4RH0A

Spore photoproduct lyase c140a/s76c mutant with bound adomet
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
340
structure length
340
Chain Sequence
KPFVPKLVYFEPEALSYPLGKELYEKFTQMGIKIRETTSHNQVRGIPGETELARYRNAKSTLVVGVRRTLKFDSCKPSAEYAIPLATGCMGHCHYCYLQTTLGSKPYIRVYVNLDDIFAQAQKYINERAPEITRFEAAATSDIVGIDHLTHSLKKAIEFIGATDYGRLRFVTKYEHVDHLLDARHNGKTRFRFSINSRYVINHFEPGTSSFDGRLAAARKVAGAGYKLGFVVAPIYRHEGWERGYFELFQELARQLEGMDLSDLTFELIQHRFTKPAKRVIEQRYPKTRLDLDETKRKYKWGRYGIGKYVYRDEEAKELEDTMRRYIEQFFPGAYVQYFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rescuing DNA repair activity by rewiring the H-atom transfer pathway in the radical SAM enzyme, spore photoproduct lyase.
pubmed doi rcsb
source organism Geobacillus thermodenitrificans ng80-2
molecule tags Lyase
molecule keywords Spore photoproduct lyase
total genus 128
structure length 340
sequence length 340
ec nomenclature ec 4.1.99.14: Spore photoproduct lyase.
pdb deposition date 2014-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rh0A01
3.80.30.30 Alpha Beta Alpha-Beta Horseshoe pyruvate-formate lyase- activating enzyme pyruvate-formate lyase- activating enzyme 4rh0A02
4FHFA 4RH0A 4RH1A 4FHCA 4FHGA 4K9RA 4FHDA 4FHEA
chains in the Genus database with same CATH superfamily
1KSJA 4OL9A 1T34A 3SSAA 3BGOS 1NQOA 4CN9A 5A9TA 5IDQA 3UBTA 4D26A 1LD3A 4Y1GA 4A16A 1CQJB 2H29A 1HMPA 1RJFA 2WJYA 5BW4A 4TYYA 1U0FA 1V3QE 1U7OA 2VTBB 5FOTA 1G8KA 3SX0A 1KYIA 3TS1A 3QE0A 5I51A 2MHCA 2O4CA 4TTRA 3IRUA 2J48A 1K3TA 4MQBA 3VC3A 4KQKA 1P4RA 1E9DA 2IKQA 4GPIB 3EDCA 2PMFA 3GVHA 4I4TB 5LU9A 3LF2A 2NTEA 2YX1A 3NATA 3TSYA 4DMGA 1KTVA 2R1ZA 4BMYA 4EP1A 3WRVA 4E5UA 1EE9A 3U7QB 3KVNA 1K3FA 2IYSA 2FKAA 2PV0A 4JLOA 2XOKD 4GKJB 1J20A 2WD8A 1Q7CA 3QI2A 4WZZA 3SZOA 4ACBA 2FE1A 2RCNA 1BMQA 3GJRA 4NMMA 4LXHA 2QLJA 3HWSA 3OO1A 2G9QA 1BMTA 1IHXA 1EA5A 4DIEA 4IHJA 1T0IA 1E61A 1EVZA 2P6RA 1X38A 2VJPA 3A6JA 3IJEB 1Z18A 4PAOA 4MR9A 1KDTA 2OWDA 2ZI6A 2ZBDA 4KYVA 3E9YA 4G97A 4Q4DA 4QPPA 2V7QD 1YB1A 4E14A 4EG1A 1G59A 2FSFA 4JC0A 2W2MA 4P9NA 4X8HA 4M1MA 3SKXA 4FYYA 5DKFA 1JDNA 4MP8A 3HR7A 3AHEA 4QXPA 4Q7KA 2P2DA 2SICE 4PAMA 4WZAA 1J21A 3E58A 1XZBA 3UHJA 4IO1A 4S05A 4PR3A 1M2EA 3HBLA 4IS3A 4J0JA 3I2IA 3P9SA 4RMJA 4BZWA 5IZCA 1EUCA 2X1MA 1E1NA 4HAIA 4H31A 4RDHA 1TIPA 2GKSA 3SZGA 2WSIA 1CY4A 3D3KA 3I04M 3T3MB 2CHQA 4DV6B 4LMAA 1XR3A 2A9KA 2YOGA 4FFPA 5GTDA 1XPOA 3LX5A 5LQJA 1SD1A 1XEXA 5EIFA 4B7AA 2BBOA 1X94A 4MCAA 2D13A 5CCEA 1IRXA 1F2TA 3N2GA 4OKNA 4D3ZA 1RRVA 1YKSA 2I4RA 4R8VA 3FWYA 4YIHA 1RWVA 5CT8A 2ZRGA 3NBUA 2Z5GA 3AVYA 3PQ7A 3UK0A 2A9OA 3WRYC 3TJMA 3HB5X 4FDMA 3A4LA 3HVHA 1T0HB 2AN5A 3BCUA 4Y1EA 4LQCA 2HR1A 4QO8A 1JG7A 1ITZA 2PGDA 4FYXA 3U4MA 2F00A 1DAMA 1PGNA 1EAMA 1WB5A 1YJBA 1IEVA 2AOVA 2VHYA 3A3PA 5ARDA 1YZGA 1PJZA 4QG7A 1MAUA 3EVEA 2D1RA 2JCGA 1V26A 1WEKA 5EWMA 2CEAA 2D0PB 2FUCA 2XQFA 5A2GA 4JUBA 4V0KA 3MMXA 4D4IA 3R2JA 2PYZA 1P0IA 2O1EA 3H11A 4I50B 1QYWA 2VFAA 4MTCA 2GT1A 3SZRA 4DCSA 1EWVA 4RQBA 4EKYA 1JAZA 1Y42X 5JZMA 1AV7A 3L9XA 3TLCA 1QGZA 4KR6A 4CG1A 2LVBA 2PIDA 3LI2A 5E4TA 1W0JD 1WDMA 2O6HA 3LPAA 1Z5NA 2H1VA 4MAAA 1UXJA 3IHLA 3IPXA 5HW0A 1CBUA 1PZGA 4JA2A 5E8JA 5ICFA 2ZBGA 1J23A 4JK3A 5J2UF 3ODPA 4GGMX 1Q95A 4DWWA 4J7CA 5IZ4A 1ZD9A 2FGKA 1TGYA 1UBUS 2ZBFA 3L0CA 3DWIA 5KHOC 4C2TA 3GEHA 2F4NA 4KLRA 1VA4A 3BXOA 5KWIA 4N54A 1FFHA 1X42A 3PCXA 3CFYA 4KVAA 4E2XA 2QVBA 4XX1A 4WESB 1DC4A 1GUBA 2W6ZA 4LWZA 1LFAA 2ZBUA 3F5DA 3I9FA 4MVCA 4US0R 1W94A 2BD0A 4MEBA 5HSGA 2IU3A 2GBCA 2HNKA 3T6KA 1J5EB 5C32A 1OU4A 2DERA 3P2OA 4MGZR 3U44A 2DUWA 3SJAA 1U94A 2G5CA 1VKRA 4CDMA 4AY2A 5LU8A 3LKDA 4H17A 1T9DA 2PZBA 3U1BA 1WZ2A 1GR1A 4XX0A 3IOCA 3U1VA 2FLWA 4KYUA 4C14A 4GM1A 2HYDA 4O2BA 1EX1A 5LL6P 4QU5A 2LTAA 1PQYA 4BP1A 3UXYA 4RVCA 1LEHA 4Z3KA 1L5FA 1N5LA 4GP7A 2HDNB 4KVGA 2DQKA 2GZAA 3PXXA 4N5LA 4XIJA 1UAGA 4AK9A 1OLTA 5B1YA 1YRBA 5E2AA 4OHMA 1G7RA 4AKGA 2QPTA 4N6OA 3DEJA 2ZJ1A 4TV8F 2OZVA 4RELA 1YZNA 3FFWA 5GV8A 3UW3A 5F5LA 1SBTA 2EJTA 3QYFA 4P6VF 3RYIA 3KHTA 1PQ4A 2G5TA 2YBEA 4EVSA 3IP6A 5BPHA 5MFPA 3OD5A 1CFJA 1I7DA 3KOXA 1VHQA 4GSLA 2OV4A 4L73A 4LXQA 5JALA 2WR8A 3WP0A 1CJCA 4IMJB 4ICIA 2J85A 4Q21A 4CQNA 1B7GO 2H51A 1TEVA 2NXWA 4MNTA 5FWXA 2XPCA 2VSNA 1RTKA 3GLFA 2DEUA 1FX0B 1HRKA 5G4LA 2BM1A 1V8DA 2CNOA 1BS2A 2HA3A 3QHPA 3RYCA 2ZBQA 1Z8FA 1DTWA 1JEQA 1Y3FE 1GQYA 2F1OA 4OOFA 5TMBA 1I3OA 3JWPA 4RSHA 5JIBA 5AQ1A 1QFJA 1VJ5A 1UAAA 2VHZA 3EXG1 4X93A 3ILXA 3H5WA 1NURA 5ENVA 2AG0A 4L3VA 3TNDA 1KKMA 3I92A 3D1VA 4H6WA 4IQGA 4HL6A 2G9NA 3R3HA 1RWBA 4IDAA 5ANRB 2OV6A 2X5OA 2WOOA 1G8JA 4PRZA 2VHVA 1MGOA 3GROA 2H2FA 3TQCA 2BP7B 1N2JA 3RS2A 4Q4AB 1XOIA 2SCUB 4PPQA 1OFUA 5IM5A 3TO5A 4EJSA 3T52A 3ZZ0A 5HYVA 1B23P 3IEKA 1YACA 4Y67A 2P68A 2H1HA 1BMFD 2JIMA 3EQ7A 3RYFB 3KC2A 3O1JC 4N6NA 3UQYS 1WHTB 1JDVA 2OGWA 4F6RA 2W83A 1V35A 2PWZA 2WV7A 3TR0A 4A6PA 5GJWC 4IJVA 4CKEB 3IXQA 1J99A 3Q8WA 4MV4A 2E7ZA 2HO4A 3WJ1A 3WQRA 4DXHA 1W36C 3WZ2A 1I14A 4OHRA 4PC6A 3WTCA 3NHFA 3EQ6A 4M54A 2I3DA 2Z4SA 4INJA 4WXRA 1FYXA 2BFAA 2O2EA 1AXEA 4BBAA 4IJMA 1QF6A 5DNDA 1A9YA 3M6FA 5JC1A 1W4ZA 3TFQA 2CJWB 5THQA 5IM4F 2YBDA 4REOA 4AG5A 4NP6A 