA 1E4EA 4XPIA 2AYXA 3SJAA 3AEUB 2HDOA 2QRUA 2YXPX 3DDUA 1ZU4A 3HVHA 5LIPA 1VBKA 2GXUA 3T06B 1NI3A 3UAVA 1T24A 1DELA 1VLMA 3B20A 4B6PA 4O0LA 4DM3A 4O4LB 1F60A 3HG7A 3PR3A 2C7QA 2QM3A 3PVZA 4MR8A 5JIBA 5CK5A 4XLTA 1TJ3A 3DOUA 2HWUA 5BWOA 3KWFA 3ZJTA 3DV9A 1LJLA 3NATA 1T15A 1EA7A 4WVFA 3ET4A 1YU6A 5AOBA 1GAXA 2JVKA 4JYCA 3DFZA 4MMYB 4AMBA 2VUHB 5TQ2A 2VA8A 16PKA 2X7XA 2V1UA 2H1LA 2REQB 4J7UA 5KYTA 2YHUA 3HDYA 1N2CE 3NPAA 2UDPA 4AJLA 4JP5A 2Y0DA 4NABA 1H0SA 4MI3A 4C4OA 3ZD8A 4LF4B 5A5GA 3GFOA 4K5QA 3VSBA 1QYDA 5AK4A 1Y3IA 2QGNA 3NRBA 3PHHA 3WRXA 5KMGA 2O8DA 1XXHE 4CFZA 3GRCA 3IPLA 1TPYA 4CPDA 1EGAA 3CNQS 2X2PA 9LDBA 1II8B 3K1AB 1OLOA 3NG1A 4DKJA 2NVUB 5KVAA 5LZ2A 2R7MA 1AXGA 5ALZA 1Y1KE 1EFUA 1Z7EA 1UDRA 3L4SO 5H68A 3ZCVA 3ANYB 3DL0A 3AL3A 3JYQA 3KQMA 1XTPA 4MW0A 1KJYA 1XZBA 2AQIA 4FFMA 4R54A 4L3VA 2DB3A 1PWEA 1A96A 2NYAA 4ZT4A 4EAAA 3DM9B 4IGIA 5A03A 4H6WA 3PCTA 2QVBA 5D87A 3CZMA 1NXWA 1E3JA 4H1TA 1USIA 2F8SA 3CSUA 4HZUB 3ONVA 5EGSA 4TRJA 1H4VB 3FPBA 3H84A 3DMYA 2XXJA 4Q7LA 4G01B 4RK0A 5DMXA 3KVVA 4CM8A 1ARZA 4BY9E 13PKA 1CC1S 2XF8A 1X7DA 4RF5A 3RSSA 3L06A 2XB2A 3GG9A 3CUYA 2EBUA 4BV3A 2CYBA 5KI6A 3V8MA 3HZHA 2ONCA 1U5BB 1X8XA 2BTOA 4O3FA 5JS8A 1KXZA 2NAPA 1F17A 1DWPA 4P4GA 1U7UA 3Q8WA 3ZW7A 2AFIE 4N5IX 2VYNA 2UU9B 3DQZA 2QS9A 4N40A 4YQEA 1TW3A 4M1KA 2C82A 4J3FA 4JJ4A 4NJOA 1AVTA 4FD2A 1XR3A 2FPPB 2IRWA 1PL8A 2Q3LA 3EXHB 1QF6A 4J07A 2VQ6A 1RBYA 1ZZGA 2FFHA 3HE3A 3NUGA 1E60A 1JDBC 1RM3A 4EKNB 3A6EA 1AS0A 2VYQA 3KAQA 3QWBA 2IS6A 5HEKA 2BUBA 3E2PA 5HQJA 4PLPA 2YZ7A 3LQKA 5T67A 3EBPA 2A5JA 1H05A 1JR3A 1XC7A 3LX8A 4Y67A 3QJYA 3JALA 3OM8A 3QYAA 4FHFA 4Y3UA 4IDAA 3QLEA 1C9YA 1LU9A 3C4JA 4LBYA 1Y63A 1KJIA 5D3KA 1N2IA 1O58A 1KI6B 3BHJA 3D7MA 3PZBA 1XEXA 2WVGA 4KIUA 4IOMA 1KPGA 1U8XX 4EHNA 4D9FA 3WNDA 2PGIA 4OGLA 1KGDA 2J1LA 4RKEA 3UJ3X 1JG1A 3IV6A 1QOQB 2BPOA 1QQ5A 5IVHA 3C1UA 4J6FA 1NVFA 1P45A 3AF6A 3MS2A 3QPAA 3I72A 2IYRA 1V95A 2CMGA 2EX1A 2RFLA 2VRWA 3C5EA 4KBYA 5ARCA 1KOLA 1H94A 4PLGA 4NJMA 2N42A 4LJ6A 5CMLA 1Y3FE 2CBZA 1K98A 4GOLD 4M37A 2E87A 4OPMA 4QTTB 4DRXA 3B9QA 3TQSA 2QRNA 4FINA 4WJZA 1L3CA 1B0ZA 2QMEA 4J2HA 3TZQA 5IPFA 2PUCA 3EUFA 1DAKA 1X38A 1RWWA 1E9DA 5A71A 1Z22A 3ZZ1A 3BCHA 3NHBA 1E2DA 2NYRA 1ETUA 2Q07A 4UVDA 1B23P 3GFRA 2A9VA 2W6PA 2NVBA 3UV7A 5A3SA 3DTVA 1ML3A 3A2NA 3HBMA 5FI1B 4CG0A 1IVNA 3SX2A 3VZSA 4IJ5A 2GRAA 1FFDA 3DBLA 4IOJA 1V26A 3FI0A 2H06A 1MP0A 4UPEA 4MVXA 4X1IB 4EGFA 4KKXB 4B85A 2YHBA 3MTDA 5AKXA 4K7JA 1EFTA 4U4AA 4RTNA 1EBUA 4BX3A 2Q6LA 4AI6A 4GDMA 4PNPA 3V4ZA 4JVMA 4PBRA 3VVBA 4S04A 5CTJA 5TF0A 4ZQFA 1TF2A 2PG3A 1XNJA 2GBFA 1JHUA 1IY2A 1D0SA 3DMPA 4MKXA 4Y6QA 5FLEX 2VDPB 1T29A 4P3XA 1C0LA 5DTRA 3EZGA 3WL4A 1XCMA 2FLWA 2FPIB 3HDTA 3ZXIA 4XWOA 4ILKA 1W6RA 4EJ6A 1N33B 1KJ9A 5AHWA 4U00A 4IUBS 2QUHA 1JJ7A 4J2OA 4KWCA 4EITA 3QLJA 5EE3A 3RC3A 3T3NA 2G0NA 1QH9A 4RA6A 2PO5A 1MO6A 5BWCA 4XUCA 2H0AA 4AK9A 2IOYA 5DXFA 1HZZA 5FAXA 1W0KA 2FE1A 3B2NA 2WKPA 3PVCA 3ZN2A 3DF7A 4OAPA 4FDTA 4RPHA 1WVGA 2V6MA 3IOEA 3V4SA 1U2DC 2A35A 1R12A 4GPZA 3VR6H 2DBYA 2G1AA 4JCCA 2GOYA 3WLLA 4R83A 3PL1A 1M8FA 4MV9A 1AXEA 4RA9A 3CRZA 3KWMA 1C9DB 2Q28A 2ZROA 2R1ZA 4GLLA 4GQBA 4GOMD 3FNFA 3TLEA 2VHYA 4NU5A 3BFXA 4YJ2B 3NMUF 2CL6X 4U3JB 5LXTF 1JHPA 3WVNA 1KFJB 1CZKA 2ZAYA 1L7RA 2PGXA 3L0BA 1XYVA 3NHPA 3OIYA 4TV8B 1JR3E 2BHTA 3ST7A 1RE0A 3I5YA 3C45A 4QOIA 2E49A 3ZLUA 1FVFA 4PR3A 2Y1FA 3LKDA 3M5PA 4JJFA 4L4RA 4QXQA 3Q7RA 4UAJA 3WFJA 2HU7A 1FP7A 1MRNA 1BGWA 2P69A 5IUKC 3JASB 3VO2A 4ER3A 1FS4A 1Z8HA 2GZ1A 1W5FA 2H85A 3C3KA 5FIUA 3EZYA 2F1JA 1XTRA 2AW3A 4OLJA 2ERXA 1JBEA 4G9EA 5LN1A 1CEYA 3DCJA 1M66A 2NU7B 1JMYA 1K5HA 2IW3A 2XW6A 2CVZA 4ZEWA 1VHJA 4IGKA 2P9CA 3GLGE 2OWEA 3KC2A 2OHFA 3AESB 1OWMA 3CA8A 4O0MA 2O8EB 1TA9A 4HAVA 4WWHA 2QVCA 2AUMA 2AI3A 2D8AA 3CLKA 2SBTA 5CFMA 5MGBA 4RY8A 4XIJA 5IM4A 1G21E 3INRA 3HM9A 1O96A 5AVXA 1G18A 4Q4AA 1I7QB 1F6DA 2QN2A 3QP9A 4KK4A 1LUAA 4RAQA 5BXQC 2O48X 5A5DA 1TAHA 2IS4A 1GLNA 4JC0A 2XWBF 1BE8A 1H93A 1V1MA 1IXRC 1YNOA 2RGCA 2V5VA 2ENUA 2OM2A 2QOEA 4NS4A 5IS2A 1OUMA 1GGFA 4H08A 1DDIA 4KN9S 2W2QA 3DZGA 1MT0A 3ISJA 5J5VA 1WTCA 1V4BA 2D5AA 1R0YA 3HB9A 4ZEXA 3DMRA 2QLLA 3VMFA 3R3VA 2A59A 3F5DA 3U4HA 4CQLB 1YMQA 3OD5A 1KS9A 4W7IA 4DE5A 3SC4A 2E3JA 3AUUA 3A7DA 1QYIA 3HU1A 4HNGA 4UM7A 3K9LA 3IB6A 4QRHA 2PLNA 2PMCA 3GEMA 1ZVMA 4MK4A 5DT2A 4C7OB 5GY7A 1UMDB 1PR6A 2GBIA 2QYSA 4QC2A 2VIIA 1ZOOA 2HV9A 4EY3A 5DCYA 4QDUA 3K2BA 4V0LA 1X9IA 5JRJA 5CW1A 1CXZA 2QTNA 2C77A 2DQKA 2MR5A 4FMCF 4YRKA 3ORYA 3CG0A 3AYZB 4MO9A 5AJWA 2P2YA 1DJMA 1P4SA 2ZYGA 2LP4Y 1HPLA 2VHJA 4D6PA 1QGUA 2EL9A 1HE2A 1W46A 4LGCA 3SQDA 3W6OA 3NRJA 4MUEA 5G4LA 3ZYZA 5CYGA 5E9AA 1HKUA 