4RH0A

Spore photoproduct lyase c140a/s76c mutant with bound adomet
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
340
structure length
340
Chain Sequence
KPFVPKLVYFEPEALSYPLGKELYEKFTQMGIKIRETTSHNQVRGIPGETELARYRNAKSTLVVGVRRTLKFDSCKPSAEYAIPLATGCMGHCHYCYLQTTLGSKPYIRVYVNLDDIFAQAQKYINERAPEITRFEAAATSDIVGIDHLTHSLKKAIEFIGATDYGRLRFVTKYEHVDHLLDARHNGKTRFRFSINSRYVINHFEPGTSSFDGRLAAARKVAGAGYKLGFVVAPIYRHEGWERGYFELFQELARQLEGMDLSDLTFELIQHRFTKPAKRVIEQRYPKTRLDLDETKRKYKWGRYGIGKYVYRDEEAKELEDTMRRYIEQFFPGAYVQYFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spore photoproduct lyase
publication title Rescuing DNA repair activity by rewiring the H-atom transfer pathway in the radical SAM enzyme, spore photoproduct lyase.
pubmed doi rcsb
source organism Geobacillus thermodenitrificans ng80-2
molecule tags Lyase
total genus 128
structure length 340
sequence length 340
ec nomenclature ec 4.1.99.14: Spore photoproduct lyase.
pdb deposition date 2014-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rh0A01
3.80.30.30 Alpha Beta Alpha-Beta Horseshoe pyruvate-formate lyase- activating enzyme pyruvate-formate lyase- activating enzyme 4rh0A02
4FHFA 4FHCA 4FHDA 4K9RA 4RH0A 4FHEA 4FHGA 4RH1A
chains in the Genus database with same CATH superfamily
4CCAA 1N34B 3LGAA 1I8TA 3C3EA 3B5EA 3IVGA 3FB1A 4CFSA 2AOWA 3D8HA 1JIVA 4RVGA 3FDXA 1QANA 4B75A 4PNEA 4C43A 5JS7A 5KOJB 2JI8A 4KK4A 2ZYSA 4G0MA 5CTJA 4ES6A 3QG1A 5FYDA 2XQGA 4Y2GA 2J9FB 1CZLA 3AOGA 2HSZA 4MW0A 4R3NA 2DE0X 3K9CA 4R9SA 4AJLA 2OY0A 2V0NA 1Y63A 4WESB 3ABIA 1TVKA 3VR3A 2RGUA 2ZDQA 3GK3A 3KJQA 1CR1A 4P83A 5AW1A 3ONFA 3OURA 4IJMA 4D4IA 3BG5A 4EARA 1TA9A 5JMTA 1TF5A 4YAFA 3VDQA 3BL5A 4FM9A 4CMEA 4R9NA 2ZUDA 4L07A 2HPHA 2GN2A 3HA2A 3JASA 3TRDA 3KEQA 4MS1A 1R0ZA 2JIBA 1SURA 3MF4A 2QQ5A 4C5AA 3OZRA 1HUQA 4MIYA 3TLGA 2REXB 1GFIA 1TZCA 2GERA 2ZCVA 4UVEA 2CDRA 4L15A 4RJIA 3WQSB 2HPVA 3AC0A 2HREA 5KSZA 1AQJA 2CVOA 3H42B 4TS1A 2OO7A 5KTRA 2IBSA 2ILTA 1N57A 1XZHA 5K0FA 