3U5ZB 2GEKA 1U7XA 3NAQA 4HYEA 5CVDA 3V00A 1RYNA 4RTRA 2R8XA 3AV0B 2VH5R 2R5FA 2OQRA 3HB4X 3PIIA 1OFTA 4MJXA 1RHUA 4R1TA 1E3LA 1M6YA 5FOVA 1ZIPA 2X0EA 3TIFA 4KITB 1KMIY 4LWOA 4D74A 5K0LA 2VVTA 3EY9A 2E4AA 4YRFA 1MEJA 3PFKA 4UQPA 2ZWVA 1H23A 2GM4A 4MUGA 4RZIA 3J80A 1YVDA 4LYHA 5EMLA 1HDIA 2DM6A 1FB5A 4J03A 1B4DA 1VXOA 4H1HA 4MWDA 2D7CA 4UBKA 3R7WA 3DOIA 1C1YA 1VM6A 3RUEA 2XEDA 2W37A 1P7PA 3IRVA 5KYXB 4MRMA 4NXNB 5CCBA 1ADJA 1XTSA 1M67A 1EU1A 1JPVA 1KO5A 3DE0X 4N03A 1TU3A 2E1PA 4AWXA 1UCFA 5EXDA 1C9NA 1XYGA 2X2PA 1F9AA 4LMBA 4A8PA 4OVKA 1GPNA 1DDIA 4RKQA 5DM4A 1D6MA 3ABQB 3OX1A 4LXGA 4B80A 1C8LA 1NQ5A 5DLEA 4DJJA 5JS7A 5FLXA 4TYWA 4K3UA 2BC9A 3BTOA 3MJVA 4YRPA 2VWHA 3LAWA 5EE5B 5CFOA 2PANA 4LXYA 3QLUA 3E84A 1HT0A 4LV6A 1XCGB 1RCTE 4QQRA 4Y3UA 4DWJA 3T1TA 1L7BA 4LC0A 2I8AA 4OB8A 1PK7A 1YZ3A 1BQEA 1SKQA 4JT4A 1QX4A 3PQ5A 1C8BA 1VG8A 4MI1A 2OPHA 2QAGB 1CB7A 1GFWA 1WXQA 2CYAA 5LYJB 3I9MA 1T5DX 2HA5A 5H9WA 2W4MA 3QPBA 3A14A 1P0CA 1Y1KE 1JHQA 1NASA 2FSIA 3QIVA 4MUHA 3BZUA 4HNVA 1R64A 3K94A 3WXMA 2QX7A 3VH4A 2C5SA 5CXUA 3GUHA 4LDZA 1YULA 1QIGA 2ISSD 5DLQC 4FFVA 3HXPA 5F2EA 2DLCX 2J8ZA 1CUWA 1BH2A 5I9SA 1AF4A 1KXZA 2ZJAA 1FFSA 4J1TA 4CV1A 1KSGA 4E1BA 4CTMA 4I1VA 4PTYA 3FPEA 1TU0A 3EC7A 3E5HA 2QRZA 1IU9A 1CR6A 3AMVA 3WHKA 4C0QC 1L5VA 4UHHA 5FJIA 1RRKA 1BCRA 2PZGA 3THYA 4WA7A 2V58A 4AU1A 2CD7A 1E2KA 2ODTX 3W1WA 1CIPA 1VYHA 2H7VA 3O2QB 1NIPA 4UEQA 3GLIA 2CCGA 1DP4A 3U3DA 4S1VA 2VDUE 1G9XA 1PW5A 4P3KA 1MX3A 5E9QA 5IKPA 2YQ4A 1L4EA 3PL1A 4JVLA 4EFLA 1OC4A 3LCRA 4HTFB 1P5ZB 2Y0BA 2QLTA 2XCQA 3TZHA 1YZLA 1LPBB 1NBHA 2MYPA 1ESDA 1SVNA 1X86B 2D62A 3BERA 4JYMA 4MMXB 5DTQA 3BDVA 3R74A 3TOVA 4AJ4A 4CMEC 2XDQA 4IG9A 2AFVA 2GESA 4LK2A 1P2SA 1T36B 4H08A 2A1UA 2A58A 2PAAA 3HKBA 3AP3A 1MQ8B 3GJYA 5IASA 2HA4A 4O4JB 1QC5A 3BF7A 3B5IA 4MVWA 2P40A 1QHEA 1L7OA 4QVGA 1EWKA 5CEEA 4IVRA 4QEDA 4ZCIA 2OXTA 3VNUA 1OI4A 1SVWA 3EODA 1KJQA 3ZJVA 1FA9A 4JEIA 4O4LA 3VUEA 1CDEA 5FWAA 2GTPA 5T3UA 3T0GA 1GHTA 2J7KA 4YJ2A 4PHCA 2NPOA 1Q5PA 4GVXA 4J43A 1KEKA 4TZ6A 2V7TA 5ALSA 3NKVA 2P0YA 3AHHA 3OCXA 2AUTA 5AKZA 1JQEA 2CDNA 2PKQO 3V1TC 3WGQA 1PEYA 1ZC3A 1ZD8A 4L9SA 2OENG 5K0CA 4LGVA 4TZKA 2OAP1 2WAYA 4MROA 3REQA 4KZPA 3LBAA 4PYJA 1GSOA 1RW4A 3O47A 1H9BA 3HADA 3CCCA 4LJ5A 4JC4A 1I4DD 5EKXA 1PWHA 4I46A 2DBRA 3UANA 1I13A 2X9NA 3RKSA 5ELMA 4MKFA 5GZ6A 3VR1A 4AIIA 4K8RB 1A95A 2IKSA 4GOLD 5FTLA 1V3VA 4OHWA 4X66B 1L5WA 1CUXA 5G3ZA 5CW2A 4BJ1A 4M9QA 4R84A 5HQ3A 1CF4A 2R7LA 3SS8A 3OURA 2PSDA 2LKDA 3GDOA 4H6VA 1U02A 4O4IB 2XCUA 2QR5A 3VH2A 4OV6B 3MHTA 3CUEF 1FYFA 3KV3O 4I55F 4PPNA 1AK2A 6ABPA 3CA8A 1CZRA 2NXNA 1RPTA 1XNQB 3C3CA 3L7KA 5B6PA 2FW1A 1B0ZA 4QOHA 3Q1LA 3GFOA 2ZIVB 1TW2A 3IAHA 1JEEA 3R77A 4GP6A 4DRXB 3F78A 1IBRA 3CS3A 1E8NA 5DMHA 5ERXA 4NE2A 2ENWA 3H5VA 5GIPE 3AVTA 4H1TA 2OO3A 4BNYA 3IUQA 4CQLA 5AT1A 2WTNA 4DLRA 1Q0ZA 4BLRA 1QX3A 3CEHA 1MMFB 2CNWD 4X8OA 4B7UA 3HUTA 4BLVA 1UR5A 2ZYGA 1QHHA 5C4MA 1OAAA 1A96A 4NG4A 3RIEA 2FFJA 2RHOA 2WYIA 3WFIA 1GM5A 1I5EA 3RUIA 2ZUUA 2OR3A 4HR7A 3MSCA 1EI9A 3S1AB 4M0FA 1YRHA 3UW1A 1JX6A 3MTGA 1IFXA 1PZEA 3GGSA 1MC8A 3FGOA 4OFXA 2ZVQX 5EE9A 4KN5A 4N49A 4RK7A 5A3QA 3GBVA 1JQLB 2F1IA 3KIPA 5EGSA 3BIFA 1P61B 3I12A 1M1XB 1M2VA 4YGXB 2R5NA 3AEKA 4ZO6A 6REQB 1FUIA 2C0QA 1NXWA 4HVCA 2XGGA 3DNFA 2QL6A 1USKA 2FNAA 3M81A 4B43A 1DSSG 3I45A 1SKUA 3WLNA 2GUGA 4WVLA 1H3NA 1Y1QA 1B93A 1ZUIA 2P4SA 2IXBA 4NAUA 2Y76A 2P8SA 1Q92A 4PYNA 3ZWNA 2FMKA 3VBCA 2YWRA 3KO8A 3ZYZA 1NNEA 2OLEA 2EGUA 4QODA 5AW5A 5LA6B 1QFZA 2QRVA 3TJZA 5JO0A 1IQPA 1VLHA 5C7OO 1EHIA 2PUAA 3C15C 1R15A 3HXTA 2PYDA 3IA7A 2HJRA 3LNTA 3LW8A 3PUVA 5DTJA 5CBPA 4W1PA 5BSRA 3I5XA 1AY0A 3EZYA 4D7AA 1EFVA 2WM9B 3D3WA 4O5OA 3TVTA 5BRJA 4X1YA 4K03A 4HLNA 2SCUA 1P29A 1NRIA 2F3TA 1DAGA 3CH6A 2O8DB 2WRZA 1NWCA 4HNQA 3BTVA 2CVPA 4NXMB 4IW3B 1JU3A 1SH7A 3PSAA 2JG3A 2ONKA 2FMXA 4LA4A 3JYOA 3M8KA 2JASA 1AN9A 3AL2A 1QKKA 3ULKA 1FP4B 2VRCD 3C3KA 4C1NA 2QN6A 5HBGA 1JDUA 4UUOA 1TVEA 4QPDA 2PUBA 3FNGA 2HQ1A 4UTXA 2Q2QA 4GI7A 5DF1A 1GDTA 4LZNA 3LFUA 3DTVD 3PUWA 4ZO4A 2ZT8A 1G41A 1NMYA 2Y2UA 2M9MA 2G9VA 2N42A 1MB2A 2W0MA 4WADA 4KUGA 2XXBA 4HVLA 2ILVA 4ZVSA 1VLZA 3COPA 4QDUA 4BGDA 1KI9A 3QKSA 3MTBA 1JKIA 5TIIA 4P7FA 2WFLB 3HS3A 4G2NA 1L5MA 1PJQA 3UMCA 3BGIA 5TS2A 2V4ZA 5LZ9A 4YONB 1BOOA 3K1AB 2WY2D 5ALGA 1ZLYA 4XGQA 4Y6LA 5J2UA 1ULSA 3KWFA 3R7NA 2PU7A 2C95A 2GEFA 3D1JA 4YJKA 1BTOA 3A6KA 3DF7A 2CN1A 4TYQA 1ENOA 3ORRA 5ESDA 1SBNE 1TXGA 4NV0A 1ZGGA 3K8OE 1OHHD 2BISA 4JOQA 4K5QA 3RVSA 1APBA 5TMEA 2ES4A 2QB5A 2R79A 1QTNA 1STOA 2XB9A 3GLUA 4JOBA 2H4JA 3TDKA 2YV2A 4G9EA 3UAOA 2ZZMA 1BHSA 4NYJQ 3GXOA 1J2RA 2FF5A 4GPEA 3CQ9A 3K70B 2WDPA 2AD5A 4DDVA 1NMSA 1BVUA 1I7NA 4JOCA 5BT8A 3O4VA 4OO3A 4B9EA 3QK7A 9ABPA 3ZY3A 4AJLA 4YEDA 2DAPA 2QI9C 3JQEA 5KTMA 1KC1A 3QUTA 3LPNA 1YA6A 1ZL0A 1V11B 2W8BA 1MB9A 1MAAA 2X3UA 5H59A 4B3GA 3AGQA 2VSYA 2DQ4A 4CL8A 1J97A 4FILA 4PSCA 4HB0A 4QOFA 4RANA 4G8BA 2Q2NA 3FM9A 1GL9B 2OV1A 4EW1A 2WMOB 4D4LA 2IHNA 3U40A 2WP8J 1BEEA 3A4NA 4QQNA 1Z83A 3FMOB 1AT1A 2SKEA 5IFLA 2XOKA 4UMEA 3WK9A 2W42A 2D0OB 4DR7B 3P26A 3JY6A 2B8EA 2CZGA 4MWEA 1ZXXA 4W63A 4MSUA 3FWKA 4JB0A 4HNAB 4P8RA 1NBMA 