3HDJA 1D2HA 4QUIA 4ZO7A 2PJZA 4ILEA 1KQPA 2F3TA 1UWVA 3G9UA 1C4XA 4WJLA 5A0TA 1I13A 1KMQA 3NTVA 2OO7A 4MP3A 4AKHA 1EUZA 4OJQA 3CUUA 4AU1A 4ZYXA 3DV0B 3KKKA 3H5WA 4HWKA 5AVZA 4PRLA 1WPQA 1UUFA 4ZI3A 1OWNA 1F0KA 4RE6A 3LK6A 1J2TA 2GYVA 4I8DA 1IBSA 1TJ4A 2A0KA 1F1JA 4P5EA 2B6HA 5J2TF 1WZIA 4J3JA 4TLEA 4YUAA 1T3ZA 2PS9A 5L4NA 4LJ7A 3EQ6A 1RLUA 3QA9A 4XLLA 2X7HA 5E6UA 3MJCA 4BJ6A 3ZX5A 1CZOA 4RLHA 3FJYA 1YBMA 2VS1A 2Z6AA 2P0AA 2P1ZA 5KTKA 3A7EA 3ITDA 2XOKD 4RZXA 3IBTA 4E2XA 1CNMA 1RQXA 3Q7QA 5EUCA 3SC6A 4LZOA 1U1EA 3DD5A 4PGGA 3WKDA 5HA5A 3U3KA 3WXBA 3D0QA 4Q9HA 4DZZA 3GEPA 4K86A 1AQYA 5H3CA 1XIVA 1Y8QA 1UJ6A 3VR6A 2BDTA 2QP4A 4DDHA 2GVDC 1P1FA 1UP7A 3F1LA 2J0VA 1O95A 1D4OA 3HJTA 3IHKA 4L51A 4MIKA 3RUPA 3G5TA 4BFCA 3FMOB 4HQNA 4YT5A 3E0QA 3T5PA 4JIGA 1N0UA 3BK7A 3I1IA 5H16A 4UW9A 2WU4A 3AHCA 4XB2A 5KSYA 1RYDA 5JZSA 1E9AA 4EF4A 2PV0A 3AHDA 3HU2A 1MJ5A 3HCFA 2IHZA 4ND4A 4O4HF 2XGJA 2B0CA 2RH9B 5DGIA 5ETJA 3M1YA 5A9TA 4KQEA 2AR7A 1E63A 3KTFA 4LBWA 4PS1A 4AM8A 1DWUA 4H4CA 2D74A 3ZI0A 2C8LA 2VZEA 2EZ4A 3MNFA 1VIVA 1UPAA 2ACVA 2CF5A 4OA5A 4MUGA 1A7AA 2V5UA 1UEJA 2N1MA 3CVJA 4H1VA 4S1VA 2FVXA 3KLMX 2Q9BA 4YLYA 1B1AA 5KWIA 4GLOA 5EIXA 4IIYA 1YV9A 3C6KA 1M8PA 2C5AA 2Z6QA 1EQUA 2I2DA 1YQDA 4NBSA 1ZOPA 1BN7A 1ZGBA 5J58A 2PPLA 3P32A 4CTJA 1DIHA 3FWNA 4B6OA 3LECA 1N36B 4W5TA 2QRGA 2WB2A 3VX4A 1X7ZA 5ENVA 4HLQB 1NSTA 4N9WA 3EY4A 3SWWA 5AVRA 2OSVA 5H59A 3U9TA 4NBTA 5TGDA 3W7VA 1HRDA 4HGRA 4JBHA 3KQPA 3SQWA 3WDSA 3ZDCA 1FDIA 1U0FA 4BFZA 4HAIA 2GF9A 1VL1A 1XD8A 2HY7A 5T64A 3RI3A 3REFA 1QLHA 2GPJA 1NC3A 2RI6A 4RABA 4Y18A 4E88A 3DOEA 5KQPA 3RDPA 1XZNA 3F78A 3LYHA 2B6NA 4X7RA 2JLQA 3P97A 2C95A 4OHZA 2BE9A 3JARB 4BNXA 2UYHA 2J32A 3MLEA 4MRPA 3ASUA 1AXRA 1O5OA 2G9VA 4P5PA 4G0XA 4WUVA 1T4BA 2A78A 3E8SA 2P3LA 4MX8A 2HU8A 1JZSA 4IHAA 4NBLA 4BLSA 4CN9A 4F3RA 3UHJA 2EEPA 2D62A 3V1KA 2OCYC 2OB2A 2CNNA 2FFBA 2XQVA 2Q46A 3EASA 4OKIA 4ZOQI 4OXIA 3D7NA 2IL1A 1SWVA 1UC5B 4A23A 4DEXA 2D2VA 3KQVA 1G4UR 1GZ3A 4OHCA 4ZK6A 5CVEA 5DM60 5LDHA 2IEGA 3H3FA 1USWA 1PZEA 3GD5A 2AWOA 3PRYA 2DUMA 2QAGA 4G3XA 1CZUA 1S89A 5CEFA 2DHEA 5EMLA 1KKUA 5FNZA 3I5UA 2O8CA 2ROQA 3U5TA 1PE0A 2VDQB 5AW6A 1SVIA 3FXAA 3PRHA 3RTCA 2ZBDA 3EPRA 2G72A 3UAXA 1IWBB 3AUSA 2Q4BA 1N6KA 4RXTA 3HQ4O 2RC6A 4FZRA 4HDKB 1BFDA 4MYCA 4RK6A 4D8WA 2JC3A 2WWGA 2C4WA 1TQ4A 3GJ5A 4Y9SA 3ZHQA 3DE7X 4NZ9A 3M9LA 3GUVA 2QXYA 3C43A 5FUMA 4OP3A 3DC2A 3C39A 3FVQA 5CM9C 4JCOA 3S29A 1O9HA 3WDLA 3P2JA 4CQJA 2E89A 2YWHA 4LS3A 5CIQA 4DCOA 4KXXA 3WSWA 1J8QA 3CF2A 2OV8A 5BORA 3JWEA 1Y37A 2V58A 3LRPA 1Z6QA 1CJKC 1P9OA 2ECKA 1L5OA 1N6NA 2NYVA 4RZHA 3JCZA 4KO4S 3IQFA 3S40A 3V7YA 4B45A 2XNKA 3LDAA 3K8ZA 2GKGA 4ND5A 5EZYA 3QIAA 1C9NA 4UNNA 3V42A 1XRJA 4E5DA 2O2SA 1RC1A 3L4EA 2QRVA 2G3YA 4ND8B 1IPEA 5E2BA 2ZSIA 2WMYA 4Y7CA 3NDIA 2ZRLA 5E6RB 1QGOA 1V45E 4EX7A 4D9GA 4FZ5A 1KAOA 1US8A 2R7KA 3VXKA 1WQ1R 1F2UB 3KPYA 1TCBA 2V45A 1PTJC 3BQNB 1BSVA 1OIXA 2Z8ZA 2FI1A 4PHCA 1H85A 4R98A 3QVXA 2DT8A 2JIPA 1QU3A 2QUIA 4EAQA 3LX5A 2Q9CA 3TJZA 1TQ2A 1NBWB 1E94E 2VKQA 3R5XA 4XX0B 2AOTA 4CNBA 1OFUX 3A6PC 1DAGA 3VI4B 2RHLA 1B4DA 3B7WA 1JE0A 3BGVA 1Z45A 3AQ4A 4H7FA 5A5EA 1KQFA 2CXNA 1SC6A 2ORED 5C34B 3CWCA 3A2MA 3EXIA 4YAEA 1P5FA 1S2LA 2HSWA 2KI5A 1BX3A 1Q17A 3KT3A 1DIRA 3LW8A 1WF3A 3MMSA 4L74A 5J4YA 5DKFA 2OXRA 2Q6TA 2Y0EA 4ZQIA 5FPPA 1MDBA 3CLRC 1G4HA 2BGUA 4JSRA 5K4GA 8AT1A 3AJ8A 2ZGVA 1AB5A 1X70A 1AN0A 3AHFA 1IM5A 2UVPA 3H97A 3RYHA 1E3LA 1GNLA 4QAQA 4C7BA 1A8HA 5IKEA 1B42A 5GV8A 4AO8A 3DVSX 3V2IA 4IXDA 4JC8A 4P08A 3ZE2B 3STYA 5K3BA 2A86A 1R18A 3ENQA 3N74A 1NLZA 4LE0A 3HP4A 3AB3A 5DM2A 1BDBA 1CULC 1HBJA 3MWJA 4AKTA 4E5YA 2EHDA 3P20A 5FAKA 3WYGA 2GPTA 1Z2AA 3TW0A 1NVXQ 4BLQA 1SQFA 1IOWA 3GK3A 2FZWA 4RHCA 1K7SN 4R2XA 3T0GA 5KBYA 3OQOA 3H87A 1LBSA 3N7TA 4PZ0A 1OWPA 2B4RO 4IJ6A 4HUJA 2QUAA 2Z9BA 3S28A 3RG8A 4NKRA 5EZ5A 1UFVA 5FD8A 4AKEA 1MEJA 5LSAA 1HURA 3M3HA 4B4KA 3A1EA 3TTYA 2AN4A 1Z8FA 3NYIA 1SIBE 5KU1A 1L8AA 4KR6A 1H6CA 4Z9XA 4H9GA 3ORRA 3VNQA 1MAWA 3T0IA 3EDRA 1VCIA 2EEZA 3TE6A 1A7KA 3D3QA 2CHQA 2QTRA 4CBVA 4DNFA 5ITSA 4OBWA 3H2IA 2RD2A 2GM4A 5HKLA 1EFKA 1H2YA 1UOOA 4Y2XA 1G6OA 1WY5A 1VJTA 3M34A 4KRFA 2R85A 1P19A 5G2OA 4GZ5A 5MDHA 5K20A 1P1BA 1ST2A 4U2FA 4DV6B 3ELYA 5AOVA 4DV7B 2YKGA 1E2UA 2I0FA 3DMHA 3IUPA 1A9TA 1QFXA 4LSWA 1FP4A 4WVLA 1J6UA 4Y8VA 3VGJA 4BVAA 1CLUA 5BN3B 3GV0A 4LQDA 4C0XA 1NDHA 2JFFA 1NW6A 4JI4B 4GI2A 4RK7A 2P6NA 4EYGA 3AR3A 3AM5A 5E38A 4WLOA 1TB4A 1QIDA 1D8AA 3K8YA 3ADDA 3H18A 3QPCA 4UUPA 4C0HA 2Q5HA 4LQLA 5KWSA 2C99A 4ITRC 4MV8A 2AG5A 1SG6A 1XEAA 4Y2VA 1T5OA 2NUPB 4OHXA 5CFZA 1CYEA 2HJ9A 1XA0A 2BFAA 2H7XA 4DCPA 3WNVA 1V7ZA 2HMTA 5FRDA 1YMVA 2AXPA 