2H1OA 1HYGA 3EVBA 1G2IA 3F9RA 4CT4B 2LIPA 3SHVA 3LXRA 3IL2A 2IXAA 1JKIA 3VNVA 1YMVA 1G9TA 2J3IA 4OHRA 4DV1B 3RC1A 4HQFA 1ZN2A 3COSA 1ZZEA 3N5CA 1FUYB 1RRCA 2PPLA 2OPBA 2Y2VA 3EQ6A 4H4EA 1QSGA 5IANA 3LCVB 4M1OA 4ARAA 2VUUA 3WSVA 4KW7A 4RWZA 4B17A 3ZI7A 3D8SA 5REQB 1IZZA 2FK8A 4WEQA 1XMIA 5ARCA 2X8BA 4OD0A 4RH3A 1V96A 2FP4B 4CLOA 4A73A 1L7NA 3SQWA 1ENPA 2XF8A 1SUAA 3EF3A 2OR3A 3F98A 5J2UA 4RJKA 4RKQA 1II8A 3L0BA 5CIYA 2IFTA 3KWMA 4A8PA 4HSGA 3UKDA 2BV3A 1W5EA 2QSJA 4QPZA 4D3YA 4NX2A 4N5LA 4Y6SA 3RW9A 2QMHA 3DBRA 2XLCA 3EXHC 3EFEA 4DGQA 3ZHTA 3K9NA 1ZHOA 4DCJA 4TX1A 5T41A 1N2SA 2QY6A 1L1FA 3C6MA 4K2HA 2V3CC 4RULA 2XNKA 5DNYB 3K0BA 4HVTA 2Z6AA 2GCOB 2LBPA 3QXSA 2G08A 5DWDA 3ZLTA 2QAGA 4CMKA 4E3WA 5LMCA 2XJ4A 2VLIA 3RTEA 1O0CA 4V0QA 3MCVA 3CVJA 4O6VA 4XVUA 3BGWA 3E23A 1F2VA 4OHFA 2QOEA 2GXUA 3B5JA 5AJTA 1SBHA 4QFCA 1CRLA 4ZARA 4BO2A 2Y27A 4EO7A 4XDGA 3ZZTA 3EA0A 2OZEA 2J5BA 5JAHA 4NRDA 5KOYA 3MIIA 3DULA 2EU8A 3EC7A 2JGDA 4QO8A 4LOIA 5D5QA 3FWYA 1XA4A 3Q7TA 1VL1A 2EZUA 3GEGA 3GH1A 4Q1EA 3CSUA 4PRYA 1IE3A 4LEIA 1HDIA 3C3KA 4NESA 3GB9A 4UPEA 2GR9A 3RYIA 4NOKA 5J4LA 3V1LA 1N5JA 3KELA 1JFLA 3TG8A 4R4JA 2O54A 1XB2A 3NAMA 2EDAA 3SF0A 5DN6D 1EESA 3KSUA 1M0SA 2OMKA 3H5RA 1XVTA 3CANA 5JZMA 2FNAA 1G4HA 2XWJI 3IFSA 4W6QA 4EX7A 4HX2A 1EK0A 1E89A 2RC5A 1ISHA 4GOKA 4PXYA 1OZGA 1G42A 2ZBVA 1YGYA 4F2WA 2CFRA 3ISTA 3OQIA 4UZEA 2CV1A 2PBRA 2BUAA 2XVMA 1AGPA 3FTNA 3GBSA 3GGCA 5E0OA 3W6NA 3DXYA 3ZDQA 4RTRA 4G5SA 1KO7A 1Z0JA 2FSHA 1N2CB 2HCRA 2BGRA 4EPTA 1T10A 4IWXA 3DEHA 4WINA 3NONA 5H3CA 4QGSA 2WWYA 5C31A 3QIAA 1FMLA 2OVBA 3ZDXB 1KU6A 2I65A 2OORA 3OH8A 4RJ2A 1EFHA 3AIKA 3VR5H 2YUIA 2B8TA 4Y3UA 4FEAA 3RAGA 4MQ6A 4U9UA 1KI6A 5F9FA 1ORHA 3CVUA 3I64A 2P9BA 8MHTA 2PKQP 5DNWA 1ZR4A 3L8CA 1CQZA 4EUEA 1DBVO 3IE1A 1IN8A 1F4LA 2DUUA 2OGWA 4CTNA 3ABRB 1QVRA 2AJDA 1T9GS 2WAAA 5K0LA 4BCCA 3BD7A 4BWYA 4MB0A 2PE5A 3L0PA 4ZVLA 2WWGA 4RH0A 1NG9A 4ROTA 3EW9A 1RAAA 4KPUB 1IAQA 1RAFA 1WABA 2Q50A 3CB2A 3L0CA 3KTAA 3T4XA 5A9SB 4L5IA 4PC3A 