4UVHA 5ALQA 3VDRA 4CR8A 4REQA 3CTMA 1F2UA 5EVCA 1KZ1A 4HNRA 4JI8B 2GPWA 3VH3A 1Z22A 3D64A 2C2YA 2H1LA 2CLKB 1GAXA 4RMIA 3L7LA 3B1VA 5AXAA 3KB1A 3MLBA 4HFNA 1IZZA 5FNVB 3UAWA 5AIBA 3PJRA 3KM0A 3CJTA 1SVMA 4K6HA 1T1JA 2L19A 3UMRA 1DIOB 1N2HA 1QR6A 2CFOA 4HEJA 3ICQB 3NCHA 3E23A 4LIPD 2H57A 5LQSA 4A6XA 4U9HS 1K8RA 3N6RA 2W6JA 1SOMA 4Q1AA 4KFSA 1G8SA 2ONCA 3MD9A 1A5ZA 1FQJA 1MX9A 1R9GA 2QE7D 1P2GA 1QO0D 3OAAD 3CZ5A 2NLOA 4CM8A 1Y7TA 1EG7A 2J4DA 5HM6A 1KFEB 4NU6A 3IUJA 2YCLA 4C0BA 2BHRA 1ECGA 1CVRA 2DFKB 3OIUA 2C4UA 1DAOA 3PD7A 2GAIA 4GYWA 4TQGA 4UTNA 4KR2A 3HBJA 3DAOA 1NMEA 2PGOA 2QJOA 3FA2A 3IE2A 1E1RA 3P45A 5LC1A 3SLRA 1AUXA 5A9SB 2GF0A 2GD0A 3FLAA 4JODA 1NUAA 4MVJP 3U4QB 3BFKA 4ZOEA 3K4PA 5F2NA 3NXKA 1L4GA 4IG4A 1D1PA 5DHTA 3SZUA 1ZAKA 3ZBTA 4DAEA 3CW8X 3AIKA 1NC1A 2DZDA 1SKYE 1K5GA 3DULA 2L18A 4RJTA 1JYFA 3UMGA 1H05A 3TJRA 2GVZC 1T6BY 3ROFA 1VIYA 2YV3A 1XALA 2QRJA 2VYND 5BMOA 4BAGA 3H86A 2WQ7A 4CKBA 5CDYA 1I6LA 1DGQA 3FYUC 2AZMA 4P4LA 4D0GA 3AEUB 4BCCA 2WIBA 4WK2B 3B7WA 2OBNA 3G13A 4Y6SA 1MNQA 1Z5OA 2NZ2A 4EVIA 5ITZA 4YHBA 2IU0A 4UDXX 1KYXA 3TRJA 4D3DA 4NESA 4N1AA 2A1UB 3ZIDA 5BT9A 1QC5B 2JH3A 3HA5A 3LVQE 3IESA 1JNXX 2QRPA 4RKEA 4GPZA 3V4RA 2VP6A 3MNFA 5AJUA 4BLWA 4D9GA 1DTEA 2WWWA 4KJZA 3QU7A 2IYZA 3AVWA 3GMIA 5I4BA 3SEAA 3U9TA 4KMSA 3BK1A 2PGXA 4S24A 2HU7A 1M1YE 4TRJA 2XGMA 3V97A 2X4IA 4M55A 4IX1A 4EKIA 3HXQA 4QT0A 3OKPA 3PEEA 3HYCA 2FRDA 2J0VA 2LZ0A 2X8LA 3I9V1 3QSGA 3NRBA 1Z0IA 3I6IA 4JI3B 3QJYA 4XGRA 4YS6A 3SMQA 4AC9A 1N2EA 2QXTA 1JB1A 4ARIA 4EYSA 5FL7D 1VQ1A 1I7QB 1P2TA 2RGRA 2RKOA 5H7XA 1N9GB 1VL8A 3P94A 4YXWD 3B1ZA 3GFGA 1PDWA 2HWWA 2LWIA 3FIUA 5BUZA 2WOJA 3FPKA 2EKQA 3NCTA 3PNOA 2OORC 2J5KA 3MGCA 1FTWA 1MC5A 4N7JA 1Z63A 2X41A 2Y71A 1M72A 1KI3A 3OZXA 4RLSA 1XWIA 4XGNA 3V33A 3ZNQA 5HUQA 2DCMA 3SGLA 4Q7LA 1THMA 1B0UA 2M6KA 2DFTA 3WZMA 4CEIB 1NW9B 5G3YA 1O54A 2PAFA 1MC4A 2GZSA 3ZK7A 3Q7SA 3H1FA 4YPVA 3A10A 3F8SA 3WGOA 4AG6A 3FVTA 4F5EA 4Z4IA 3FRJA 2FSHA 4OP1A 4YRLA 1WNTA 1WCIA 4XXHA 3UKJA 4FMCF 2BLLA 2AN9A 3TAUA 4CCSA 2G8LA 3UCXA 1EUQA 3S6JA 1V16A 3G2QA 3MCWA 4P83A 2B7BA 5JYEA 4L4ZA 5F64A 1CFZA 1MJGA 3F96A 1QH9A 5C1OA 2ZYWX 2C29D 2WF5A 2V1XA 4M60A 1E0AA 1KEPA 1FYEA 4GM4A 1E5TA 4QLAA 3S40A 2O2DA 2ORVA 1G66A 2Q5OA 4M9ZA 4UZFA 2B36A 2G08A 3CSDA 8LDHA 4CJXA 1R18A 5DYGA 4L0MA 5FTWA 4NWIA 4Z9BA 1UKVY 3CEJA 2BEUB 3R44A 2DPMA 3KQVA 2CXUA 1LDBA 1JR3A 3L1HA 1EUCB 1NUTA 2AZDA 3OICA 4KPYA 3FB1A 1N32B 4IDDA 4MA0A 1VE7A 1TVKB 3MJRA 5JJKA 3M1IA 2VUSA 2W2KB 2RC6A 3HI6A 5D5HA 4R2LA 2RGCA 4F21A 2QRVB 3RUFA 3EGOA 3RVMA 2HI0A 2QSJA 4ILEA 2PGAA 2QQ5A 1WE2A 2JJ1A 4BRWA 4C2AA 1RZRA 2D0IA 3A1NA 1Q0UA 4G5OA 1MR3F 3SE0A 4UCXA 2CLSA 1KE1A 4OHBA 4FJ2A 4WFKA 2QE6A 1SOUA 1DZIA 2OMKA 2UZ3A 3QOYA 4CF6A 1NQXA 3ES9A 1GIAA 2Q1TA 4MW9A 4Q5IA 5LBUA 4HPWA 2N3ZA 2PH7A 1EGMB 4HH1A 5A9RA 3CMCO 2IU4A 4ZO7A 6REQA 1I36A 3UHOA 3BMOA 4L4SA 4JROA 3GO4A 3X1KA 1BWSA 1XRJA 4FYWA 4RABA 3JARB 1MENA 2I22A 5ECDA 2NP7A 2N46A 3PZRA 1CXZA 3LGSA 2G28A 2JFZA 4JJ6A 3F47A 9LDBA 3QM1A 1Q2UA 3SNKA 4EG6A 4LNHA 1P7VA 4LI0A 5KCZA 3L8ZA 2ZAGA 2I3AA 4FZJA 5FPPA 1DCMA 3ONFA 1RPZA 3PD0A 1XPJA 4LV8B 4DM7A 3UB3A 3VPSA 5L3SA 4FQ5A 3I9KA 2WNHA 1PJLA 2O14A 3TN7A 2VYQA 2WKSA 3R23A 1ZW6A 2GK3A 2DWQA 4R68A 5AXCA 5KYWB 1TE2A 1GV0A 4QLOA 4R1SA 1W5BA 3EF1A 5A4FS 1T24A 2ZPAA 5BOVA 1OZAA 5C4GB 3ROXA 3W6UA 1Y6GA 1N6LA 3I6BA 4HNTA 1L4BA 3EG5A 3ZY5A 5GQSA 5EUQB 2XWBF 5BN3B 1PHPA 2OK8A 4XA8A 1P18A 2XTJA 1V0JA 4RM3A 1GL3A 4D98A 2HFJA 3EGDB 4E5NA 3L6RA 2H52A 4I9FA 5K0TA 1M8PA 4EA6A 1OOEA 3IDFA 2XNSA 3Q7PA 2I76A 2VYNA 1PEDA 4YFVA 3JW8A 3BRCA 3PA8A 3L49A 4XCVA 5CT9A 2DR0A 3WFZA 2CXTA 1IB0A 4EUKA 4JT8A 2JCXA 2PRZA 2W2OA 3NRJA 1TQHA 2OZKA 2NV2B 2WT9A 4WEOA 2QIOA 2A7XA 2AMFA 3EA4A 5DGTA 4F8EA 2GXAA 2IHUA 2VAXA 3D4LA 3K4QA 3SPXA 3V1LA 2YC4C 4DXDA 5DXFA 4A2CA 1TAHA 2Y8EA 2VPXA 4EL0A 4RTPA 4EMBA 1S6YA 1MEEA 1WRBA 2ZBRA 3LZCA 1WQ1R 3GQBB 3L6CA 3ET5A 2JKYA 4YAFA 1M5UA 2UZAA 2EVWX 4CHGA 1L5HB 1WEHA 1B6GA 3I9V6 2EQ5A 3KUKA 2FJUA 2HWYA 3X1DA 2CB0A 2QUIA 3ZCSA 3A6GA 2KBEA 1PAUA 1XG5A 3N8GA 3IUPA 2CLEB 2DH5A 1O8CA 1J2UA 2IYYA 2NZ8A 3Q3GE 4GSKA 5SZJA 2V0NA 3P2EA 4PVCA 3RVJA 1LSOA 3GT0A 3I3SR 4AP9A 3KKOA 4YR7A 4H1WA 5FXMA 1SHUX 2IS6A 2IY7A 3GF4A 3ZK8A 1UBRS 3Q85A 4XWYA 721PA 1XDUA 1AK9A 3TLKA 1JR4A 4GM0A 4XR4A 4C87A 3MTEA 3NEYA 3ZIAA 1QVAA 2AQ8A 4ZKEA 2HDHA 2I6QA 1F2VA 2YN2A 4KBFA 4S1PA 3P19A 5E0OA 5E3IA 1XCOA 5GONA 4PZEA 4QGSA 3TECE 4OQMA 2PT9A 2VJMB 1SCJA 1W5TA 1X87A 2R96A 4I1RA 5HMMA 1XA4A 4AKHA 2IP2A 5GJCA 4TT3D 4OLBA 3ACBA 2ZIXA 3NBKA 2PZLA 4R51A 2E89A 4FZVA 4JJGA 5TNXA 3Q2KA 5TQ2A 4TYNA 3S55A 1OBOA 3DAHA 3E81A 1QRTA 3G7SA 3OCVA 3QFSA 4Y9UA 1QHFA 4JL8A 4YJ2B 3H5OA 3T35A 1YRQA 4D4MA 1X9IA 2ACEA 5JDCC 1G20E 3ND9A 3NVKI 3FYCA 3I8OA 4UE2A 3T4PA 1DL5A 5JBIA 2XIQA 2IV7A 4DLLA 3F97A 4E7OA 3ZBUA 2DUNA 4IJ6A 4NCBA 5EMJA 3ISTA 1C9MA 5GZ3A 2P69A 2J0SA 4GXQA 1R0WA 3KBBA 3CSUA 3LP5A 4H0FA 4JQSA 5FOQA 1I7LA 1OTXA 4MQ5A 2WU4A 1FDSA 2FE4A 1U1DA 3DE6X 5DVZA 2RBKA 5ALWA 1GR0A 2GCPA 2O23A 1L7PA 1UKYA 4XB2A 1T4CB 1JFRA 1HFWA 3MGKA 4MW2A 4N12A 2LV8A 3CRW1 2H11A 1WULS 3TL3A 3VH1A 4PPGA 4I9UA 2I87A 1RLJA 3COZA 3CX3A 1OFUX 