1XU7A 2OV4A 3T7AA 1HYEA 2UZ1B 2ESRA 2IZ1A 4MRNA 1D4FA 4AY5A 1XTJA 2IYLD 1UMBA 4ZI7A 2I6XA 1YI1A 1LVHA 2Q0HA 4MQBA 1XZEA 4N0PA 4B35A 5C7YA 3VZQA 3FOEC 3KZNA 1OV4A 3VYRB 1FPMA 2WE8A 3MN1A 1KJQA 1SJ9A 2JIQA 3DB2A 3KJHA 4HQ6A 2RHDA 3C3DA 3H42B 4K6OA 4O02B 4OBEA 3PEYA 2XADA 4HDCA 2DFKB 1S01A 1IIRA 5FUBA 3U3DA 3KU4A 5E0OA 3WAKA 4F6RA 3E9DA 3MJ4A 3KZKA 3MW8A 3ROGA 1EAMA 1RZUA 3BH6A 2RAPA 3D5EA 3K9GA 4IDGA 3ABZA 4UC0A 4EUNA 7REQB 3E70C 1K08A 1QZZA 4UU7A 4WA7A 4Q1BA 3CN7A 3JWPA 3RRJA 3VNSA 4B3SB 3RR2A 1XWIA 2PT6A 1XHEA 2F2TA 2I8LA 1L6IA 3JTMA 2LE0A 1BVUA 3EH2A 4Q3NA 2VXOA 4QVGA 5GONA 1GKYA 4P3NA 5F2KA 2QXUA 2IP1A 1E1QA 1FTYA 4D3YA 1BO6A 2HBRA 4H0FA 3CUVA 4LTNA 3QUCA 1E2BA 3BCUA 3IB3A 2QQFA 4LQ4A 1R6DA 3IHLA 4BIIA 3KDPA 3SMVA 3TRDA 2OSBA 2JATA 5I4KA 3CCBA 2SCUA 3E5NA 2ZKIA 3AHGA 3CMMA 2MJLA 1GQFA 1T0JB 1N2HA 3QPDA 3V8QA 4B4VA 4NYMR 3RC7A 4XVCA 1FNNA 1C1DB 2PSDA 4NULA 3BBPA 4IH1A 4YJGB 1P1HA 2C92A 2IODA 5CYFA 2ODWA 3OT1B 5HJ5A 1FP2A 2P2SA 2VF4X 4I9HA 4YJ3B 4DAOA 3OZRA 4TV9B 4IIEA 3K73O 1XFAA 1Z12A 1JDVA 4KLZA 5LUAA 4Z4IA 3UAZA 1E6CA 4C4AA 4A36A 4DQ0A 1BAPA 1DX6A 3F3MA 4UVIA 1POWA 3T0FA 3AF5A 3LC0A 1W96A 3TOCA 1M1NA 1KEVA 2Q3FA 9ABPA 1Y5MA 3HFRA 5DYNA 1Y8CA 1EP3B 2CE2X 2YC2C 2FRXA 3B3JA 5DXJA 5GTDA 2I1WA 2ZB8A 5LJIA 1BTOA 4BIMA 1KY5A 4F8EA 4IVNA 3COJA 3BIOA 4YCBA 4EG5A 2AC2A 4DB2A 4YP7A 1ND5A 2F1RA 4X95A 1NIJA 2HCJB 4FKBA 4J8PA 4B48A 2QG4A 5BWLA 5IMBA 1IYZA 3HDGA 3CNLA 5IAEA 4N82A 2OP1A 1PEDA 4H3SA 4Q6WA 4MVJM 4YNBA 1CR0A 3THOA 4HT3B 1CRWG 1GCGA 3RK1A 1GXSB 4X93A 4HDNB 4QSHA 1K97A 2PGJA 2VSQA 3T5TA 3NKLA 2Q1TA 3OCYA 1EGMB 3BCSA 3I01A 3AI1A 1W5BA 1XWFA 2G28A 4EEZA 1B6SA 4NE2A 4O4IF 1T3TA 4YONB 3UNXA 5ICCA 1GPMA 3OQBA 2XTNA 4URYR 2NQ2C 4DM7A 1M2VA 2BY4A 3A3NA 2HIHA 2NZJA 5BPFA 6Q21A 4U9UA 4RHUA 3LQ1A 3U40A 4OQFA 4UFOA 3F5SA 4RK4A 1F3OA 5B3KA 3M82A 2E5FA 3EF3A 3LY9A 4MW7A 4UOZA 4DDTA 1N5RA 4RTMA 4BUJA 1ZUD1 2FNAA 2C3MA 3RTAA 1QHIA 1YF3A 3QFFA 4HDQB 3L7NA 2I4IA 5CLGA 1MJHA 5JAOA 4E2FA 2FB9A 1TRHA 4HWPA 4N7BA 4DJTA 5JZOA 3VM6A 1KK2A 3D8SA 1FJGB 1D3AA 5LQMA 2AOUB 3LX6A 1D2GA 1OXSC 1T1EA 4FB4A 1T2AA 4ZYVA 4TT3A 4ZA2A 1VKNA 2VUIB 1FDUA 4KQXA 5LA6B 3F5MA 1RZ3A 2OZLA 2YW2A 4LISA 1WUJS 3IJRA 3RTEA 2XDQB 2X4GA 3T34A 2FFQA 2WF8A 4BWGA 3EFOA 3HJCA 2GZMA 3U60B 3OETA 1HFJA 3IJEB 2H9YA 4KIFA 1S8NA 3IH5A 3PWZA 3QWFA 4CF6A 1YQ9A 2BFEA 5B6IA 1E7YA 4YIKA 2ZJ5A 3HEBA 4UXIA 5FNVB 2KPOA 1FE8A 5NULA 3IOCA 5L95A 3DEKA 2IOFK 4ZOLB 4MARA 2I67A 3P2OA 4E03A 5B6JA 3AR5A 4XD7A 1EK0A 5AD1A 1QP7A 5K3SA 1E2QA 2YC4C 4JVOA 3FLEA 1OXBB 4UBIA 1XX6A 2QV0A 2YV4A 3MCUA 1V5IA 1L7EA 4YDSA 3LPCA 4XJVA 3Q3VA 3CNBA 3NYRA 3QVTA 2TECE 1PT7A 3ZQUA 3CKKA 2MTBA 1R4MB 1DEXA 4H6XA 2ZJOA 2XUGA 4H1WA 3BWYA 1N2ZA 3R0VA 2DPLA 4B8YA 1F0NA 1VYTA 4OHOA 2BGGA 3DDHA 1ZUHA 2BEKA 1ZX1A 1KRXA 4ZCIA 1XYGA 1DARA 2J3HA 4EHLA 4QKQA 1GRQA 2VJQA 4M88A 1KJNA 1GLGA 2HPVA 4MHTA 1JEYA 1WNFA 2ZIWB 3PS9A 5MGNA 2JNWA 2ZJ6A 1U3TA 3HJNA 2PKQO 4ZVRA 3VTZA 4P4SA 5JASA 4M87A 1X80A 3AKCA 4JBLA 5BWBA 3ZWWA 2DR2A 2QTAA 2D7DA 1W59A 4L8FA 3O38A 3C15C 3LBFA 1H2AS 3N05A 1RE1A 4ITUA 2QY9A 3PPVA 5JD3A 5K0SA 4ZZ2A 5G0VA 3HJGA 4XZ3A 3A1SA 1KTIA 4DUYB 3DLHA 4GKKB 3DVLA 3QMPA 2Q5EA 1JHQA 1T2VA 4KXMA 2FEAA 1NQ5A 4QBGB 3LX4A 1PK9A 3GRUA 3O2JA 3WK5A 3HK2A 2PYDA 1HDCA 3NIDB 4GZMA 3RTDA 3IPXA 3IAAA 4IM7A 1IB0A 4DLUA 2NTEA 2B69A 1WXDA 3IOYA 2D1RA 4FHDA 1LGYA 1GRNA 3QKRA 4DR3B 2FZVA 3CUSA 4YJFA 1BJRE 3SGLA 2VDMB 3WLKX 5CDSA 2OOSA 3ZZNA 1Q77A 1RBZA 2OUKA 3IP1A 1VB3A 3Q6MA 3Q7EA 3F4BA 4KGDA 3VYUB 3OJLA 4B31A 5BNZA 4HCJA 2DFNA 4EFLA 3EDQA 4YX9A 2VK1A 2B37A 1C0KA 2QZZA 1COZA 2HI0A 2Q21A 1HLFA 2W2LD 1UPBA 4IIHA 5JY6A 3RAEC 1ISPA 3D4PA 3FOCA 1YRWA 3PD0A 3TQRA 2VXYA 1IH8A 3QTBA 2VA9A 4BEWA 1ELOA 4R2IA 1AV6A 1PJ3A 3GFTA 3O8LA 3T3EA 1UPXA 1RIFA 3L0DA 3H5RA 2VRBA 3F9IA 2CNBA 3UWPA 1PUIA 2YJNA 1QBKC 2BGKA 4ARIA 1QRAA 2Q7XA 2RG7A 2XUQA 1K3UB 4P81A 1ORRA 4DCCA 3V7FA 3IPCA 4PN7A 4JXKA 4CLOA 3KKLA 5IZCC 5CU7A 4KFCA 4GXRA 3C4QA 5KJ6A 1J21A 3DBVO 2JRCA 3R7LA 2XRFA 5DX8A 4QPCA 1WCWA 2C4TA 2IV2X 1XNGA 1A5ZA 1ZITA 2DMRA 5CT9A 2ALJA 3MOIA 5B12A 1RC0A 4KWIA 1V48A 1XQ9A 4X0EA 5ULLA 2R5WA 4U6SA 4NENB 5AJUA 2HBYA 4NYIQ 5DFAA 3R7WB 2J67A 2OC9A 4DVGA 2F1OA 3M6MD 1B6TA 1G0NA 4W5JA 3SQLA 4UEJA 1XRRA 3GLQA 1ILWA 1G3MA 1TYDE 4E7PA 2QDXA 2H2GA 3OSZA 4JLNA 1IY0A 3IIJA 4YALA 4YB8A 1Y34E 2IUUA 3RAGA 5MFZA 3ZIAA 3AVXA 4L4SA 3CISA 4IXWA 3ZU5A 3C0KA 4N1AA 3GUUA 3ZBTA 3QKSA 4QDZA 2QA5A 4TSRA 5CA0B 4ZDWA 1OA1A 2R751 4IUDS 2I2BA 2HYDA 4RFSA 1XJCA 2A4KA 3G2IA 5J4LA 4DBVO 4AQ7A 1RFGE 3HRIA 2VNSA 1K3TA 1SUPA 4J9UE 3GGOA 5JNLA 1Y3BE 3QU5A 5KYVA 2LZ0A 4WUTA 2HA0A 3OF2A 3QMMA 2HA3A 1NF2A 2Q3BA 2VTKA 4KLRA 2XE7A 