1U3VA 2OD7A 3DZJA 1DFHA 1KEPA 2W90A 2FMFA 1EBUA 2BPOA 1V7ZA 2XTZA 3H2YA 4PSAA 3M1YA 1J7JA 2ETXA 2HO4A 3MWFA 1LVGA 4JQCA 4OAPA 2ZYHA 4PVDA 1R8XA 3PUIA 4H7IA 2GNAA 3GUCA 4OLBA 3H2IA 5KB3A 2QP4A 2XWQA 2ZVPX 3WL4A 2HXSA 4OBWA 2BYTA 1YU6A 5AHRA 2C9YA 5LYYA 2VDQB 2XA2A 2PMDA 1PNOA 3PE4A 2IYUA 2C4WA 4OA5A 4KQKA 1M9NA 3KLPX 4EUNA 3NVDA 2MSKA 2G40A 4O59O 2GPSA 2ZBEA 4FKZA 3CLKA 5BWCA 1E9RA 3GDFA 3IR5A 1YJ8A 4O4JF 1KF0A 2R00C 3ZC3A 1YCFA 2ZXUA 2RHGB 1KQ3A 3DEZA 4K5QA 5EIOA 1P0IA 2QVXX 2XUHA 3JATB 4QUAA 5K6AA 3IJ5A 4ND6A 2IPMA 2RHOA 4JLOA 5AKKA 3O31A 3OUZA 4ZQIA 2W2VA 3EZ2A 1YCHA 3A06A 3OICA 2H63A 4K0KB 2YWJA 4G97A 5A4JA 1V25A 3NHFA 3V3KA 5KTPA 2WIBA 3V9AA 2B5WA 4EL0A 4N0DA 1HDOA 2IZ7A 3RD5A 5BMVA 4KSBA 2B4QA 3VI4B 5EJ5A 2C5SA 2RE8A 1YOVB 4HZUA 3DMGA 1XFAA 3R74A 1ZGHA 1VLHA 3WIEA 2FW8A 5LA6F 1EHYA 2O3UA 3TLYA 4I5IA 1NC3A 1DV1A 4MTLA 2PG3A 3DFUA 4QBKA 1PJAA 2DFTA 2IYZA 3K3PA 3D02A 4YAOA 2G9VA 3L6CA 5KYUA 4BWVA 3L7OA 1P45A 4IRUB 1GU7A 2UZ3A 3D8NA 3LZCA 3PXUA 2AZTA 1REQA 4M89A 1T2EA 3OPMA 3E7XA 4GLFA 1FP6A 2D8AA 5AW5A 4CNQA 3U7RA 4P9NA 1QFSA 2F3RA 4N6GA 3ZBTA 4BGVA 2GDJA 2WD7B 2I78A 3DGEC 4LNUA 4ZO9A 1HYHA 4B43A 2ZB4A 3MERA 2ONZA 3ZDEA 2N3ZA 1G291 4BBZA 4BNXA 1FFEA 4BZZA 2ZYTX 2ECKA 1OT3A 2I3GA 2B8WA 2OQ2A 3HBFA 3HUEA 5EJ8A 3IODA 1RTTA 3NHWA 4D45A 2EIHA 1PWHA 1EJ2A 4GKVA 1IK6A 1B16A 4G9BA 4WI1A 3DE6X 2PZLA 1BXGA 4FGZA 4L3VA 2R7MA 1S02A 2SHKA 4BS9A 1QMPA 3F2VA 4EFKA 1NPYA 2G9ZA 3PEEA 1WY5A 3N7AA 3FR7A 3K1TA 3TXAA 4R6XA 2I22A 3UHAA 2XW6A 4MDYA 3QSYA 2JFVA 4RIHA 4FNMA 3COWA 1FC0A 1KRHA 3ZS9A 1KBOA 2XUFA 2ORWA 3FW1A 1XJWA 3HB7A 2F3QA 4BV2A 3TSYA 1WCIA 2X5OA 2MR6A 1ZIDA 3FY4A 5JI3E 1EP9A 3GZJA 1QX3A 5F52A 3KXIA 2FPGA 4WOCA 1T43A 1P81A 2CLOB 421PA 3EGIA 4QEKA 4QRIA 3R8FA 2ZVQX 3KHTA 3JY6A 2L2QA 3M6LA 4DTIA 5C52B 2D5CA 3SDSA 2Q4OA 5K3OA 3GVCA 1HC7A 2R62A 4HJRA 5KSYA 2B82A 2XYGA 1GNVA 3KOXA 4OATA 3X0DA 3ZWYA 2JKVA 4D4KA 2OCDA 1EDEA 2HFKA 1VSTA 2E48A 2BFNA 1X8LA 2RHDA 2XZLA 5I9LA 4HRYA 3SP1A 3Q7EA 1KWKA 3J7AC 1I7LA 4C1NA 