1HT1E 1U4NA 1Y1RA 2VQ6A 5DYNA 3QPVA 2RHBA 4GRAA 5EL0A 2BKVA 2V03A 3DBHA 1SU6A 2IHTA 1WDTA 3HYTA 2E87A 5EINA 1GZDA 2JRCA 3IGFA 5C1DA 2WABA 1D2MA 1GNSA 1O1YA 1O9GA 2WFMA 2YDYA 3A58B 4U00A 4AJJA 1IL0A 2OE2A 2ZT7A 4OXRA 4AMBA 5DSTA 3I37X 5IVKA 2VTVA 3O3CA 5DNYB 4YRZA 5FAXA 2IPNA 5JJIA 3KQKA 4EHKA 3DR3A 3RVQA 1LC3A 3DPIA 4CKWA 3EVZA 3QWBA 1Z68A 4L28A 3PPVA 3O1LA 3VR3D 1M1YB 1A7AA 2QU8A 3JRXA 3FSGD 3LP6A 3GUZA 1Y37A 4G37A 1L0BA 2V1UA 5LQMA 1SN7A 3VZQA 3IAM1 2SHKA 2QTAA 3M1LA 4W8GA 2OAEA 3L7DA 1R4NB 5BVHB 5M3BA 1NR1A 5HA5A 3OQ1A 1YVRA 5CG2A 1Y5IA 2AI2A 1DXYA 2HSJA 3PNMA 2XUAA 3PNPA 4RF2A 1J70A 3QA3E 1FU8A 1NRJB 4V0OA 3FOZA 3UPUA 2WIGA 1T2DA 4CE6A 4P4SA 1IG3A 2XRFA 3WTBA 4LGCA 3PDHA 3GLHB 4HO1X 2C57A 1L2TA 5D1NA 2X8JB 1QTQA 1HEYA 2AOTB 1L7EA 2YR0A 1E5LA 2CJXA 1Q22A 2BFOA 3H9QA 4BCDA 5IT9A 4M4SA 2X8BA 3LPMA 1M0TA 3CVUA 1PE0A 4UHBA 5JCXA 1X7ZA 3IUNA 5M29A 3GDWA 1ZH0A 4A5SA 4TMFA 4C3UA 5C5IA 1P7ZA 2IDZA 4ZK6A 1W30A 3SG0A 5IABA 3SMVA 1Q16A 3KAJA 3D6VA 3FNIA 3MS4A 3K53A 4Q12A 4ZAGA 3UHPA 1I3NA 3ZHQA 4P4GA 1IN5A 1HDEA 4YRAA 3TLJA 2YMPA 3H05A 1M83A 2Q4DA 3A31A 3HL4A 2IHBA 2P30A 4LMRA 4MW0A 2EBUA 3VKUA 2CMDA 1MAHA 4UM5A 1YAHA 3H4IA 2VAMA 5FQNA 4UD2A 3EUWA 1DAEA 5BP7A 4JDUA 1VBKA 3AHCA 4L9WA 1ID8A 1ZYUA 3DKRA 1SBIA 4HGZA 4J90A 1E1MA 4NNOA 5E7MA 4HUQA 3V7UA 3IYLW 4V0MA 3FOFC 1F3LA 5F33A 4OI1A 3ZU6A 2XR1A 1EQ2A 2QMQA 3GEPA 1HE1C 4O33A 4UTZA 3JWJA 5JD3A 2M1XA 1RRMA 3B70A 4CLOB 5HUHA 4UBLA 1BXRB 2WVAA 2VYVD 3H75A 3W7BA 2AFIB 3ABOB 2YIDA 1QCYA 5HJEA 2MT9A 1U7PA 4EABA 1UMDA 1TC2A 3OKFA 3GAMA 1Y7PA 1NBOA 1J0EA 1ODLA 1TJ5A 2ZITA 1H2RS 1OCEA 3INNA 3L7IA 3C3PA 3NGLA 4D9NA 2E37A 3OQNA 3SBDA 4Q93A 3GIDA 1C0KA 3ZZTA 5CFLA 1YR3A 2ZAYA 4GQIA 1UMKA 2GN6A 2D5LA 4HRXA 4RD0A 1QTIA 1DC5A 3T9DA 2HH9A 2XA1A 4M1EA 1U2SA 1W8DA 1KOFA 4CEHB 3GPLA 1N6RA 1XRRA 3ZV5A 2X5XA 1WCYA 1XLTA 5IYZA 5HS6A 4ZT4A 1ZMRA 4AMVA 4DQXA 5EJ4A 3WK6A 2WQ6A 3ZGLA 1L7RA 1IBSA 2TYSB 5IS2A 3ZE9A 3DC2A 5CFNA 3GHYA 4HSEA 4ZZ3A 1K6JA 4BLQA 4JKIA 4UEKA 2X1LA 1NLYA 1YL6A 3HB0A 2YKGA 1JHDA 2AC4A 2AOUA 2PKYX 1YQUA 3H19A 4J9UE 4GR4A 3J81A 3VJKA 4Z8XA 3HB7A 5AKKA 3EWSA 3GRCA 1E1KA 4DBLC 1QPZA 1KBOA 1R6XA 2CJFA 1CEXA 4EFKA 4HG2A 2ZJ6A 3K1ZA 5LD2B 2FR1A 3V7NA 1GRRA 2PUFA 4GZ3A 4CHTA 2C3OA 4F1JA 2QTWB 3LUDA 3OM1A 4M8KA 3H2IA 3E7XA 4ARSA 4DS3A 4HI0E 4ZRNA 1OH5A 3Q3IA 2M2IA 2VXYA 4C5CA 2WE7A 3IR7A 5FT9A 2NPIA 1T5HX 3GH3A 1RQXA 2A78A 4KQ6A 4MS1B 1FPQA 5I9IA 3NTQA 3FJ1A 1AMUA 5HF8A 4L2IB 3WNCA 1BROA 1JEQB 4TSFD 2FN3A 2C03A 4OI4A 4CWAA 3E9ZA 3UXEA 3IIIA 5HM8A 2X2FA 2C97A 4MQEB 1YE8A 4C6SA 3RAFC 2E4ZA 4EAQA 4N3CA 4QWMA 5TR9A 1TTPB 3DT6A 2ADOA 3KLPX 4Y0VA 3DBLB 4WNCA 4ZVQA 1IAVA 5SY6A 1C50A 1UP4A 2NYRA 3GNTA 4D0SA 1OJLA 1D0VA 1UIMA 1CD5A 2JRLA 3EF3A 2VH2A 3EXG2 5DK4A 5ELXA 3NTVA 2VNIA 3RODA 4C05A 2J0UA 3P71T 3FZQA 3HDTA 3P9IA 4NH4A 2WJAA 3MG9A 1YA4A 1HV8A 3LQYA 3URMA 4R4JA 4DIBA 4TQAA 2VATA 4CETA 4G5RA 3FZGA 2VUUA 3BQNB 3RF7A 4QLBA 5IAOA 5AVVA 3EDMA 1IZYA 1H94A 2PVCA 2XEXA 1NP3A 2GCEA 1PGOA 2RHJA 3WYNA 5CEFA 1HTBA 4WL0A 5DFAA 2BYTA 5KTPA 2DE0X 2IBTA 3ONVA 5AHOA 3CTPA 1VCIA 3EGXA 1QLHA 5BW5A 1KE2A 2Q9CA 3LYLA 1SWWA 2W71A 2EXXA 4FNMA 4F3YA 5HXAA 3NW9A 3CX6A 1V3TA 3IBGA 1AG9A 1FZTA 3SLGA 1J9ZA 2HQRA 2CEKA 4WFIA 4Z9YA 2OA0A 5AJYA 3SIWA 2XB8A 4JYZA 4NPCA 3D6AA 3UWMA 3ND7A 4ND2A 4XWAA 4CKCA 3K9BA 3VC1A 3CPHA 1GLVA 5BN3A 4RULA 1SM4A 4RZSA 3BS4A 4HH4A 4JZYA 4MHOA 4ZYVA 5JMOA 3ZPXA 1G20B 2B8TA 4C88A 4MJ3A 1TRHA 1ZD1A 5AKIA 1HY3A 2I4IA 1UP7A 4DCJA 5HVNA 3PWTA 2V7WA 1KFJB 3P96A 4MVJM 3HA3A 4N3AA 3H5IA 2WU1A 3G1WA 3HKCA 4DDMA 4FNAA 4N82A 5BN1A 3U3JA 2XVYA 3CBGA 3HJAA 5ESWA 2O7SA 3KQMA 5C8YB 3W8NA 1ML3A 5IMSA 1Y3CE 3G8AA 1DNPA 4L4RA 1ZJYA 1NN0A 4H59A 3ZUPA 1GTZA 1ZM4A 2VJQA 3HJTA 1LWNA 5CDHA 3SOPA 1R8JA 3EEYA 1VHWA 4U2FA 4UVGA 4JXXA 3GEBA 3VNSA 1NJFA 1DTSA 2HY7A 4LRQA 1NZDA 1YTLA 4O4HA 2G72A 5J2TF 4JYCA 2F3PA 5C4IA 1NFFA 2QRHA 2R8PA 3LFTA 2W11A 2XNCA 4O8CA 4QNNA 2QMHA 3BWXA 5AKLA 1FYWA 1QLWA 5HF5A 5AD1A 5KNBH 4Q1VA 4BFWA 2FOIA 2IELA 4BWVA 2Q5LA 3TTVA 4QXAA 4BWGA 4WV3A 3G5MA 4UUBA 4BO4A 2ZETA 2J59A 3FUTA 2NVUB 1KP3A 2QN1A 3GLQA 2NO4A 3C8ZA 5HEKA 3G2NA 4QTZA 4LZLA 4CM6A 4ENQA 1L4MA 5JH7B 1G1MA 3ZHBA 2QTFA 1ZGZA 4UNNA 5IHPA 1FRQA 2CXQA 3MVEA 3BWBA 3TLBA 3GN1A 1JJVA 4OXIA 5FBWB 3MLEA 3FHTA 1QXSA 3WGHA 4Q3OA 4UM9B 2PFKA 3PRYA 3UT5B 4N4AA 3QSYA 2H4WA 4O4LF 4F5DA 4WECA 2I3ZA 2B8NA 1U8AA 3AIIA 3WISA 4X6UA 2O7VA 4KR0A 3CURA 3DLTA 4TL8A 4RL4A 4IDBA 5F9HA 3EC2A 2ZGVA 5CA0B 2NP6A 3BE6A 4HUTA 3DP7A 2W5UA 3O03A 3AVVA 1LNQA 2OP1A 3COWA 1OVGA 1QNFA 1UBJS 3ENQA 4V24A 3ZG6A 3NBQA 1ZPDA 4LZWA 5ALUA 4AJ1A 5I7HA 4HZUA 3GFBA 5JCJA 3L0DA 4OAQA 2G09A 1FP1D 2PMWB 5JV5A 5HKLA 3DWGA 2Q5JA 1W9MA 3KSZO 3MGBA 4KDCA 5BVHA 3BXHA 4LVOA 5J43A 2P65A 3B60A 4PZCA 4D80A 3ZZUA 5BSGA 1QE3A 1LTQA 4L57A 4M0PA 3CW9A 3LECA 4D6YA 1D4FA 4TMKA 4FGUA 3ZIUA 3BMCA 3KEGA 1SHKA 5C8XA 4MKXA 1II8A 3FROA 2PZKA 3ZX4A 3OZBA 2WWYA 3BFJA 1H0SA 3TPFA 3ZZMA 1QCZA 2B7LA 4TV9B 1UF9A 4FEEA 2PSEA 4WCFB 1PZXA 4BECA 3ESQA 4XWKA 3NHBA 4XD7A 1NSFA 1V7CA 1JBQA 1C29B 1KDYA 1X9GA 2HSWA 3WE7A 2A92A 2EIHA 5CBKA 2QIPA 3MTIA 1SNYA 2AW3A 3IKLA 4AICA 3EBLA 1D2EA 3DMHA 5M34A 