3O6VA 3UM9A 5BYBA 3VBCA 2Z2KA 2WHYA 2GAIA 2IOFA 2AEEA 5G3ZA 3AZPA 4AX4A 3S2FA 1E3WB 2CGEA 3RVJA 4AO7A 4BMCA 4MV4A 4Q9IA 3Q8KA 3VV3A 3HFGA 4H3VA 1N6IA 2PL3A 3PEEA 1I4TD 2Z09A 3L46A 2R47A 3D54D 2NPFA 5DO9A 1L8LA 1N7GA 4QD3A 1PHPA 4FFDA 5BOSB 4MWGA 4Y9DA 1NR1A 5EERA 4DLSA 4CR7A 3TTTA 1L7PA 4UDNA 4M1SA 1V5EA 3DC7A 3GEEA 2ODPA 4PRZA 1U7ZA 2GJ8A 4UAVA 1DOAA 3WY9A 1N0WA 1JEAA 1VCHA 1T6XA 1ZESA 2CFIA 5JS2A 3N2KB 3QVVA 2OM6A 4TTVA 1WP9A 1UXHA 4GGPA 4LDQA 4OOFA 2AFRA 4TS3A 2XJ9A 4WDRA 5LP6C 5T6BA 1JIKA 1H6AA 1P9WA 4MCIA 4ARZB 5FFMA 3C1TA 3DLCA 3QBTA 4JKIA 3T5MA 2YOHA 3FYDA 2QUBA 4XYLA 1S02A 5ERYA 5AESA 2O7SA 3WYDA 4MS3B 4Q12A 3Q85A 4YRDA 4LRWA 2EBFX 3L1UA 1VSVA 2HQRA 4EJSA 2V96A 1ZNQO 1ZN2A 1WO8A 2XODA 5JARA 3H8WA 4MSUA 1XQ1A 4BJ5A 1Q1BA 1BROA 2CK3A 1FBTA 2FWRA 5LL6P 3JD2A 3TCXB 3F5QA 1B16A 1OAOC 4JEHA 1K6XA 1DRWA 2ZB3A 2OV6A 3CH4B 4KUHA 2WV9A 3F1KA 4WKNA 1E59A 1IZ9A 2I6TA 4D0RA 4CIAA 4MPTA 2XCIA 3BK1A 2WI8A 2HV8A 4NBWA 4KQIA 2IH4A 5F98A 1L4NA 2EGHA 1X3LA 4BFTA 1RSZA 2BD0A 4FW9A 4BVJA 2AKEA 4HI0E 1NJ8A 4R5HA 4OB7A 3EIOA 3PC7A 1NI4A 5BMVB 2VNAA 1SUEA 1U8EA 2ZSUA 2EKBA 3L43A 4XPZA 3H3JA 3ZYCA 4HNRA 3PPXA 1U1DA 1S8AA 1JPNA 3NLLA 4JV5B 5TDHA 3ILVA 1E61A 1DAEA 4YO8A 5CIYA 2VUTA 4OFXA 1PN3A 5JNRA 4ARCA 1IU9A 2C7GA 1RLIA 1BA2A 2A6PA 2NO5A 4CUKA 2J48A 3QOXA 3F7NA 2P79A 3MCAA 4RENA 3SNKA 3X1MA 1ZXBA 1R27A 5CNMA 4PLYA 1VYUA 2OY0A 3KB6A 3QMVA 2W4IA 4FGSA 3TH5A 3UOWA 4K6HA 1R5NA 1PL6A 3IEUA 1SR8A 4BFLA 1Q91A 4EO7A 4J0FA 5KS2A 2V7VA 4WFIA 1LBTA 4A6XA 1Q0TA 2WWXA 4YR7A 1QYVA 1P3Y1 1HOTA 2VAMA 4QUKA 4RD4A 3HBLA 4G5OA 2OCLA 2WINI 4FQ5A 1ZOLA 3R9XB 2A4MA 2X8LA 3NXSA 4XIIA 5LQCA 1UDBA 2ZCJA 1V8PA 3IBGA 3UUGA 5LNK6 1EX6A 3IVGA 3R5TA 5IBPA 1GN9A 4KIGA 2HAEA 3RHSA 5FF9A 1N8NA 2REQA 4D96A 3CUTA 4LXIA 3B9PA 2M32A 4X66B 2HJWA 1U2SA 1IM8A 1Q11A 1Q95A 1NW9B 1SN7A 2QNIA 4HQFA 4JC5A 1YL5A 2GWHA 2PN1A 2QVZX 1NBHA 4HTFA 2W5UA 1PFWA 3M6FA 2EWVA 3T5BA 5C2JB 4PAGA 5JCZA 4H17A 4MHSA 1PG5A 2GFHA 3GRVA 4EELA 1EDBA 3H9UA 4QJ4A 3EC7A 1DX4A 4B47A 2GZSA 3ROMA 3WK4A 4BPRA 2CLIB 4YY3B 1G291 1GT6A 3QVOA 2FWNA 1ZRNA 2XVXA 3UB3A 1H8ED 1EXWA 1F9AA 1ZNZA 3H83A 3WISA 3FDZB 5I4CA 2ENWA 2YFYA 3ESXA 3A05A 4HKTA 3TNLA 1OV6A 1N5MA 2D54A 3T54A 2WB4A 5F52A 4DIFA 4DLZA 1YRBA 1JWLA 2N0SA 1LPPA 1R6VA 5CDGA 4KZKA 1TUIA 2EX4A 3SQXA 1EVZA 3B1FA 1XNRB 3PXUA 3WMWA 3HN6A 5LOVA 1GKIA 1VRCA 4RCYA 3EJ6A 4P54A 4BAGA 1XTSA 4QBTA 5HE8A 3TNYA 5AQEA 3LZDA 3WNQA 1XEWX 3ESZA 1L5HA 5L40A 2H1FA 4K6GA 4DLWA 5DHQA 4S1OA 5T7BA 1MC8A 1EFRD 4Q15A 1IDOA 1U5BA 1DE0A 1QPBA 2BFDA 3DDSA 3FYSA 3ONNA 3AEYA 5D51S 3ZNPA 1AKYA 1UPTA 2FGKA 1K4YA 3G8YA 3HNPA 3NV9A 1UJCA 3OKFA 4I4TF 3T6KA 3W9YA 4A7PA 1CK4A 1Q1GA 2XKBA 1DWQA 3IA7A 4DN6A 4GMXA 4YUZA 5IYZA 5KREA 1GUYA 3WYEA 4DIDA 3RABA 3H5OA 1TM7E 2Y3IA 3QF4A 5J5CA 3TUIC 3AVYA 2JVIA 3IDZA 3TL2A 2GNAA 4C6HA 5LD2C 2IZ0A 3GP8A 2GN4A 2ZOSA 1RHQA 3R23A 4PZUA 2NO9A 3GX1A 3AERA 5AKEA 3BWBA 4LCJA 1LV8A 3OZ7A 4PCAA 1YE8A 3UXYA 4EPTA 2WAXA 2NU9A 1E0JA 2WM3A 3I04M 3HBJA 3IQIX 4L5JA 3TGLA 3L01A 4OM8A 2GD6A 4H15A 4O6VA 3RVSA 3PB3A 3FJOA 1T0HB 5EXSA 1JJBA 2G6TA 4MNTA 4TUYF 4I1SA 1ISRA 1HL7A 4KWEA 3ETCA 3P45A 5IASA 4O4JB 3O5AA 4R2KA 3AY0A 1PI3A 1I32A 2PH5A 4C1NA 4BBZA 1EAYA 3BICA 3DS8A 2RKOA 3HA5A 3RIMA 1IATA 1QP0A 1EXMA 2DBVO 5ALLA 2Z95A 3K70C 4KI0A 1SBIA 2B2CA 4EEXA 2V0CA 3NJ4A 1VG8A 2CJPA 3H2HA 1CJVC 2R11A 4HGOA 5LU8A 3HGTA 1G59A 3K2IA 4J1TA 4MITA 4MUFA 4ZHQF 4A2CA 4ISCA 3T5GA 1DJOA 2UYGA 4MVCA 5H3LA 4D8XA 1T5HX 4KJZA 3ZV6A 5AKYA 1O8BA 2R62A 5JNTA 1WLYA 1FSFA 1ETHA 1AD2A 1BE0A 4K1LA 4C6TB 1NF9A 3NM4A 4KQMA 5D00A 2O6LA 4A82A 2A30A 1CF4A 4IIJB 3FVWA 4F9EA 3WWCA 1NBMD 1RNLA 2CHGA 1Y42X 1ECCA 1N6OA 1FFEA 1MJGA 2A1IA 2MSNA 5GGXA 4EECA 2GS9A 4B2PA 1KF0A 5BNFA 4WEOA 1MUUA 1XXLA 4CJXA 1LNSA 5TT0A 3HB5X 4LYFA 1Z0KA 4CTKA 3CPHA 3GJ3A 5FHRA 2E21A 4B0OA 2E18A 4AJJA 1I33A 4W99A 5JAIA 1DRUA 4AFNA 3G68A 1QE3A 5T3UA 3OEHA 1XP8A 4H3HB 3BOSA 3CR3C 3ZHSA 5ED4A 1QQAA 3K09A 1O0CA 1WMDA 2QRKA 1XCBA 4CIBA 4DQKA 4Y7DA 4DCSA 1BH2A 2I87A 2NPOA 4KWHA 4N7MA 5AI5A 3JQBC 3ILXA 3UXEA 5CAEA 2FPIA 4BECA 4LXYA 4Q4JA 4D8TA 5DDIP 1R6BX 1ZK3A 3MIZA 2G83A 3NWJA 4LJLA 4JD5A 3A6FA 3T3MB 2JLZA 1QRTA 1EE1A 4IQ0A 1Z2NX 4HWTA 5D1NA 3RO7A 2NGRA 3K16A 1DRJA 1JHOA 2XMBA 2Z2YA 1SQ6A 3F2VA 1ZRMA 2OFXA 1OU4A 3KFXA 3SXUB 1LLCA 4OD0A 3HKCA 3LOUA 2WJJA 4R31A 3DV2A 3IFSA 2I1LA 3ZE9A 1GQYA 5JH7F 3I62A 2W22A 3E1GA 3LU1A 2ZU6A 3LNTA 3NBMA 5I9BA 4X8LA 2PKEA 1K2WA 4MPPA 1JSCA 4KRXA 5FUYA 4IJWA 3CNHA 1V9CA 5IW8A 5LYJA 2FR8C 4PQRA 1XEWY 3B5JA 4HOYA 4JU8A 2HHHB 3QX9A 2F43B 5E7QA 4MS4B 5K51A 4TMTA 3RVRA 3LWNA 3E5MA 3QEAZ 3O1IC 4HJXA 3R3WA 4GLJA 3SD7A 4C04A 4AJ4A 2W71A 5IAJA 