2F9LA 4J16C 4CDRA 4R83A 3GNLA 2O1EA 5LBIA 3G0DA 2PD4A 3L06A 3IKLA 2O59A 2PXCA 2TYSB 1GQOA 1W5BA 2C97A 4CDMA 1PIWA 1USWA 3JARB 4YRFA 2YS6A 3RS3A 3GLFE 1U63A 5EMJA 1PR9A 2C03A 1FSSA 1XD8A 2G77B 2A9QA 2OXEA 3N2KA 1VGQA 4J4BA 3KT0A 1FOEB 3FNEA 3I0NA 2FQXA 4BPBA 5DH9A 1F48A 3GR6A 3T7EA 1E2FA 2QT9A 2WFAA 3ZGYA 1UZLA 4LMAA 4Q66C 3TFWA 2HU2A 4N3GA 1JH8A 1K89A 1D0VA 1UMDA 5JCJA 4YJ2B 1PK8A 4OG2A 3T5CA 3SYLA 4EEZA 1Z12A 2O2GA 2FYTA 1K6IA 2NVOA 4NK5A 1THMA 2AFIE 2G07A 4ZIRA 2DXIA 2IU6A 3HU2A 4B3RB 2FEAA 4GYYA 4QSMA 4HB2A 1Q1AA 2I2DA 3HADA 4PQGA 1KYXA 4AP9A 4S3MA 1E94E 2V7EA 2QI9F 5E4JA 4RHXA 2ZSAA 1KEWA 2AE1A 5SZKB 4Q12A 5JVDA 2HIMA 1L4KA 3D3EA 1W2HA 2EFEB 2ZTVA 1Q1QA 1G5FA 1JQLB 3L8HA 4RCVA 2Z09A 2HLPA 4C03A 3A9UA 3AESA 5C8YB 4W5RA 2O2EA 3F7TA 4ISBA 4X84A 3ZPXA 2HRRA 2CNWA 2OVFA 3LQ4A 3E15A 5J2TA 3FZYA 2PBFA 4KLCA 5HF5A 4JC5A 1D8AA 4P4GA 1QYXA 4PN7A 1RKBA 1J9GA 4FGUA 5A9TA 4Z0PA 3F96A 1Y81A 4IIHA 4CKZA 3RIYA 1ZEMA 4G67A 1YRBA 1OYWA 1TJPB 3REQA 1ORRA 2H8GA 4HDMA 4C4AA 4J4HA 1XTVA 4KHZA 3CVYA 3DW3X 1U3UA 1DIAA 1YRLA 5LQAA 2Z3VA 4HTAA 2WWTA 3L4EA 4KWIA 3EEBA 4F6CA 1E1CB 3GJ6A 3PGVA 2DHRA 2ZUFA 1LFAA 2R5FA 2ZUSA 1F4VA 3OO1A 3UJ7A 2HHJA 3IQEA 3NTLA 4IP0A 1XALA 4CQMD 3MWKA 4DV2B 3I9JA 3RV4A 3GCXA 4M0DA 4EOGA 4S24A 1GZDA 1K8YB 3R0VA 5ILQA 1R0WA 4A8HA 1LXCA 1OGJA 2HUPA 4HLQB 4H0FA 4GAEA 1N5KA 3H6KA 1XQXA 4DPMA 2ZIXB 4QU5A 5K6AC 3UH0A 1OZAA 3GVXA 4DARA 4TMXA 2KLBA 4WFQA 4NCIA 3DAPA 2UUAB 3Q87B 1GDDA 3MB8A 4UBNA 4H1TA 2XUKA 1SOMA 3WAKA 3UAWA 4OMDA 2IXFA 3GEPA 1HLDA 5ADUS 4DPKA 1KYVA 1RZ3A 1KY2A 2ZPTX 3HNOA 4G07A 1UPUA 3FLBA 4E5DA 1EA5A 2GZ1A 4PPQA 2HMUA 3WQHA 2DY0A 2GPTA 4YCNA 4RF3A 3E61A 2CY0A 2IHNA 3VHXA 3VSBA 1RM0A 3EPPA 1V5FA 2IHUA 5HGJA 1EWQA 1A7AA 1WSBA 2R1ZA 1AUPA 2ZDHA 3ICVA 1A8IA 4RD1A 3CG0A 3C2QA 3NI2A 2BBTA 2X2EA 4XSHA 1PWEA 3HE3A 4RM2A 1YFZA 1ZJYA 1Z5GA 2QX4A 3F7NA 5F73A 3REOA 1E20A 4IGKA 5ERYA 2EERA 4EY5A 3PZRA 5K3FA 5DULA 2NIPA 1ZIYA 2YHBA 4O3MA 4H3KB 4NMWA 4U9HS 4XIYA 2QRKA 5B12A 3O3CA 1Q0QA 3D0KA 