2JF0A 3WVNA 5A04A 5HCNA 1I2ZA 2GPJA 4CM3A 1DAHA 1RE0A 3UCEA 1QP0A 5KYYA 3WLKX 3ED1A 3W4KA 5LWHA 4C4OA 4UBOA 1N6PA 1JEJA 2ZB2A 5LP6C 4ZMRA 1H3EA 1Q0PA 1VTKA 4FMPA 1H8HA 1IN8A 1N78A 1FLVA 2CZCA 3A2MA 1YZYA 1E9FA 3P52A 3PNBA 4YB8A 3WRXA 1Z6TA 2VAVA 4PQGA 4X00A 1C3VA 2QRMA 3KR0A 4HP8A 1FRFS 1T36A 3DE7X 4MV8A 5EQDA 3WWEA 4AS2A 5BXQC 1I2DA 1PNRA 1A88A 1DCKA 4WLFA 1TCCA 3PYLA 3HCCA 8ADHA 4E33A 3L4SO 3JTMA 3M6XA 2R86A 4MGEA 4ZT3A 5C3UA 2WG0A 1X7HA 4D43A 3QMWA 2AK3A 1ZU4A 3WFJA 4UCQA 1B15A 2GUWA 4RMGA 3UK6A 1OAOC 3BJIC 4YXWA 1E18A 2H0AA 1OLXB 3NBFA 3ZUGA 5J5AA 1IJBA 1DJQA 1IN7A 1WZNA 4Q9HA 4LBWA 4IDGA 1VPWA 5C8YF 1SQ0A 1Z2AA 2R1VA 5KCMA 2FW0A 2BWJA 1PNTA 3R4CA 4IHJF 2BFMA 1ORDA 3HZHA 4CCAA 3D8HA 4LOAA 1W4LA 1P9OA 2RGDA 3CF0A 3D3EA 3Q7QA 4IFTA 5DTMA 5THKA 4MWTA 1DO2A 2VYFA 3F6SA 3DV9A 4CFSA 1KJJA 4ITUA 3W5CA 3KDPA 4MS4A 3TSWA 4ZYLA 1V39A 2C00A 4DA9A 4B44A 3GP3A 3I73A 4LNUA 3W06A 1PG2A 2NW6A 4MQMA 4TKMA 1JL3A 3T9BA 4CUJA 5BWNA 3ZS9A 2V7VA 4QAJA 4KFCA 2Z6UA 1G5PA 2B2XA 1A8IA 2AHRA 2RHHA 3LDUA 3NYRA 3OTWA 2XLCA 4I1YA 4CM7A 3A06A 4WAUA 4CQMA 2IF2A 2CF5A 1Y4ZA 5BVGA 3I64A 1K1EA 4OUDA 1J07A 1K3UB 3VR3A 2GD6A 2HF8A 2FMTA 2X9VA 4DV2B 1EXVA 5HDBB 3R0IA 4EO9A 4L2IA 4I8XA 2QJWA 3GIWA 4FE3A 3N05A 2ZQZA 2AR0A 4OSPA 1E4YA 2P9YA 3BHMA 3VZBA 1JR3D 2PQ6A 1AJEA 2FUG1 1CY1A 4WFQA 1SQFA 1SCNE 4IUBS 3DOEA 1JZSA 3GRYA 4DJ5X 1BXGB 1WWKA 4G5GA 4IF6A 4UBIA 1XK7A 4E21A 2OL4A 5FBZA 3EGVA 1PCXA 4HAWA 1GTVA 4IAOA 1E2EA 4Y2VA 4JLBA 4YRCA 4C01A 1U0HC 5CR9A 3E8SA 3PJDA 4ARCA 5FEMA 3OLZA 3BD9A 1UZAA 4BUCA 1MO3A 4OXYA 1OU0A 3GBPA 5CK4A 3ICVA 1Q0SA 1JAHA 2QZ4A 1M3SA 2YW9A 3DLBA 4G89A 2EP7A 5DP1A 4IXWA 1A4IA 4X7RA 4FB5A 5KPJA 2YOHA 2XUFA 1GUDA 1H5QA 1E3EA 2DPXA 3OX3A 4OQYA 3LPLA 5SYMA 1N2ZA 1QORA 2I1WA 2ZJOA 3DZDA 5JDCA 4PEVA 1XL1A 2ZSFA 1W52X 4TLCA 3DBLA 3L1UA 2PL5A 1XMOB 1WKBA 5IJ9A 1FNDA 1XXHB 2I6UA 2BMDA 2K2WA 2VQ3A 2B83A 4ISCA 4KH1A 4MW5A 4MI6A 5IX8A 5JNUA 1HGXA 3BSSA 3OESA 1VMEA 4JH0A 1V1RB 3A1SA 3K9WA 3QVVA 5U4XA 3VR5A 1KZ7B 3GEEA 4ENTA 3NB0A 3PHHA 2XF8A 5HCUA 5HE8A 3RAJA 2JFWA 5H82A 2HJSA 1KC3A 5DB4A 3AU8A 1G21A 2FAXA 4G85A 4UDYX 4WWHA 1K86A 2FW7A 1P4SA 3NPAA 5IANA 1KAGA 3GMTA 1QP8A 3N2LA 2UYCA 1YZHA 4G1UC 4RVUA 3B51X 1EFRA 2L17A 1T9AA 4I19A 3WGMA 4F2GA 3SXJA 2A67A 3KEFA 3DLHA 1KFCB 3UMMA 3N59A 4R81A 4J7AA 2R44A 3IBYA 2ZSKA 1RPNA 5HX7A 1N5MA 2FOLA 4U2GA 2GVNA 3OSUA 4FOPA 4L76A 4JYAB 5F4ZA 4XPIB 4AZSA 1BDJA 1GO2A 5F2KA 1JUDA 4X1YB 3HYSA 1B16A 2YRXA 4OH7A 4QVKA 1NBEA 2QSYA 1JXAA 1HBJA 2VJNA 3ENWA 4A0QA 5LIPA 3B2EA 3W05A 4C0HA 3J7AC 2HZBA 1XTQA 3BHJA 3HRHA 1KH1A 1CCWA 1J7KA 1PK8A 2ZDGA 3H16A 4CEIA 1W2WB 2OHJA 4Z6KA 4AULA 5FFNA 1DO8A 1L4LA 4JP5A 4AT1A 4XM2A 4DIDA 4DDUA 1T2AA 4V0RA 1SMKA 1SB9A 1KK2A 1PFKA 3RANA 3ZDAA 121PA 1WJGA 3CF2A 3FOCA 1JS1X 3MOIA 4GGPA 4W7SA 2YCBA 3ROMA 4N9WA 3KZCA 5CB4B 4JEMA 2IW3A 2FRVA 3QXHA 4BNIA 3BGWA 3HDYA 3TAHA 4B1FA 4IHJB 4C5AA 3VR6H 2IE8A 5BQPA 3NVDA 4B5LA 5KU7A 1QHNA 1U0SY 2F1JA 4HGQA 5FOUA 1I7PA 1C3JA 1W34A 3RSGA 1ZJZA 2EDCA 2ZKLA 3ICOA 4QFBA 2ZI3A 2ZBPA 2JIBA 2SNIE 2IIBA 4KXUA 2E4WA 3I6ZA 4X94A 2OKCA 4Q1EA 3OT5A 4F93B 2WBLC 3PLRA 4LRTB 1H0HA 5HRAA 1EQAA 1DTWB 3DMGA 1KSFX 1A4RA 1EM6A 1WMBA 4M7OA 1U9IC 4YX9A 5L4LA 3RSZA 3WKBA 3B48A 3EVCA 4KIGA 4R0VA 1EG2A 1XXLA 3QEMB 1COWD 3RYHA 1GRCA 2VRNA 3IAEA 1RNLA 4PNEA 3OWXA 1XZEA 2IY9A 3P9ZA 5GAJA 4A0RA 2XQIA 5AW0A 1GPBA 1E2UA 3E0XA 4F4CA 5E6RB 3A1UA 1YQGA 4DMRA 3HO1A 4RQUA 5EWJA 2O0LA 5F3RA 3AJ8A 2P9BA 5AHKA 4C0KA 1U0EA 2FEMA 1EK5A 2HPZA 3C45A 2G63A 3HXLA 3KDAA 2HWXA 1XQ1A 2J3JA 1OROA 2I33A 2UAGA 1X3SA 3HGTA 4TS1A 5F7JA 4X85A 3VO2A 1Y9DA 1XE3A 1F2UB 2QM3A 3E7PA 5AVRA 5C53B 1XZ8A 3IT1A 2DMRA 3E48A 3JQBA 1CJMA 3UA4A 1VP3A 5L51A 3Q11A 1MHTA 3AUKA 2W6MA 5ITWA 4EGFA 5E7JA 1E9RA 4JQZA 3O2SB 2W2QA 1ZK1A 3RTDA 3TI7A 1P1JA 2PXXA 3RVPA 3PHBE 4EB6A 4ZT2A 2I2AA 2ZCVA 2XI4A 5TARA 3RSLA 4BBZA 3KTAA 3DMTC 3NU1A 2JFHA 4MR7A 3LW7A 4EEXA 1P2FA 1RRFA 5IC4A 4WK0B 5TPWA 1A2KC 3GGOA 4DV1B 1ODCA 3LPCA 4XJTA 4AY4A 2BBWA 2H31A 1PI3A 3X2FA 3KFXA 4LZOA 2UXBB 3D3QA 3LVRE 4Z0NA 1JLLB 1IDN1 2P9CA 4EK9A 4PF1A 2D00A 3E9RA 1JR2A 2X86A 4IIYA 2HMVA 2QAGC 1AHHA 1IMJA 1CR0A 1X1EA 3B6ZA 4GVLA 1ZM3A 4FFDA 2GNPA 5C80A 4Q39A 1Z2DA 3BXFA 4I55B 3HA7A 2C04A 2CV1A 1RXEA 2XXJA 4LHSA 3QQ5A 4QUEA 3TSCA 4QXMA 2R6JA 3N2EA 1EB9A 2G1AA 1JEAA 1KY4A 5GJBA 1E3IA 3R76A 1PX0A 1HOXA 2C5BA 1Y98A 2R87A 4O1HA 1W75A 3ZNNA 1OGJA 2QTRA 1E2PA 2G5GX 3BTSA 5K3FB 2X7XA 3VHXA 1OAOA 1RKUA 4DL9A 1E1CA 2WJIA 2R9VA 1LPOA 4V0SA 3NBMA 3ENKA 3QNWA 2JCBA 2VQDA 1P73A 3DTNA 1Q1GA 4DMLA 3MGGA 4NU0A 4NU5A 5CXSA 3WDSA 5J23A 1RC8A 4RFVA 2EFHB 4PLYA 4O2AA 1GNVA 3STWA 7REQB 3DV0B 1DS6A 3RQIA 2H4HA 1PL0A 4A0SA 2XUOA 4P53A 2DHCA 4A7PA 1EFPB 2FPOA 1NY5A 1PSWA 1ZVVA 2XODA 3SQLA 4B35A 3A6HA 4JOSA 3RGGA 4OXKA 2C31A 1EVQA 4HJXA 2ZR0A 4NYIR 3FYTA 2GEJA 2BHNA 3CEPB 4PYLA 1Y9AA 3LV8A 3GNSA 5G02A 2AA3A 2AR7A 4QATA 3A1CA 1RQNA 5CHEA 4D1YA 5HK8A 4EEZA 3H5LA 1F4LA 2QGZA 1UBTS 2WUFA 3FPAA 3IUEA 4L50A 3RS5A 4KK3A 3K7EA 1JVNA 4HAYA 4A0HA 5KKNB 4PG6A 1POXA 2NXJA 4PQFA 2ZJBA 4X97A 3OAAA 2VZ0A 4EATA 2PIAA 1ZRHA 2QT0A 2Y9MB 3HSYA 1J8QA 1QANA 1GPH1 5DHAA 2VKTA 5H81A 5BWOA 1JMVA 