1YJAA 1J23A 3QFHA 3SSMA 1QQTA 1WAMA 1Y7IA 2Q4EA 2FZEA 2HUPA 3QF7A 4NFYA 4OGKA 4R84A 1E1RA 1H1LB 2VKTA 4YRLA 3RJZA 2OCIA 3I5AA 4QYIB 3S27A 1ULAA 1ULTA 4TYQA 1YXMA 1IUKA 2B0JA 4Z4FA 4J0HA 1EJ2A 4D3DA 3NJRA 3LUBA 4G6ZA 5ALVA 3PFFA 3RPEA 4UD6A 5J3JA 3KAPA 2NTYC 3G59A 2XE6A 3G6WA 3PXDA 2XOKA 1WVIA 3BFPA 1X7YB 2ZP1A 3T1NA 2YS7A 2MSWA 1A97A 1EK6A 1JKIA 3FOFC 3MB8A 1VSUA 6PFKA 4US0R 1Q74A 1W4AA 3P9IA 3ENKA 3H1FA 4K81B 3WGIA 1M2KA 3RHZA 3VYSB 2V3WA 1JLKA 3EPHA 2HSZA 1FNMA 4MLZA 1PYGA 5MN6A 5M7EA 4CEJA 2HLDD 2B92A 2GJSA 5J2UB 2XQKA 1LWNA 3VMMA 4E6EA 3KQYA 4E22A 1XMXA 3FPFA 1B8UA 4FGWA 2HF8A 3FLMA 5DI3B 3ZD7A 3HYLA 4CHGA 2OOKA 2HK8A 5AJYA 3EZ7A 1LVGA 4AO6A 1DIGA 2G1UA 5L9AA 2D3WA 3Q2IA 2C4KA 2I6SA 2CXOA 2QKYA 2Y9MB 1TCAA 1Y48E 1E3QA 1THMA 2V03A 3ROEA 1U8TA 3S1AA 4EOGA 2F8TA 3V1MA 4IMJB 5CW2A 2J87A 2C58A 3RFVA 1GA4A 3VZPA 1RWPA 2WTMA 1HF3A 1YB5A 1DEAA 1I14A 2XT0A 3D6NB 5K0FA 3EEOA 3E9QA 4WK2B 5G4KA 1PG0A 1JEEA 2WJAA 1U80A 3B78A 1IJEA 1WSBA 3GZ4A 1K89A 5L4LA 2FEPA 4PXYA 3PD7A 2PFSA 5G0UA 4LZPA 1SURA 4RACA 4HAXA 4Q39A 3S2UA 2A33A 2QYOA 4F9GA 3UMGA 3L0PA 1OB2A 1MIOA 1ZH6A 4L16A 4X60A 1JQLB 1E98A 5DX0A 1GU7A 4PLHA 3KOWA 2YOGA 4WSOA 3SBOA 3TQTA 4UTXA 2BGIA 3PUHA 3WYBA 3I2FA 2QJWA 4EGAA 1A7UA 2JGMA 2ZJZA 1H9CA 3R3UA 1BRMA 1M2OB 4CEIA 4OK6A 1XKQA 4BJ1A 4RY0A 2QQ5A 4KE6A 1TZKA 1P44A 2AJ8A 2QRLA 3ITKA 4Q47A 4WQMA 2H1RA 3KKNA 3A1NA 2QR2A 3NTUA 4KQFA 4ONEA 4AZ3B 4BLVA 3L8EA 5SZJA 1Z6PA 2HHJA 3O21A 1C1XB 4X8HA 4Q4LA 1QQBA 1CUGA 4R41A 1U0OC 4ZJZA 2ATCA 3CHYA 4LZAA 1SEPA 3DWEX 3NAMA 2GO7A 3R6WA 3VKWA 3MTQA 3PFIA 1XMQB 3O4VA 4WMLA 2CMFA 2O3TA 3L5KA 4M86A 4EA8A 1PGPA 3WMEA 2WWRA 4YAKA 3OQNA 4K9PA 1PD0A 1P4HA 2WTEA 1A4UA 3ABOB 3ID6C 3P5SA 4YQFA 1L5VA 5K6AA 1LI7A 1PDWA 4J0QA 1Z0JA 4CEHB 3QLVC 2BMEA 3CRMA 1D6SA 2BCEA 4N65A 3SDZA 2CY0A 2I78A 4EPWA 4A10A 1ZUNB 3DZDA 4G1MB 1K7FB 1VPWA 3ZDYB 5JJ5A 2IHKA 3MSXA 1LDYA 1S2IA 4TPKA 4OLHA 1S8FA 3DOIA 4G23A 1G19A 3EZFA 2P41A 1UBTS 2BMFA 1SVWA 4DW8A 2P2NA 3F7TA 3LQRA 1SUDA 1EE9A 1EUCA 2H2AA 3GD7A 2BEJA 4D46A 2JG3A 1LEHA 3R6LA 4UM8B 4IP0A 1DADA 2ZVPX 2OHVA 3GZJA 4YCNA 4R1SA 2O2DA 4D80A 3GPIA 1T5BA 3LYAA 3IQGX 3NOOA 3VJMA 1Z6XA 2DUWA 2JHFA 3ZOKA 1Q1NA 3B36A 2RK6A 3YASA 3REQB 5K6TA 1TA0A 2ACWA 2ZRBA 3OEED 4QJ5A 1QGAA 5IWCA 1F7UA 1BIFA 4QPNA 5C8YF 2J07A 4MPRA 3G1TA 4JQSA 4X94A 1Y4AE 3ELWA 4KN5A 4C7VA 1Y6RA 1WOYA 4TWJA 2PX5A 1FYWA 2DZDA 4YRQA 3HR7A 1U5CA 2NSHA 1AY0A 1MABB 1SCUA 3KLOA 3NTOA 1UPUA 3FX2A 3P2IA 4ZZ1A 2CKDA 2FW9A 4Z2AA 2GN6A 5JJIA 1NURA 1LDGA 1WMFA 2O7NA 3NGLA 4MO2A 3WGQA 1PZMA 1SC9A 1Z5GA 4TROA 4PCUA 3UF0A 2NVWA 4LXTA 5EKXA 1ZL0A 4PN3A 1GSIA 5A7HA 2W6ID 2E82A 1GR1A 3CW9A 4Z9BA 4B6EA 1VL8A 5JFGA 4KNVA 4RPLA 5KTTA 2QWXA 2HGSA 4KP7A 1VTKA 1REQB 5KHLB 2L0XA 4CM6A 4DA0A 2VSXA 4EYOA 2LR0A 1F2TB 2X9LA 5HP4A 5ILQA 2H31A 2GQ0A 2X3YA 4G86A 3I0NA 1GDHA 2I8CA 1DG9A 1U90A 3DTTA 3H11B 3LS2A 3AM3A 3L8MA 3C7AA 4KHPB 1N9ZA 1SHUX 2PVCA 4M2LA 5E3IA 1E92A 1CS0B 1JJIA 1OSNA 2IE8A 2X6TA 1MX5A 3MM4A 1FMFA 1CUSA 3U31A 1R6TA 2FHSA 3OC6A 4RZSA 1MX9A 1QO7A 1C9MA 4RXUA 2BFFA 1Z74A 2IW1A 4R40A 1Q1EA 4IKOA 2PZFA 4TT8A 4XSGA 1ZKDA 3JQ7B 4RK1A 3GHHA 1ZFNA 3DZIA 1SCKA 4P7JA 4TRMA 4GGMX 5HILA 2BR3A 2EYUA 2FSVC 1ZMXA 1QRDA 4FYKA 4BJ3A 3MGBA 2R8PA 3O9VA 4GPIB 2ERCA 3ZWBA 4Z51A 5SYMA 3L7DA 4UBJA 5JLAA 1Q1ZA 1R9MA 3KUXA 4AUNA 2GBPA 2IELA 4ZD6A 5B2FA 1ZGGA 2C07A 3WKBA 2Q6IA 1VPEA 2XA2A 1G8YA 3DFFA 2WMNB 4Q9NA 2JIMA 2J0UA 5AICA 1M6VB 3H0KA 4DLXA 4EUHA 2ZWIA 1FVXA 1TUBB 1BDIA 1HNWB 5HSGA 3CH7A 1HEYA 2PMEA 4B73A 4HB0A 4GG1A 4R8SA 4J16A 1YRHA 2HRZA 1EWRA 1L0BA 2I6QA 4A6EA 2AFHA 1R7RA 4AS1A 1RAHA 2XR1A 2HFJA 2NADA 3PHBE 1WJGA 4IX1A 3IIMA 4R0VA 3AIIA 4P1ZA 4RFLA 4N3AA 1AUPA 3TSWA 1FP1D 2ZS7A 4XCXA 4NBUA 4E5MA 4XUGB 4JENA 5DP1A 4GSLA 3W2TA 1PO7A 2X41A 3FZNA 5AUPB 4EUFA 1PJBA 4JA0A 3GPLA 2I66A 1RHMA 1TIPA 1KOJA 4GU5A 1E3TA 5FJJA 1BQEA 3I83A 1PFVA 2QRPA 3W8RA 4AZSA 3PGA1 4HDKA 1PDOA 5KTYA 5JSHA 3WLTA 2YHSA 4QL3A 1CZHA 3PGKA 2W2NA 3IUYA 3JAKA 2ZUCA 2FN8A 3O8BA 2X3FA 3TTUA 5KYNA 1LK5A 2D1TA 4MQ5A 3OUUA 4ZAFA 5SICE 4FCCA 1I94B 4WBNB 4OJTA 2ACEA 2PR7A 4WZAB 2WSSD 4WKGA 4CE6A 1RQNA 1MB0A 3D1LA 3S3TA 2XUZA 3EVTA 3K92A 5AUNB 2QX9A 1VXOA 3AKZA 4MCAA 3WGTA 3FNIA 1TAGA 3G2NA 4NI5A 2PUAA 1YB6A 1RLJA 2OFPA 3PNOA 4WBSA 2HQ1A 5J5AA 1PR0A 4UCQA 4PAOA 4K03A 4LK2A 4QFCA 5K1ZA 4KQ9A 4GP9A 2ZZKA 4KRGA 1LX6A 4ATNA 3THXB 3U4DA 2FZKA 4B3XA 2OEPA 1MVLA 4LVUA 4O1HA 2JLUA 4XYMA 5ITZB 2MOKA 4J4BA 3SFTA 2YIDA 5EJIA 5GADl 2XCUA 1WBDA 4C05A 1W35A 4M0LA 5HKKD 4ENRA 1X0XA 4LJ8A 4OBBA 5A3RA 4F3TA 4YMWA 2HREA 2IEIA 4LXUA 2G71A 2QENA 3AFOA 1XB2A 2G70A 3DDCA 4W5WA 3D5QA 3UO8B 4FFBB 4XM0A 1IC6A 5AVJA 1T5TA 1RP1A 3WO1A 3HTXA 3QRWA 4XWWA 4NESA 4HVTA 2CLOB 3HWWA 3GDWA 3K0AB 2AEJA 1XL1A 3D4BA 5D5PA 4X91A 5CGZA 3GT3A 4HLCA 2JFXA 1FS5A 4Y6LA 3H2SA 3RVMA 5DBFA 1NC1A 3AFGA 1M6WA 3GUHA 4D5EA 4BQRA 3UKJA 2L18A 3D0OA 2L69A 1AGRA 1Y9AA 2OZKA 1SUFA 4FT2A 4B3GA 1SK8A 2C8VA 2H2DA 1N6PA 1MLDA 2IP2A 2VJCA 3H05A 3QVLA 1E5XA 2TS1A 4L5BA 4IVQA 5CT5A 3T7RA 3JD0A 4WJKB 1FPQA 4EW1A 5JFOA 5K3AA 2UKDA 2VPTA 1TJYA 4GUAA 5KYXB 4IAOA 3K9HA 1KE2A 2WYVA 1E7RA 1A9PA 2A1TR 1XTTA 4BX9A 3HDQA 4HZIA 2QLJA 1WB4A 3STWA 5C32A 3SLGA 3ABIA 1J0EA 5FWXB 4UHBA 3LCUA 2ZQ5A 4NNPA 3G9TA 1F20A 1T2EA 3ZV4A 2X14A 4IL5A 4WOBA 2EFEB 1Z28A 4ZCSA 2AFHE 5E1MA 3LUCA 4FX5A 1Y1LA 2OMKA 4OO3A 3K5WA 2JBHA 1KEWA 5EAIA 1Z0DA 5FEMA 3ASVA 3AVUA 1XDWA 4B0PA 1TVCA 5AKJA 4E3ZA 4RTRA 2OQ2A 2QMUA 4DUPA 1D9XA 4JMPA 1P33A 3BXOA 3QEKA 1FDVA 1KK3A 4ND3A 3TM4A 6ABPA 2O1WA 621PA 1QFJA 2FZCA 1OLUA 3QYFA 4UNQA 4XYBA 2ZUWA 3PC2A 1GGVA 1Z6GA 5IT4A 5EJ7A 3C74A 4O1IA 4RQTA 3UQZA 4V39A 3Q3EA 1FP6A 1SHZA 3I8SA 5U1PA 5JAPA 2BBTA 3X2EA 1AT1A 4I9NA 4ZPJA 4DEVA 1U7DA 3PC8C 1WR8A 2DERA 10MHA 1HYHA 1WCIB 1EGHA 5BPHA 4V1CI 5C51B 2H1OA 1M0EA 2I9KA 2C3OA 2C9MA 4FDAA 1YZLA 1RMQA 2ORYA 3HJAA 3QXJA 5G0SA 4N4AA 4FDMA 4BNIA 3EW7A 4Z1MD 2OORC 5I4BA 4KXQA 2W00A 1DV1A 1BS1A 1LBHA 2PZ8A 1MTZA 3NC4A 2A9JA 4HWSA 2UYCA 1ZEMA 4JH0A 2X9VA 4OQ4A 4KPEC 2AZ4A 1T34A 2IX9A 1UK7A 3PGLA 4IV5A 2YZGA 3W8NA 4HS9A 5HUQA 3H13A 3FPCA 1OYVA 4J7CA 2I6FA 3DMNA 4HN2A 3HCRA 4YRSA 2BEVB 3UOAB 4P0TA 3RS3A 3VYWA 3IV9A 1Z08A 5LD2B 2FMFA 3OZTA 1KKMA 3SF8A 1BDMA 3NHMA 2G36A 5FTKA 4YRTA 3T5AA 1K8YB 2E4XA 4IHJA 3ESBA 3HI4A 4QLOA 3A1UA 3A1TA 4AP9A 4Q3EA 3RSOA 4FZ3A 1J06A 2MYNA 4UASA 1K8ZB 1SCQA 4D45A 4GI3A 5F23A 4MWDA 1T9ZA 2R8EA 4A0GA 2X2FA 3OBBA 1IWPB 3THRA 3GJ6A 5ECDA 4P92A 1Q1QA 3TW4A 2C5LA 2OBXA 1WABA 4A3SA 5JMWA 1YKSA 4KVFA 3GNQA 1P60A 5DYYA 1QJCA 3GMTA 3KYIB 3WC4A 1L5KA 3SHTA 2OBFA 3TGPA 2DKNA 3H0EA 4HB4A 4L9RA 3ZHBA 3IRVA 2J3JA 1EM8A 5J4VA 4Y2PA 4R71A 1SUCA 4LI3X 3UB4A 3AB7A 2BFBB 3DA8A 1PLLA 4CLRA 4XIYA 3MJSA 2ZTUA 3UHPA 2QRMA 1O9GA 4RIEA 1Z75A 1BGVA 1FA9A 1LWOA 3CX7A 2P3OA 1JZQA 1LQTA 2EIXA 1S8OA 1U2PA 3IDSA 2O3JA 2BGMA 3AJEA 3GJ4A 2J3KA 3LOQA 3R44A 5EYPB 4DCTA 3UJAA 6REQA 5K8UA 2IA5A 1CHNA 2BZGA 1U3VA 5JJBA 1GGMA 1VJ0A 3BE8A 1JG7A 3V97A 2ISSD 2P9QA 3VKHA 2QD1A 2PD4A 3HWRA 2VPYA 3LUDA 4NTZA 3R40A 1XF9A 5KVVA 1FOEB 1YB7A 2XMZA 3DLTA 4K40A 4NECA 5ILGA 1ZAYA 1OCEA 5CDHA 2P27A 3WRYC 3D4OA 1X87A 3BKWA 4K9RA 5TB5A 1U2GC 1GV0A 3HZRA 5EZ6B 4ZODA 5FB3A 1J9GA 5HXAA 3QLTA 2PNFA 2WFAA 3WIVA 4P84A 1WF6A 2GPYA 4AECA 1TCVA 1NUPA 3D7SA 3OT1A 4PYNA 5LQKA 4HSEA 2IXAA 2EV9A 2WT9A 3LUHA 1RABA 4YJ3A 1EWTA 2XDAA 3GBPA 4TV9A 2BH2A 1FSPA 4YUVA 3A27A 5AJZA 4RC9A 2JHGA 1PVDA 1W76A 1Z4KA 4R0NA 1SK9A 4RWEA 5DI9A 1JLRA 5FBQB 3TR5A 1ZIOA 5DNAA 2A0XA 1XJQA 4FFSA 1OC4A 3GVIA 2HF7A 2B25A 1GNQA 1YUMA 1JGTA 2HWWA 1A5BB 1G2OA 2HWYA 1EZ1A 2WG0A 3IT2A 3KL4A 3OPYB 4OQMA 3JRNA 3TTVA 5A3JA 5BQXA 2VJOA 5JECA 3UMVA 3WQHA 1OBCA 2Q3HA 3WOVA 1WTAA 2PRYA 3RS0A 2HMUA 1P7VA 3T1QA 3VHQA 1P7YA 2H5JA 4YT8A 3VAYA 5ER6A 4BKOA 1KHHA 4BAZA 3LO8A 1JFRA 3JSAA 3PDJA 3NR2A 4KQJA 5ALFA 2QD3A 1MNAA 2XNDD 3UA4A 3OCUA 2R6ZA 3Q87B 5BOVA 4E12A 2RH4A 5JMPA 3JW8A 4ETNA 3LVQE 4I1IA 5HF8A 1U2DA 3AKYA 2H0RA 1PJQA 4JYMA 4Z7OB 1AUXA 4WRRA 3WSVA 4TVSA 3LHIA 3QV1A 5T5QA 2NT3A 3ZY2A 1KDTA 4PG8A 5A1TA 4N3NA 4YO7A 2IUSA 4YCLA 1W9MA 3OIWA 4F86A 2DE0X 5AO9A 2IOHA 4HDMA 1AUQA 3VU8A 3DE6X 3WQQA 3B8EA 2RHBA 2TMKA 4HDOB 3BFJA 1UWLA 3LTNC 2PX3A 1H69A 3OU2A 3KJZA 4XEHA 4TXNA 1R9JA 4WI1A 5A4IS 3SBEA 2YZNA 4WACA 1JAYA 1DKPA 3LLSA 4JELA 2HXYA 5ALQA 2HJRA 3UK7A 1S2OA 1W4CA 5C46F 1UOEA 5FKJA 4O8CA 4KTVE 4N5HX 1U99A 1JE1A 4DJEC 3QZUA 2OLKA 1TCCA 1Z2OX 2Q5QA 1GTSA 5JNWA 4D9EA 1PL7A 1QV6A 5ALOA 1WXFA 1CZRA 1E5QA 3LGSA 4MW2A 2E5WA 1KZHA 1VMEA 2W2LA 2Z4SA 5HIIA 3K70D 1MX3A 1TEZA 4RM2A 1FRQA 1U28C 1C29B 2PMDA 3ZEAA 2C29D 3CRW1 1J2RA 3QELA 2I2AA 3AI7A 3GW8A 4PEVA 4A73A 2VRCD 4NDZA 4BAUA 4F7DA 1KWKA 4LAFA 1EUDB 1Q6YA 2NTNA 2O07A 3CNEA 5ALWA 4C2BA 2IY8A 2QLTA 3ANSA 3FFWA 3SDBA 1JS1X 2P5YA 4W9RA 1TZ2A 2PFKA 4PRYA 4QOHA 4PINA 1YTLA 1Y4UA 5IK2A 3CEPB 3D1JA 3SHVA 4KO8A 1E0AA 3JZFA 4FQ8A 5C3UA 2NSJA 1G20B 2OQRA 4TOIA 4PPGA 3RU9A 1O6CA 1AF7A 3B3GA 2QY6A 3KWLA 2P7HA 1UADA 1Z88A 2WTUA 4BP3A 2OG1A 3L0SA 5AXCA 4D3XA 3KYDB 3AP3A 3FMFA 3R0IA 3WO0A 5D86A 2ZRFA 2HT1A 3MRVA 2I3ZA 3ASZA 4LHSA 4Y9TA 4FB5A 5H9WA 3WE7A 1KAEA 2GD2A 5CDFE 2FQ1A 2C54A 4GPEA 4ON9A 3BE6A 3SFZA 5I7HA 5BSFA 4LY3A 2ZBRA 3B3FA 3GWGA 2X23A 2IYYA 2V7WA 1XLUA 4I9UA 5TPWA 2PX4A 1E2JA 4J76A 5EIBD 3EXEB 3X1DA 3MJRA 3N8IA 2HA2A 1DCFA 3EVFA 4D9IA 4TTPA 1CR2A 2P77A 1B14A 2WZDA 3F6CA 3AW9A 1SZJG 3H4IA 1YJQA 3P8ZA 3S2IA 4H31A 3IUEA 