3CJRA 2GJAA 4J3FA 5LA6F 1FSPA 1Y6QA 5I4KA 3DTVA 3R5HA 1H6DA 3W9SA 4LX8A 3LA8A 3PTAA 5K0JA 4JI1B 4C6TB 1C3OB 2BEUA 3A4YA 2P9QA 4B79A 2WF9A 4N3GA 1YXMA 3Q40A 2QRKA 2ZUBA 3ZDEA 2XSZA 2WAMA 5SY9A 1XVAA 1BE1A 1VMDA 1WPRA 1QLJA 3BDAA 3PQDA 4EJ0A 5L4SA 5JSFA 1UBOS 3WB2A 5E9WA 4LY0A 4NDZA 4WTOA 1EHYA 3L4KA 1BAPA 3E5MA 3SYMA 4LHXA 5LQUA 3HGQA 5EN4A 2RB4A 2PQMA 4HEHA 1M66A 2Q4EA 3IV9A 4IIXA 3X3HA 1IB6A 2RFLA 1MQAA 4L8FA 2MYNA 2HA6A 1UANA 4YQYA 5FPYA 5TB5A 3CUWA 2MR6A 4WBNF 4MPDA 4BYMA 5ADWA 4CMIA 1HYQA 3KVRA 4IFBA 5KHLB 5AK5A 4PHTA 5EJIA 3KAQA 2LPMA 3UT0A 4HNGA 3INYA 1HL7A 4TL6A 4Z1OA 5KNDH 2BZGA 4IKOA 3PFHA 1CETA 2JBHA 1JLMA 2XZPA 4RY2A 5TGZA 2I4NA 3NHPA 4IKEA 3AQ4A 1SVIA 1KS2A 2V3WA 3OA2A 3QNMA 4UDNA 4HWGA 5FJJA 3AXSA 2G77B 2HMSA 2BUCA 4L8LA 5IM4A 1JFVA 4ZVKA 2JFVA 3EZNA 2RHGB 3UNXA 1IPFA 2GA8A 4TMYA 4JLVA 3PIDA 3M7IA 1ZG3A 3DDUA 1ZD2P 4LBZA 1CDOA 4FQ8A 3T3PB 2GB4A 2BP7A 4IH4A 3PYMA 4G8DA 2HC9A 4F97A 3L4JA 1HFJA 3RB8A 4XUGB 2B69A 1JG6A 4GEGA 3A70A 5ALYA 2OV8A 3ZC3A 3M3PA 1CT9A 4Y2XA 1UDRA 1D9ZA 5CHYA 5P21A 3ZWXA 5JADA 1Z74A 1GU0A 1I80A 2PKRA 4NAHA 4DLXA 4U4AA 3TLYA 4XM0A 4EHFA 4A1FA 1QCCA 3KSBC 4KMRA 1XTRA 4ER5A 1LBEA 4NOMA 4RK1A 3E0QA 4G09A 1SEPA 1OFIA 4NBLA 2BMVA 5EJ6A 3CLVA 3HCWA 1WP9A 1UKCA 4J16C 4MRMB 2AV6A 3NM6B 2CXRA 1CP3A 5EHIA 4FEAA 2OYRA 2IUTA 5B1EA 1YD7A 1Z0ZA 2XWQA 4P92A 4DAOA 4K9OA 1P1HA 1A2OA 3RQSA 2DHDA 5KYWA 4ETIA 2RJNA 3A6ZA 1E1DA 2QD3A 3GH1A 3PRHA 4YY3B 2UZ1B 4D8UA 4KXVA 4NBNA 4PFKA 3RTAA 4F45A 4X90A 1Z38A 4M7RA 4FMDB 4EG7A 2JIQA 4WK4B 3VFDA 4UHDA 4KQIA 1X13A 3QKRB 3EGDA 4BZXA 5KOHA 1I2AA 4G1FA 3JARA 3TQFA 5K3SA 5KREA 5H3CA 4CIBA 1ZISA 2O7RA 3P32A 3TXAA 1LBIA 1WDLA 5GP1A 1ONOA 2OBMA 3KUDA 3LHKA 3E7WA 3QPUA 4DJTA 4Z0HO 1Q1AA 1J8MF 2ZLBA 1HE4A 1NVMB 3WNBA 3Q7TA 4YLGA 1C5KA 3PNQA 4J0QA 1LS6A 4M2LA 4YA6A 4ZXPA 1NOJA 4HQKA 3RRMA 1CUEA 4UPEA 1FIUA 1I2CA 4LHZA 1PG0A 3RRXA 2VJMA 3UFBA 5A3RA 3RAPR 4BWYA 2OO5C 4DLWA 4H0CA 3QLVC 5EFZA 1P3Y1 4DR2B 2FUKA 2V6GA 1XLVA 2HT6A 4GQAA 5CM2Z 3ZD8A 4ZU3A 4E5SA 4EUSA 1EZZA 4JJFA 3IIEA 3I53A 4EG5A 3PNKA 1SUPA 1HE2A 4H6XA 2V98A 1QB8A 5CURA 2XKJE 3F4BA 2IWRA 3WRXC 4TTVA 2BCJQ 1OV6A 2TMKA 5EP4A 1O7JA 4BO7A 1HNWB 2ATIA 2NU7B 3PC8A 1R8YA 3AJRA 4CEJB 1N5IA 1Q3HA 2J3EA 1NN3A 3SU8A 1UK6A 4CYMA 5BR4A 1VCNA 5CP8A 2CJPA 2NVWA 4EF4A 2FDXA 2LIVA 2VDJA 4LQLA 3W79A 3OC0A 3SN6A 1FS4A 5CAEA 3JYLA 4HMQA 2FSVA 4NS4A 3UGQA 4DIFA 3ZDZB 3Q7IA 2AK2A 2FMIA 3DQQA 1ONPA 1XMSA 2BMJA 3FUVA 5EMMA 3VDQA 4G0UA 3EXHC 5IAKA 2DX7A 1DBVO 4G0NA 4PAGA 3KJZA 4XGIA 2CXHA 2GF2A 2B1QA 2YL2A 2DT5A 1E92A 3KSMA 2IYTA 2PX0A 3GAFA 4L16A 1NTRA 5DHSA 4CCYB 2Z2XA 3AOGA 4L4UA 4MKGA 3INRA 5AVKA 4ZT5A 1NR5A 3N7TA 4I0WB 4HPXB 3OJOA 1A04A 4H15A 2BI4A 2GERA 3DFZA 5K01A 3HEAA 4G1MB 2ZM5A 1HRDA 4Q1FA 2G7ZA 2QAGA 3HACA 2FUG6 5F51A 3UUWA 1YS9A 3QEOA 2D1SA 3D3WB 2B2NA 3K73O 1H2ZA 3DEFA 3ZQ6A 4K88A 4DG9A 3ZNOA 3QTLA 1IHUA 3VXKA 2FW9A 2PL3A 2E9SA 3FCOA 3Q12A 4WBSA 1ECBA 1XU9A 3HTXA 3MBIA 3BWMA 4Q7MB 2FPGA 4G84A 4TVOA 2CL0X 2PQ0A 3C8UA 2F8MA 3AY6A 3ZE6A 5KC8A 1XF1A 4DTCA 2B8JA 2V5UA 1E2BA 3M1AA 1UH5A 2GMWA 3MWEA 4JCCA 4M86A 1MAWA 4XDYA 1ORRA 4V3BA 1H65A 2QVXX 3DJYA 1QZTA 4BKQA 1U9YA 3FDIA 3M6WA 5DM2A 4ON9A 4WY2A 2HAEA 2MINB 1IXYA 5GMOA 1UPTA 2CFSA 4XVUA 3MFYA 4XARA 4FOOA 2XVXA 2XKKA 1CP2A 1TJPB 4LOIA 2R60A 3V4SA 2J5BA 2YWBA 4QYSA 3V42A 4YV1A 2EEPA 1U5BB 1D5CA 4ZZ2A 4U2CA 3PXAA 1K0UA 2QGQA 5FR2A 4HQ0A 2W6ID 3FZNA 4Q1CA 2JGAA 1G7SA 4RCYA 3T95A 4NBWA 4PM4A 5CIWA 1OW3B 4OB6A 4CDRA 2JLZA 4WRRA 4LYYA 5F1KA 3G2LA 3DCIA 5BPFA 3R6GA 2NUAB 3DLCA 3KJXA 5AI8A 2J7PD 4ZQEA 1AX9A 4MOWA 3RKUA 4EJ2A 2H8KA 4IO0A 4LKRA 4OJQA 2A84A 4RWZA 4EFNA 5L3VA 4WKNA 3RO7A 1UC9A 3Q72A 4Z7QB 2YXDA 1QOQB 1NLFA 1J2YA 1G5HA 1OXMA 3ADKA 5CFRA 2BELA 2HDWA 1KPHA 2O3SA 3LZ6A 1XRMA 4MVYA 4QBKA 3RR2A 1EFDN 2RK3A 4CTNA 3BSFA 5EZQA 1GNRA 3R7FA 1BJTA 3ITKA 4TMWA 3K5HA 4XB1A 4TLLB 2BF4A 5B1SA 2DXIA 3DAYA 3IPRA 4DLTA 4RTNA 1RQLA 3VDMA 3GPCA 4EW3A 2BHSA 3CVJA 3LDAA 1X92A 4Y0NA 5IJAA 5K5EA 2CF6A 2QNRA 4HY3A 1SIWA 3C7AA 5JXWA 1VRWA 2FG5A 5KYTA 1LI4A 2YNMC 5JG7A 1YI0A 1XFDA 1KF0A 2C84A 1QYDA 3VKFA 1TYEB 4PX3A 1HO3A 1KBZA 1SC3A 1Y3HA 3Q1KA 2Z8YA 4YP6A 2X1VA 3GZNA 3KLMX 4A73A 2ZRJA 4Y2YA 1QK3A 5JNSA 2CLIB 2O52A 1QP7A 4BBPA 5DGHA 2IOYA 4Z5XA 2GETA 2V96A 1SELA 1E7QA 2WYVA 3H1BA 3CW2A 3O74A 2QENA 2XRYA 3GJXC 2YWEA 1L5RA 2XMBA 4YAUA 1ACJA 1C81A 3AFIA 1M2GA 2I5PO 2KWIA 4S2EA 3ZJ4A 4BEVA 5LMCA 3H2GA 1G6OA 2E4YA 3EZFA 2B35A 4WDQA 2JLAA 2ZEJA 3CV3A 3A0UA 1WW3A 3VC7A 5JAHA 4AP6A 3Q6NA 3REOA 4HWRA 3WJAA 3MT0A 2GD1O 5BUQA 2I80A 2XMSA 4YNBA 5JXJA 3S70A 2VCEA 4DMFA 3AUSA 1BXRA 5AI5A 1PW7A 4RKFA 1SC4A 4KOAA 1E2DA 4HADA 4XGKA 3REQB 1RYMA 5CBPB 5IUNC 3A2NA 3K0BA 1JT2A 2FEWB 4J0KA 2VF5X 5DOZA 4MRRA 2YZKA 1YSCA 3IJPA 1PS9A 3LVBA 1KU6A 4GMXA 4OA5A 1IONA 1DWOA 3EUAA 3OEHA 2X77A 1JHVA 1AURA 2FFHA 2R66A 4ZPXA 5ABPA 4R2IA 1FMCA 4Y6OA 3WLHA 3SP1A 4WSOA 5E1BA 2XY4A 2DR2A 3FTDA 5GVRA 3GGDA 1S02A 1IRIA 4UCFA 4CL3A 1G3RA 2ZREA 3OP1A 4UPDA 5F7ZA 4B33A 1QMPA 1K2WA 3P2MA 3CEMA 3KJQA 4OK3A 4BLUA 3KWJA 3A9CA 1P1KA 1ZNQO 1XRNA 1SIUA 2FFRA 2RGYA 3AI3A 3PUJA 4PICA 3MT9A 5LOVF 3VI3B 2JAUA 1V8PA 4KLCA 1JN0A 1NX6A 1UMBB 2HK7A 2P4UA 1M2FA 5IH7A 1K6IA 1U9IA 2VUHB 2A9VA 1DLIA 3H1GA 2HA0A 1VLVA 1Y5RA 2HQOA 4OGKA 2GZ3A 4XASA 5IBPA 2AD1A 3EHDA 1H2FA 2HCJB 3B12A 3KK0A 1HFEL 1RKVA 2G07A 5H4GA 5DGXA 4MLCA 2ZWAA 2G3YA 2QQGA 3FCAA 4UXHA 4N7MA 1NPYA 3WGJA 4DLUA 4DY6A 3HGMA 4CU5A 1F48A 2J0UB 2XVAA 4H7IA 3K3PA 1KP2A 1YDHA 2GCGA 2X5NA 2C1XA 3E3AA 3GL9A 4BKUA 2ZYDA 3OTIA 3A6DA 4YREA 1G8FA 1CUJA 1QHIA 3JVUA 4DB4A 2WILA 2F1RA 4GLBA 3VBEA 3TAXA 4EARA 5CIQA 1ZM9A 4OF4A 2C5LA 4DSZA 2NUPA 5ERGB 4D57A 1SBZA 2HKIA 3OU7A 1J1ZA 1P91A 2ZB4A 2X8AA 4OQEA 4TKZA 2VHJA 4KNVA 2HZ7A 4J0CA 4X0EA 1S2GA 1RYFA 5LXTF 1EAYA 1PIWA 3OFSA 4IGAA 2NZXA 5DM0A 3A2LA 3GARA 5EJFA 3LUBA 1Z6YA 4BB0A 1ST2A 2EARA 13PKA 5CA1F 1OY1A 2RKWA 5CH3A 4I5IA 2OBFA 5LQNA 4MB0A 4OLAA 4D9IA 1LLDA 7MHTA 4P08A 2J3KA 4E5VA 3NTUA 5IZCC 2ZRKA 4IJKA 4UU7A 1MPTA 4P84A 2VT2A 1ZDMA 3PD1A 5EG5A 4BVGA 4ZDIA 1NN1A 4JL5A 4LMPA 1UDXA 2C07A 1OVMA 1HDZA 3MIIA 4KE7A 1L5NA 2CC2A 3E22A 1ZGCA 2C1EA 3USZA 4B6JA 4BNNA 2EFEB 2G0AA 2QGNA 3AKDA 2GJ4A 3ZV3A 3CF4G 1GTG1 3M5CA 4A10A 4AYTA 3C3MA 1TB4A 2BGWA 2QBYB 2ZTSA 3DW3X 3IT2A 1WCIB 4KPUA 4B3SB 2C4NA 2DQYA 3MWDA 4W9RA 4QTYA 4BNMA 1LW7A 1MVLA 1ZGAA 4UFOA 1P4HA 4WOKA 2PS3A 3HRKA 4YAJA 1YAJA 1H5NA 2ZB8A 5DBOA 2BM9A 5CYPA 4V0NA 3D8BA 1DKRA 1DC6A 4E5MA 4OYYA 2A9RA 3D4BA 2KW5A 1BG6A 1F8UA 2C5HA 1XO1A 2XAAA 2VHWA 1WMSA 3W5SA 1IMOA 3PDWA 1QYRA 1T26A 1QV6A 1NXVA 3QUQA 4R8SA 1VL0A 4ES6A 1TEHA 1YZQA 4YGYA 4KU4A 2QYHA 1O6BA 2ERCA 3K09C 2HK6A 1AZSC 1Z0JA 5INTA 1RAHA 3MIZA 5JLJA 3QLEA 2POQX 3UN1A 3H9EO 2W6NA 2VQSA 2JLWA 1BWPA 1J8FA 1N0VC 1T0JB 2J9XB 1JT9A 2UYYA 1HETA 3CUSA 4MKZA 1D4AA 4PGMA 2PX4A 4DNQA 4I8IA 1SRRA 4WESA 2R6DA 3ASYA 1ZNWA 4PANA 3QPCA 1ECPA 4QTTB 4Z9FA 4UBMA 1S9DA 4QUAA 2XT0A 1X7GA 3IDZA 1SURA 2EFCB 1XTUA 2I7CA 4ZEXA 3BA1A 3EN0A 2BAGA 1XTPA 1YRWA 5IG2A 5JZVA 4D4GA 4NE7A 5E6UB 5EHXA 3QKUA 1PL6A 4G5XA 4UTPA 1BD3A 4GVPA 4MA4A 2DOKA 3ASUA 1UKEA 2FP4A 2ZDHA 3KOOA 1KZ9A 2GN0A 3OZGA 4JP8A 1CF9A 1EXNA 2NVOA 5JT1A 5G41A 3TSAA 2II6A 1IHYA 4C0XA 3MJHA 5ICCA 5IP5A 4TMZA 4HV4A 3QPDA 1AUOA 1RJ9A 3AUAA 4FOLA 1VI2A 1YR2A 4NX2A 5LOVB 3WR5A 3BQ9A 4KXQA 3A6PC 4G41A 4JI4B 1M0EA 4L9AA 3IAXA 1WV1A 4C4YA 4U7GA 3RYIB 3SSMA 2GARA 2GSWA 3W9BA 4HUJA 5FF9A 5MGBA 3WLJA 2OZEA 2QTVB 2XNHA 1WSDA 2C7RA 4N0PA 3HZRA 4RA6B 1WETA 3UWPA 5HOQA 2A59A 3M4JA 3WOHA 3BMCB 1LJUA 1TJ4A 4IRMA 5I3ZA 4D0RA 3OOYA 4LDAA 3VA7A 2FH5B 3COYA 4IINA 1ZOOA 1NM5C 2WEKA 4HJRA 2C92A 1VHLA 4M83A 3NDRA 1F8FA 2EL9A 2RI1A 1Q1NA 4LI3X 1TCAA 2GBIA 2GR9A 3B78A 4DHWA 1SOAA 3K96A 3KKNA 4K9MA 3KDSE 3B8HA 1E2GA 1C3EA 5FNVA 4AZVA 1GU7A 5SZKB 4KPEC 1YV9A 3RS7A 1QUFA 2HHCA 2OMEA 4Q9NA 4JR0A 5HCIA 2Q9AA 4CFYA 8ATCA 1H4VB 4NCJA 3Q7RA 4M0KA 3TGLA 2QXUA 4IY1A 3PHGA 4P2BA 3HLTA 2WUVA 1QKJA 2DUMA 4G9BA 3ZW8A 4JDPA 4EYQA 4XQEA 1A9TA 4Y2RA 4RD1A 3W9UA 1YKGA 2HN9A 4Q4LA 5BW8A 1MW9X 1Q2XA 1ZUNB 5CG1A 3KJEA 1XWFA 3I34X 1BXKA 1VBFA 4HYYA 5HIKA 1RI5A 3ZE8A 1F0NA 3V8EA 4NQRA 2ZYTX 3FDZA 4C5BA 1QH8A 1KYVA 1OB2A 1ZQ1A 5BYKA 2PRYA 4FW9A 1AB6A 4KAAA 4Y9TA 4F12A 3FCCA 3W2GA 5JNRA 2WIDA 3AB3A 1TZBA 3F46A 3DHVA 5TJ9A 4XLTA 3SX4A 2J9YB 1S0UA 1ZBQA 3GMSA 2AI1A 2GJ8A 1I3LA 4BNJA 1MXFA 3FHOA 2KYRA 4F72A 2HRZA 1E2MA 5GONB 2OOSA 1JTEA 5JMPA 3ZOKA 3H9JA 1CY7A 5CT6A 5ER6A 3UM9A 3KZKA 3MGAA 4AS3A 2RE8A 1GTMA 2BCEA 2XUIA 3OPXA 2B37A 4QBIA 3TKYA 4CTOA 5M04A 3EFEA 5B7QA 1IK6A 5JYBA 2F8SA 3NI2A 2VR1A 2H1CA 1J9EA 1P9LA 2WICA 4NDNE 6PFKA 4K6KA 3FNEA 1NXTA 4G0ZA 4EPVA 3PGXA 4OLHA 4YJGB 5DN9A 1AF7A 3JQCA 1DARA 4MVJD 3ZHCA 4AMUA 4LQ4A 1TU4A 4QJ4A 5AM1A 2A9FA 4OI2A 3X1YA 1K6EA 1FZQA 2M98A 4O4HF 3ZV4A 5AM2A 1WUYA 3FHLA 4BZZA 3KSRA 5JPDA 1ODIA 3U3ZA 5BMVB 5D3MB 5LQDA 1X1SA 2B94A 4Y2UA 1YR6A 3IT0A 2ZI7A 1CZLA 1NQTA 2QW0X 3GA7A 4I5EA 4YROA 1NF9A 1INLA 1FLDA 1OLXA 1CY2A 1QG2A 1WF6A 2BMWA 4ND6A 3S5JA 1T4CA 2ICAA 1ZR4A 2DQZA 3SQWA 1G2OA 2ZUVA 4MRSA 3G68A 4GRDA 3UPDA 2W4IA 4IDQA 2DF8A 3IOMA 1F0KA 1QIEA 4PX5A 4TLMB 3EE6A 1V43A 2JJ8A 4HDMA 5DNAA 2D1QA 4DKJA 1C1DA 2A57A 3F3MA 1AGPA 3KL4A 4R5MA 3SR3A 1ZNZA 4KR9A 4ATNA 4BFZA 5KO2A 4J4TA 5KX5A 2HT1A 1B42A 1H22A 3QYAA 3T9AA 2L42A 4B48A 1IXKA 1PDOA 4EB3A 4MS4B 2B99A 2FG6C 2OCXA 3U5TA 1RLUA 2ZTMA 4FGLA 3VNBA 3COSA 2A4KA 3UG6A 4BYGA 2FHPA 4XLZA 3DHYA 3HM9A 1M6WA 3DQZA 5FWXB 3DKKA 2D5AA 5BSEA 1DDOA 1LI7A 3N2NA 1JLRA 2V4UA 2JDIA 3MK31 1IBCA 4RNCA 4UNIA 4UOQA 1WXHA 4GZ5A 1X74A 4TV8A 4DCTA 4W9NC 3HXKA 2HW8A 3G7NA 3OLQA 1XTTA 4LPSA 1O95C 2A2ZA 2ZE5A 4QPCA 4CCWA 1U2DA 2XQVA 4Q6BA 3VR2D 1VG1A 3C3WA 4MO9A 1UEIA 1FNBA 4FXPA 3AC0A 2OK7A 3EC1A 3G6KA 1GSHA 2QPLA 3F1KA 1MRNA 3KVYA 4RH0A 4AECA 5DBEX 3DBVO 1KDVA 3T38A 4BFCA 4EHJA 2IZ5A 5H02A 3VQTA 4ZQIA 2IT1A 1C0IA 4TX1A 3AF5A 1YMUA 4V0LA 1D7AA 1SBHA 3NO4A 3ZHRA 1X7YB 1Q77A 4B46A 4IIVA 3VKWA 3FWPA 2R3SA 4W9MC 2P2LA 1VLLA 3DUFA 4EJFA 1US8A 2HU2A 3IODA 4U7FA 3KKPA 4JI6B 4B2IA 1GTSA 2VRWA 1DRJA 2IQ5A 2WG2A 2MYTA 3AEQA 3QIAA 3LT2A 3DYBA 3FSGA 3GRRA 4HXEB 3W5UA 4CQMD 1YBHA 3RU3A 4BE9A 5HGXA 2VPZA 1U8XX 2AEMA 2WWIA 3TIGA 2ZRFA 2VJOA 3CCBA 4UQOA 1KH2A 4EEKA 2C2GA 2W2KA 5HMLA 4BE4A 1FBTA 3IB6A 2UUCB 3SC3A 5DWQA 1K08A 3G2HA 3PEFA 1XQVA 2V65A 3N0RA 4GNKA 4IQ8A 4YACA 1YIOA 1Z82A 1GCGA 1ORIA 1U1FA 1TOAA 3NTXA 