2ISQA 4W1QA 3TD2A 4BNJA 3DLAA 1XQXA 1H6BA 2WT4A 5FPHA 4HX2A 5JVDA 1SU4A 2WKWA 4IWXA 2RGDA 2XGSA 2P5UA 4N8EA 3VO1A 4QBIA 3A3YA 3QHPA 1R4AA 4U7WA 4QO8A 3U39A 1RTKA 1KMNA 2DUNA 3KQSA 3IKJA 4KZPA 5GVSA 1U4SA 1YNSA 2HOQA 2X86A 5A4AA 1JI0A 4ZVKA 2JAHA 2YJTD 4HPXB 3SPXA 3PIDA 2OGSA 2FR0A 2ZI9A 3GBSA 3IAUA 3L7YA 1TVKB 3JD3A 3UKOA 4BGVA 1H3NA 2IDJA 1B6RA 3RRFA 1OZAA 4LX8A 2XXAB 1UIRA 3C97A 4NLLA 4CFYA 4HLUC 4RMJA 3O8QB 5IDWA 1RWVA 4DLLA 1WXEA 2O2HA 3EZLA 3BERA 3K31A 1I10A 4HP8A 1IXKA 2GDZA 5E95A 3SK0A 5KTNA 4A2WA 1ORWA 2GO1A 1P2GA 4K6CA 4WKCA 3VOSA 1VA4A 1B8OA 3GEDA 4N39A 4EYKA 2IHVA 3I52A 3N3BC 4Z3KA 1NQUA 1WSWA 4Z7NB 1QR6A 3QKUA 3OO1A 1XAGA 1U9JA 3C24A 1JFLA 4P4TA 3I0ZA 1QAQA 1GA1A 1UZLA 4FWBA 2VAVA 3ZU4A 3UGQA 4F4DA 5EHXA 4X1YA 1FLNA 2B7CA 1IUPA 4JB3A 1NUTA 3AHJA 3FYUB 1XN1A 5JV5A 3QXSA 2Q1YA 3WWPA 1JIJA 4UZFA 3O03A 4CCAA 2NQTA 1YJ5A 2JL1A 2YY7A 5DYGA 1ORTA 2CMHA 3FGNA 2C59A 3A6KA 2W90A 3Q2KA 3TFQA 5CX1A 2O3UA 1E6LA 3HXMA 4G5YA 5JOQA 2V5AA 2KB0A 2GK3A 3EDCA 3MGAA 3U3MA 3VR5D 6LDHA 1IAVA 5IKXA 1OVGA 3G8AA 2BBOA 3EQ7A 3DE5X 4KO1S 2OXIA 5FBRB 3T3GA 1GDDA 3VR3D 1PGNA 1A95A 4L0CA 2QTBA 4XAQA 5LYYA 3AVWA 3RJ5A 3IUBA 1Z4OA 2G8NA 3M81A 5TMPA 2XRYA 3GBVA 1L7OA 3FRIA 1BEZA 1I6LA 3RIHA 4LGVA 3ECCA 4CL2A 3KUKA 1V11B 2YOFA 1DU4A 2DWPA 3OKAA 5A6SA 1FSZA 2PRJA 1WHTA 1ZC3A 1DSSG 1CQIA 3R7WA 2H29A 3PUIA 3IMCA 4YR9A 1JP7A 1J07A 1FRVA 2B30A 2A1UB 3LCCA 3ZH2A 3U13A 2XWJI 2JDID 2HQSA 1ZC4A 2ZR8A 3IQDB 4R9SA 3UXMA 4BEJA 2V7PA 3AP1A 2DR0A 4OYHA 1WD7A 3GA7A 3FIJA 3EIUA 2MHCA 4I50F 5HF6A 4BATA 3CLVA 2YMQA 3U7EB 3GRPA 3S7ZA 1JZTA 4NS1A 2IV3A 4YMHA 1HT0A 1JX6A 3DWGA 2RH5A 4O2AB 1L8XA 3QYPA 2AMVA 1ZJZA 1G55A 4WOJA 4DB4A 2B61A 2G0AA 2JLBA 3ORHA 1KEEB 5CFPA 4WKPA 4BVGA 3GNLA 2VSNA 1ZG3A 1YDFA 4L78A 2IUYA 3HVUA 4JZKA 4OB6A 4TKVA 4I14A 1Y81A 1DV2A 3JYHA 2GBGA 1VLHA 4P3KA 2PKXA 4UE6A 3K6RA 3SHQA 3ZE7A 4QYXA 3B5EA 4GEKA 1M2JA 3N7AA 4HYTA 3LK7A 4DYDA 3BZUA 2HSEA 3N3AC 4LYAA 2IZ6A 1KYWA 5BURA 3O8DA 2ZT6A 1PVVA 5DN6D 1U98A 3A6JA 1DBVO 1Y6FA 5BN4A 2B8TA 2RC5A 2PL9A 1YR6A 1Y7HA 3GXBA 4AZTA 1OH8A 3KELA 1DDOA 3ADPA 2WAYA 4IRUB 8GPBA 1XALA 1Q12A 2JJYA 2QZ9A 2QG6A 3DOHA 4R3WA 1W93A 2B4QA 3PLAE 4YCMA 1XLVA 1C30A 1DGQA 3VPSA 1J99A 1KMHB 1KXJA 1L2TA 1Z15A 1XZGA 2PSJA 3K9CA 4HFMA 3UUFA 5C8DA 5KYWA 1O6FA 1WW3A 1H8EA 3VNBA 4E5SA 1XDGA 4KSYA 4GWLA 3T5DA 3T7TA 1XQ6A 4JP8A 2Q3DA 1RRKA 2QN1A 2V9PA 2ZANA 3JZDA 3N2KA 4HNUA 5KSWB 4CGZA 1QONA 4MGEA 1VG1A 3OURA 2HPAA 2VEDA 3CLHA 2YJ4A 1ISMA 2WIAA 3EAQA 1QF7A 2C4HA 1Q2UA 2PXAA 2V7GA 2W43A 3LWBA 5C5IA 3CVXA 5CA1A 2Y1KA 1GJRA 2GDJA 2AE2A 4GT1A 4UHHA 3RJ9A 3WLHA 4EATA 3LP8A 3RS8A 5DB4A 1Y5LA 1UKAA 1GADO 4MYHA 2GJKA 5K3FA 1PZNA 2HUNA 4YTEA 4DZRA 2ECPA 1QCCA 2OHHA 5I9SA 4D43A 1EFRA 1YD7A 5DP2A 1J0DA 5C1DA 1KR5A 4BO5A 2QM7A 4NOMA 2IIPA 1HX7A 2FFRA 5CP8A 1T9BA 5A4DA 3RRZA 5CUQA 4JWTA 4AIRA 2QPTA 5JCPA 3FTPA 4Z53A 4NCJA 2BTQA 1ZSNA 3AI2A 3R6GA 1EG7A 1J8VA 2M9MA 5BMVA 2X2EA 4JX8A 5FULA 4YN3A 1Z7BA 3M83A 1PJ8A 1I4LD 2XCRB 4LTDA 1JG2A 1M34A 5K8IA 2BBSA 4OHBA 2QLMA 3OH8A 3FVRA 4URWR 4ZT6A 3I1FA 4EQ6A 3QITA 3TAXA 3GH3A 3LLUA 4JN6B 1K6IA 2NV6A 4UTNA 1U65A 1TJ5A 1JLMA 1FUEA 2N3ZA 3BTUA 3MGCA 4JXJA 4FPXA 5CVTA 1NIPA 1A1SA 2BKXA 2KHZA 2ZJFA 1E2KA 2ID4A 1OBOA 3I76A 5FTWA 1A9ZA 1U1FA 4K26A 3G23A 1KJZA 3ZU2A 2RKBA 4YRRA 4M9SA 2HWXA 1ILEA 1PR3A 1K5PA 4PZZA 2ZWMA 3KJNA 1PEKE 1PTJA 4Z1OA 1YI8A 2ARKA 4K9KA 5FCDA 3CZRA 3Q3HA 1SKUA 2ONYA 4BRUA 4C29A 2O05A 1GA6A 3OVMA 1QM5A 3DXZA 2AH5A 3ZIDA 2XV1A 3MMZA 5FBWB 3T3DA 2G4VA 3HVKA 1SKQA 1EINA 1FFWA 2VLBA 4O2LA 3E5HA 4LUCA 3ZJUA 2A3RA 4NFHA 3DWIA 1RQLA 1S3FA 2UUOA 2WAOA 3HXLA 1B2RA 3UK2A 3COPA 2C3YA 5CYOA 3PPWA 3R6TA 1XRMA 3CZCA 3ZV7A 3L9XA 2EG5A 1UBOS 2VYFA 4LRSB 4DJJA 2XT6A 1T26A 4RESA 3RIYA 4ESOA 2IFTA 4GDFA 1OYOA 3GC6A 2BR5A 3WBKA 1H65A 1E1LA 1NBMA 3ETLA 3ORQA 1CD5A 4CV2A 2RMKA 3P9YA 3LSYA 1THGA 1YFZA 3DDNA 1XZLA 2DFLA 1YK0A 2OV2A 2NQ8A 5H5JA 3GLHB 3N87A 2H2WA 3HKDB 1JEQA 3B1WA 1I0ZA 1RTTA 1TECE 1WHSB 3A1VA 3U4GA 3TTXA 1NVBA 1X7WB 3G5MA 4CLHA 5BR1A 4HQLA 4MB6A 3UEOA 2D7CA 1LNZA 1YONA 4KSCA 2PZMA 3IXQA 1BHO1 3S8EA 1EI9A 1DNPA 3E05A 3EC1A 2P3SA 3PDUA 3WI7A 3O82A 2A1TS 1Q0HA 3B5IA 1KI4A 1N3BA 3NBFA 3LL7A 4ALMA 1NBAA 1ZKMA 4UJ3A 1AQNA 4Q9DA 2J9RA 2B9EA 2XAUA 2WFLB 2W2XA 3EZ2A 3P96A 3SSOA 1ZD8A 1X1TA 1S0UA 2BWJA 1I8TA 2Y1GA 3GMDA 1EVIA 4A6DA 3ED5A 1PZXA 1DQRA 2VXBA 5IC6A 3GLIB 1Q3HA 3LCVB 4PCLA 3LXUX 3SCZA 3LT0A 7GPBA 5KWEA 3S2ZA 4RJIA 3VR1A 3MWEB 3QFRA 1IUNA 2O7VA 1E0DA 2FLKA 1W29A 1PJZA 4QAJA 1K4MA 2J9FA 3BILA 4KXWA 5F4BA 4JFAA 1UDWA 3K15A 3ZNQA 4G4GA 3UYKA 4M8LA 4R1UA 4YRMA 4ZCQA 3N0XA 1RWOA 1NQOA 2FDCA 4ZT3A 1RHJA 1W30A 1IXSB 4NCHA 1AGNA 