5HKAA 1WKCA 4O4JF 3VJRA 1XDZA 1U7HA 2BFBA 2GLUA 4JX9A 3JS5A 4JSTA 1M54A 3W7VA 1RYYA 2YWXA 4HQFA 1QDLB 2UVPA 5D87A 1KY3A 5ALJA 4J0EA 5B1IA 1DWQA 2FWAA 1VE9A 3D0QA 2HM7A 4B6RA 2BCGY 3DBOB 2A5GA 3LL7A 4RK0A 5B1HA 1H1LB 2F43A 3DC7A 4QC2A 3IJRA 4BQQA 4D8YA 3Q8MA 4YAGA 3QXCA 3I62A 3IQIX 4KN6A 4M6WA 2ZTVA 3R5SA 1XKLA 3AR6A 4O1IA 4H7HA 4WXEA 3AZOA 3ZW7A 3CANA 2JIZA 2Z5LA 3FBTA 3OZSA 4QARA 5JAMA 5CM9C 1Q14A 4RBNA 1XB2A 2R8ZA 3HVJA 5TVGA 1TFUA 4ERNA 1U5AA 4YT4A 1SB8A 6GPBA 5ICSA 5BSFA 1WLSA 3ZLBA 4FJ0A 1WUKS 3T9EA 3X0DA 4G0MA 5JRZA 5KNDA 1NMQA 2AEJA 2HHLA 4E15A 5H68A 3UJAA 3DS8A 5IAJA 2NZVG 2RAPA 3RS3A 4ALLA 3O8BA 3SVLA 1N9KA 1U3CA 1GEEA 1YQWA 2P9HA 4ZPJA 1GQFA 1E6LA 3MQFA 2JA1A 4GR5A 3RDPA 3WHLA 3HXMA 5BQ3A 1MOZA 4EB8A 3CWQA 2ZVDA 3TW6A 5BY2A 3MJEA 1K89A 3LRTA 3HEMA 3AFHA 4JUIA 5I8PA 3EXFB 3OCJA 2FMFA 4LJ8A 1MP0A 1BCSA 2FVXA 4OYRA 5JAQA 1HORA 1QCDA 3F7OA 4UVIA 1Z6PA 3FBGA 3AWIA 1V1MA 4R40A 1ADCA 4B6EA 4D3SA 4EF5A 5CB4A 4QTXA 3JPYA 8AT1A 3EPKA 3H8WA 2BKXA 4YT2A 4E70A 1H1TA 1PJCA 4K6FA 4U8HA 4DV0B 2N1BA 2OUIA 5HIAA 4Z4FA 2ZJ0A 1Y1TA 5DIZA 4WI1A 4LXXA 3WP1B 4F5WA 1OXXK 2Y1KA 1RPAA 3BRQA 4HAXA 2F1HA 3C3DA 1MAVA 1PDVA 3IVAA 4U6NA 2X14A 3AR3A 5LB4A 3ZWQA 4BLSA 1T5OA 2P3QA 1VC2A 2Q4RA 4O2AF 1CUHA 5KKAA 2PZ8A 3CNHA 2UUPA 3BB4A 3UZUA 3OTOB 4GWLA 1FXUA 4A8HA 3CKKA 3LVFO 5KJEA 3GVIA 5EP2A 2VDVE 1D1SA 1SJ9A 2B4AA 2C5AA 3EXAA 3AI7A 2H2WA 1P39A 2MSEB 3CKYA 4CKWB 4TS4A 4E0BA 3N87A 4F6LA 3PRJA 1QNLA 2ZYHA 4BO9A 5AFSA 2ZWIA 1YNSA 2C59A 2OSVA 4DFDA 4BLTA 2EEZA 4G81A 1TPYA 3AVUA 1BJRE 5TT1A 3HR4A 5E7IA 5GY7A 4PLWA 3A28A 2OG2A 1RWWA 3ZQJA 2K5UA 4UJ3A 2EQBA 1CS4C 5ALZA 1JEOA 1MG5A 4Y1RA 4BFTA 4H6PA 1IPEA 1CUFA 3PDJA 5KVCA 2G80A 3LY8A 4FLMA 5LIRA 4KYTA 4QGHA 3EDOA 1WU7A 3H97A 1DG3A 4M7PA 5I9MA 5TV2A 5JU6A 4I3FA 4C7OA 2PHZA 4OXNA 3HYRA 2DTXA 3JX9A 1G2PA 4V1CI 2UUOA 4NOLA 1E99A 4INAA 3PXEA 5H83A 2Q46A 2AJCA 3FNBA 2VOEA 3BPSA 3HKEB 1Z7EA 3L1JA 3FE2A 3NETA 4L95C 3T7JA 3D7LA 4XSVA 3S28A 3TD9A 4Z4GA 1GNLA 1NNUA 1ZBDA 3KTFA 2AQIA 3KZNA 4BKPA 1G19A 2FPRA 2PCLA 5LYJA 4HTFA 2ZJ8A 3SNHA 3DDCA 1J90A 3U7IA 2ERYA 5IBQA 4ZDJA 4ZZIA 4EY7A 3I8SA 3NKLA 4AQDA 3AUYA 4DBZA 2J87A 4YYZA 4FK8A 2VL7A 3ZKWB 3JSXA 5E6RA 5KSYA 1EIWA 2O3RA 1QONA 4UU0A 1Y6ZA 3N6XA 5JXIA 2ZOSA 5C7YA 1WX1A 3HBFA 4GYJA 3EPRA 1CS0A 4HEA6 2QQEA 3DBRB 3STHA 1YK1A 1RWOA 3ZHZA 1VI6A 1GRQA 2ZCUA 1N34B 4NABA 4MQFB 2QYSA 1K8XB 2P90A 2V6IA 4YJ3B 3WBJA 5JD6A 1U99A 2G9RA 1LQTA 3QRWA 3EB9A 3K0CA 3RD5A 3C3EA 2WU3A 4R9SA 3GT7A 4FYKA 3RRJA 4KSYA 5J5CA 5GPBA 4DRZA 2AG1A 2XA2A 1G1AA 5IT5A 3Q15C 3C97A 3EWAA 2NU8A 5JW6A 4PRYA 3HRIA 4HWTA 4MA5A 3KELA 1CQZA 1TUIA 3DYVA 3OZUA 4V39A 3TQTA 5AMXA 3IULA 1OJ7A 3ZXSA 1XNJA 3TIXB 4B6GA 4NI5A 4B84A 2W22A 1Z5VA 1X1BA 421PA 1MFPA 1ST3A 3N3AC 1T8WA 1Q15A 2VHTA 4I8DA 4XSGA 4JLMA 4LFCB 2JAQA 2IZ7A 4LSZA 3T3GA 3FFXA 2CB9A 4MI3A 3T3IA 3G2JA 3KVVA 3O26A 3WLIA 4CQLB 2VDMB 4BX3A 4FDVA 4DQKA 1ANKA 2J1LA 1IEXA 1L4FA 3D7RA 4GUDA 4PZ0A 4TXLA 4EL5A 1G9SA 1SXGA 2YY7A 3WLLA 4CI9A 1BX0A 4I55A 3U61B 2YV1A 5KTRA 3T3DA 2H16A 4NK4A 4YRBA 3A9TA 1QVWA 3WGNA 1N6NA 1ZSVA 4YO8A 2OHHA 2G6TA 3DXZA 1NNI1 2COUA 2FZVA 2I1QA 1DJNA 1PFYA 3OEHD 4HRYA 4LOJA 3W3ZB 5DM70 1NHWA 1ZEJA 3VU1A 3I4CA 2ZQ5A 4XJVA 3UO8B 5MHTA 1JDJA 1JAXA 4GECA 2FY8A 1Y4AE 1OUMA 5A7HA 1FRVA 2HJGA 4LHVA 2YC2C 4OIFA 4W9NA 2YYAA 3IERA 3NOOA 1HTWA 4O6VA 1XVVA 1JAYA 2Q3DA 3QTTA 1PGPA 1NF8A 1WS6A 4MV9A 4GO1A 1NNLA 5K8LA 2G40A 1VYTA 1JHXA 4IDHA 4CMJA 5JJCA 4ZI7B 4F4HA 1Y5MA 3R3XA 5HR5A 2JEYA 3IKJA 3C7CB 3L77A 1C3LA 1L8QA 4LCJA 1NPTO 4RHEA 4TGLA 1CUDA 4RM2A 2E4XA 3EAFA 4BQSA 1SZPA 4K05A 2WTAA 3SI7A 1YWGO 2IYNA 5A4JA 1A9OA 2GD2A 3KE8A 4AY6A 2NZWA 1JYSA 2FX5A 5JOQA 3NBYC 3QX9A 1NI5A 1GKLA 1UT8A 2Y99A 5TMDA 5HJ5A 1H0RA 1C4WA 1GZVA 4RJKA 1L3BA 3CO5A 1QH1B 3WL5A 4DLAA 2WUDA 3VYVA 3LHFA 1QYCA 3PX2A 2HK9A 1BWRA 3RV3A 4F8JA 5CB6A 1SIOA 4F9FA 4P0QB 3QW2A 1TM2A 4NMWA 1X14A 3UXMA 1N7IA 2YUTA 5CXXA 3WWOA 3EVAA 1O4VA 3KQWA 3C16C 1DQZA 3D3NA 4JLKA 3ZWBA 5KJ6A 2HEIA 4EY5A 2O0KA 3UC9A 3VPBA 2ALJA 3WL4A 2CMFA 4BGUA 3WYFA 1IQ0A 1Z0FA 1KOGA 3VPXA 3SDSA 1FVOA 5BYBA 3TLAA 4B7CA 2RHWA 5FNVF 3TXXA 1K5HA 1JIIA 1Z2EA 4EI2A 1RRPA 2I66A 2OAGA 3GG9A 1W85A 2OCAA 1E4VA 1WBJB 2D0DA 3Q9LA 3GELA 2FJPA 1JWAB 1NFRA 1W59A 2EQAA 2IUEA 3PR1A 3QVXA 3U26A 2JNWA 4BX9A 8GPBA 1MCZA 1WSAA 3L8YA 5THXA 2R6HA 4BIMA 2CFIA 4II7A 3E2IA 1XPRA 1NU8A 2C5FA 3QXXA 2PWPA 3TNYA 4CLEA 2EZ4A 4UOEA 3IS3A 3IVRA 2JL1A 3E61A 1VKNA 1QAMA 2Q2OA 5ITVA 4D9BA 4OLJA 3PEYA 3DZCA 5J47A 1MV8A 1TO1E 3FMPB 5EGNA 4PN7A 4K1LA 5A0VA 4C29A 1CEYA 1UOOA 1V5EA 2FSUA 3CX7A 5JS1A 3E1SA 3DUFB 1XZDA 3GN2A 2C7BA 1KMMA 2CHFA 2OCBA 3A9WA 1UMCB 1W1IA 4EM6A 5I9LA 2JIOA 2OBYA 2HIAA 1HNZB 3GJZA 1TMOA 2H48A 4OP2A 4E5PA 1UXOA 2VNHA 4PNZA 2BBTA 3DZKA 1NI3A 2J5QA 2GHIA 3JQAD 4CMCA 3RUAA 1GRVA 1P44A 2LDXA 2C98A 4BNFA 3SSNA 1UJBA 3L6UA 1QBKC 2RBGA 1Y9JA 4KVZA 4QDOA 4INPA 2FWMX 1W5AA 5FI0B 3WBFA 1P5FA 1UPFA 5FKJA 3BB1A 4QUBA 4BNXA 2V6MA 1OWMA 1JSXA 1XA3A 2ZSHA 2QV0A 3LD9A 2CL5A 3B9BA 4LYAA 3TDNA 2Q8NA 4GRIA 2A1TR 3R0VA 2F9FA 4L9RA 3K1AA 3OZWA 1K06A 2DU8A 3PXGA 4XUCA 1M2KA 3N7AA 1MLDA 3L0SA 1O58A 3NWEA 5D7BA 5IARA 1QGAA 4R54A 1UT5A