1T9DA 1K92A 5T4BA 2XEXA 4RVNA 2FXVA 1U8AA 2BV3A 1E9CA 2VYCA 3MS7A 3WYFA 4F45A 2YYYA 1PHRA 4X92A 3RNLA 1ZGAA 3L1JA 3MOSA 4G5GA 2QNRA 1LD3A 2XMRA 3OZUA 4RORA 2CFOA 1XG5A 2DWOA 4Y6PA 2ZE8A 3P9RA 4ROTA 1L7VC 1LLFA 3D0KA 4IDEA 1QXSA 5TLSA 1GTMA 1RAFA 3HJUA 1O3YA 4PO3X 2D00A 2YS6A 1U9YA 2JGJA 1UM9B 3BH0A 2JFUA 3WK7A 4CU5A 1JT2A 2GJAA 4PPNA 1U9CA 3I28A 3I1YA 5FQOA 3WP0A 1LPBB 3U48A 5HMLA 1ANKA 2EGUA 1MKYA 1N2CB 1V1RB 3AL2A 3E7XA 3OCZA 5DASA 3IT1A 2OYCA 1JVSA 5D3MB 1Z4JA 4F4CA 1HYQA 2V3VA 4H7EA 1J1ZA 2EOAA 2I2FA 2BEWB 2O0MA 2O7QA 4OSOA 3U7QB 3KZOA 4ALJA 4D4GA 1IL0A 1NRIA 5EJAA 4C0WA 4QJIA 1VFNA 1D7AA 1YS9A 3BRCA 4BNVA 1CVIA 4I5DA 3ZXUB 5HIMA 4F91B 2IK8A 1B0PA 2G0TA 3LIIA 1UBUS 2QRJA 2HLDA 2VWGA 3IUJA 4X61A 2BKVA 5FFNA 3DXFA 1WVMA 1CR6A 4UQPA 2QAGC 1Y1QA 4CT5A 2NXWA 3D7LA 2RBEA 4BRSA 1SU8A 2LVBA 5CT8A 3N0WA 1UQTA 1N5LA 1PFGA 4HH1A 2XCOA 5I9TA 1EKXA 2BSQA 1JJFA 1KI1A 4X71A 1DZIA 1OI2A 1NBME 5CNJA 4UHKA 5HTKA 2NACA 2QE7D 4LZNA 1EQ2A 5EHNA 2RIRA 4XJSA 2Q1SA 4FW8A 4V2UA 4EA7A 1L1EA 1RBMA 2YMPA 4RKQA 1T13A 4RHTA 2VJPA 1OI7A 1OJ7A 3PWKA 4ZJYA 3WG9A 2C83A 4BKUA 3JU3A 1NBEA 5DLDA 1RM0A 2V6GA 1NNUA 3BMQB 2GAAA 4L22A 1LRJA 1NLFA 3F74A 4QM7A 4A8JC 3KSAC 4O4LF 2RBKA 3DKRA 3CNOA 3WA6A 1XZMA 5CTAA 1XL0A 2GZ3A 2DFDA 4GOXA 5F9HA 5T4FA 3TD6A 3GLUA 5CLFA 3KCQA 4K3UA 5AHXA 1SVMA 3EG9B 1KE1A 3SR0A 4GZ3A 2C4UA 2EIHA 4NATA 3HA7A 2WYUA 1DAFA 1P9NA 3RCBA 3RAFC 2O1SA 5FUVA 2GJ9A 2SKDA 3ZV3A 1ZJJA 2FXIA 2HEIA 2AFIB 4D4HA 5C7LO 2R66A 1ODLA 4ZZ0A 4CV0A 4URFA 2O2CA 1JLLB 1R74A 3BFKA 3HB0A 5B37A 4EFMA 4TKMA 4YP6A 3C3WA 3OJEA 4JLWA 1HYBA 1OY1A 1G64A 1BGXT 5B2ZA 3UCEA 3RVLA 1Z7GA 2ZTHA 2Q6OA 1SXJC 1T4CA 3FSJX 2M6SA 3X3HA 2IPOA 2IVZA 4LPKA 5C35A 1N2JA 4IKPA 1I5EA 2D0PB 1CDDA 1O4VA 1U0HC 2BP7B 2EFHB 2JCSA 3R1IA 3EGXA 2FG6C 3BRQA 5F76A 5ALHA 4JQYA 3I64A 3MA0A 1RDFA 4MS4A 4GMGA 5DOZA 3UJ6A 4AZWA 2C2ZA 4N0MA 1NKSA 3HM2A 5LZ5A 2O2XA 1E4EB 4XPIB 2VJNA 2X40A 3G0OA 1G8PA 4OLFA 1SC4A 2WR8A 2DTXA 4IEEA 4D3SA 1XTBA 3K5HA 4MR7A 4BLOA 5BVHB 2DC1A 3CVOA 4QDKA 3ZE0B 3ZGYA 2VBGA 4MR8B 4C0JA 2LUOA 2ON6A 3KLPX 3VH2A 2PV7A 3VDQA 3KTDA 2HK7A 1EX7A 1XTUA 4EPVA 5EMJA 1PSWA 5KVCA 1FYFA 2R1TA 3EEFA 1EQAA 5TQ2B 5HVNA 3TOVA 1J1UA 4AN0A 1TZBA 4HPJB 1P1JA 1S7CA 2A9FA 5AHKA 2ZW9A 4OV6B 4P36A 3WXMA 3H2YA 3MWGA 3OJFA 1JXMA 4J94A 4QHYA 4TTQA 4B5KA 4DR4B 2KX7A 5DWDA 4CYMA 4BVFA 1PSDA 2RHGB 2ZJ1A 1VSTA 1MT3A 5KMGB 2O8DB 1Z16A 1NSYA 3TOXA 1SCNE 4PZ9A 4FWTA 1T5LA 2C3UA 4F85A 3K1JA 2VJAA 3O0DA 1JR2A 1IHPA 3CT4A 2Y1EA 3GRAA 5DI3A 1RZVA 1M0TA 3OEEA 1PZHA 2F8MA 3G85A 1MFZA 3EG5A 4LVNA 3S81A 3ESYA 4Y2UA 1VFPA 3NOVA 4TTJA 1DG3A 1DUIA 4DIUA 2C7RA 5F9MA 2Q6KA 3KHSA 3DE0X 4D0SA 1XMPA 5CCDA 1OW3B 4IZ6A 1CR1A 4LXQA 2OGUA 4L8LA 1FIUA 4TZTA 1AGXA 1B41A 2FQQA 2LWIA 4O63O 5AVWA 1ZISA 3W6ZA 1F14A 4FCTA 1RPNA 4LDNA 3U6KA 3H4TA 3CN9A 4Y1EA 1T1JA 2H8GA 4FEAA 2W6IA 3D2BA 1W0JA 2RSLA 5K99A 2I71A 3WGGA 2XBLA 4LOHA 4JUCA 4IZIA 1W36B 3BD9A 3H9EO 1G8JA 5L7YA 4GMFA 1GNPA 2VZLA 1GEEA 1ISFA 1HDOA 4C2AA 4ZYUA 3VPDA 3NGMA 9LDTA 4HBGA 1DQPA 1EX9A 1SBTA 1J0BA 3TTWA 1GL9B 4JNKA 4XYGA 3KZXA 3I45A 3EXG2 3IO5A 3F0TA 3LT1A 1KY2A 2ZYDA 4GZLA 2I3BA 5HKAA 2O0LA 3BXEA 4JBXA 3OT5A 4NCKA 1W73A 4Q7MB 1JEOA 1OXVA 2K7ZA 2Q99A 2RCYA 2H9AA 4FILA 4LN1A 1RRVA 1AF4A 1I1NA 2Y8EA 4IDBA 1G3RA 4M1ZA 3FNGA 4UQOA 3HBFA 4EVSA 5KNDD 1SUAA 3NVDA 4UREA 1SUBA 2R96A 3RGGA 4EX6A 2JJ1D 2WC1A 4KGVA 4YGYA 2V9CA 4EG6A 3U4MA 1GPNA 3G2PA 4FOPA 1RYZA 2PGAA 4X97A 2IWHA 1AO0A 1XEXB 1KRHA 2W2KB 1JVBA 4WGFA 1GPH1 5G0WA 4DR2B 2X42A 4Y1RB 3HA3A 1JQAA 3D2LA 3MRXA 4TZ6A 2FH5B 3T9BA 3IEVA 4N03A 1QRSA 2HDWA 1C5KA 1ZUNA 4FLFA 3KU1A 1I2MA 3D8RA 1UZNA 4EH1A 1N92A 5IWAB 2FY8A 4NJMB 2WK1A 1UBJS 3IP5A 2RK4A 3L6BA 4GMHA 1OX4B 2H07A 1V4VA 1GG9A 3HDVA 4DRXB 1XZJA 4P3OA 3ZGNA 1E0SA 2ASEA 3EE6A 1VKOA 4J4HA 4O2RA 5CPFA 3RT7A 4E1BA 5L51A 1Y3HA 4CIDA 1SUWA 1GCUA 3PYXA 4TTRA 3MT7A 5EY5B 1JQ5A 3DL4A 1JG3A 4LV6A 3HSYA 2G7MC 2P8JA 1AKVA 3NETA 4G0OA 3BORA 5E4TA 4C7MA 2NO7A 4R4JA 1UBGA 3TVTA 1KIMA 1XPJA 3DBLB 2EKLA 1EB9A 4MYDA 1OI4A 4BDSA 5HIAA 3GLFE 5DRYA 5JJKA 2DQSA 3LWDA 2UZ0A 5DIZA 4UU8A 2XWQA 2WSSA 4IDFA 2OYSA 3PNPA 5AW4A 4M0UA 4YJ2F 3PDIA 5KUTA 4MIEA 4JASB 3BPSA 1QKIA 2QTTA 5EQFA 1Y82A 3LJKA 1ZN7A 1M1YA 4TV8F 1QZXA 3I05A 1SCDA 4P3YA 3RKSA 3VJLA 4AT1A 1EGVB 4LW8A 4F46A 3ULKA 4B79A 2HL6A 1SD1A 5LP1A 2ZSFA 5PGMA 3HHPA 3DBIA 4C06A 3VC7A 4U5XA 5IZCA 2D1YA 4U9IS 1N78A 1UBEA 1FDRA 4QU8A 1SXPA 2H57A 1K5GA 1I1QB 1QDEA 2G4CA 3R5FA 2VRNA 4XI9A 5DSTA 2FA9A 2GHQA 2H1SA 2PA0A 4GBMA 1REQA 1ZD4A 1KIAA 4G63A 4RA6B 1R5BA 2P67A 3AFIA 2PBFA 3M1LA 4XFJA 4E07A 4MYUA 2Q2VA 5ED0A 5HKKA 5E3HA 3N0TA 1BS2A 2BAGA 2RHJA 2QBYB 3DQPA 5AI0A 4CVNA 4PSKA