1OWPA 3DDZX 4TGLA 3NDJA 4ETWA 2GZAA 3E3LA 5L7YA 1SKBA 1WMAA 2LW7A 3LLMA 1RFLA 5E3HA 4YJ3F 1UEXC 4B81A 1LTQA 1I7PA 1RU3A 1COWD 4AN1A 2H2HA 5J9FA 1CF4A 4J3JA 5K01A 1H2AS 1IRIA 1S2NA 1DEOA 2GEJA 3TKAA 1WKCA 1BKDR 3U4DA 3TGLA 3ETDA 4X7PA 2QYSA 3TLEA 4MUJA 3OUTA 3RK1A 2P9HA 1D07A 5F3DA 2P5SA 1ACMA 1BXRA 4A8TA 3K53A 1M2GA 3GLFA 3RASA 1XJCA 4UE2A 1SMKA 3OEEA 4B4VA 2C5BA 1ECCA 2GKOA 3BJIC 2FQ1A 2ARKA 3MJEA 3X44A 2FI1A 1AT1A 2GJKA 2JGKA 3ZHYA 2HO5A 4R1MA 3IV6A 1PKEA 5LP1A 3FVTA 1GKLA 3DDCA 1OF1A 3T34A 5KVQA 3H6HA 1MC4A 2H2AA 1OJLA 4FCCA 3VSAA 4P5DA 4Z9YA 4ZK6A 4IOJA 2VOJA 2OLKA 2VSYA 1CY6A 1W4LA 3COVA 3OU6A 5FOXA 3T52A 1N8TA 2H1RA 1ADBA 2AFIA 2QVCA 1RRPA 1ZOSA 5ICFA 3ZW9A 1Z47A 4EG0A 3OLXA 3ZE8A 5GONB 1TT5B 1H3FA 1XRJA 1T3TA 3ZCSA 3ABQB 4DLUA 4JLSA 3W79A 1FDRA 4ZOLA 5LOVF 2BJHA 3IIKA 2BI7A 3ME5A 2ZI5A 2OYRA 5A3RA 5LLDA 3ZE6A 1AD2A 4NBNA 4Z9AA 1Y9EA 4DV5B 3KQPA 1NVXQ 1UWLA 2JCVA 4KN8A 4QJIA 4M0UA 5GVSA 1ISJA 2O3JA 1NSYA 2XB9A 4S12A 1ZD9A 1KI4A 4O5OA 1IY8A 5T6MA 3UG6A 3CCCA 3EUEA 3UMMA 1UC4B 2GN6A 2PLNA 3FYUA 3MTBA 2XKAA 1X0VA 2VTBA 3PCRB 4P5EA 1EXNA 1WEHA 2ZQZA 1Y1SA 3ZI4A 2GD1O 3PHBE 1G63A 1L4UA 5IJXA 4OMUA 2G8NA 1QM5A 2R3SA 4XXHA 2II6A 3C8ZA 3PNBA 1RRKA 4WJKB 2XCTB 2YXEA 3DV0B 4LK2A 4WH0A 3V48A 1NDUA 4AJEA 4CGZA 1Q21A 2CDCA 4NBUA 3ZHUA 3WMXA 3DL4A 1KZHA 1QPGA 1Z73A 2H6EA 3N3BC 1NXPA 3BRWD 1UP7A 1YL5A 3O94A 3DDUA 4RF4A 4PLFA 2EF0A 4EI9A 5CB4A 2F4NA 5D5PA 1OLUA 3SNKA 1NA5A 3WE7A 1YZVA 4HGYA 4YRRA 1Q7BA 5JLAA 4J0IA 1IXSB 1QGUB 2CHEA 1NWCA 1GUFA 2VJQA 3G2NA 2Q5IA 3E35A 5KBYA 3AUAA 4QPJC 3N74A 1ODCA 1RYNA 5KVAA 4LFCB 1V8FA 1GG5A 3F4BA 4HQLA 1PR1A 3QUAA 3DVAB 2UUCB 2WYOA 3FCCA 5JD3A 1Z6XA 1HM5A 4RKRA 2AXNA 1XC7A 5CMLA 1CVIA 2BONA 1WQ4A 3TKYA 3D8RA 5HM8A 3ENNA 4Y2XA 2ETVA 2FW6A 5BVGB 5LZ4A 2B4YA 2VRWA 3CRZA 3V9PA 2RG1A 4FMDF 4MW2A 4ZJUA 4O25A 1W30A 1DTEA 2G09A 2GH1A 3TN7A 2OZLA 1UXIA 3DOUA 4G1UC 5EN4A 3UJCA 3W8DA 3LBFA 2B98A 3MSXA 2E37A 4BLOA 2QUBA 2A57A 3MWGA 4HDKA 1M6WA 2G3YA 2WJVA 2IYPA 3TI9A 1WP4A 1XVLA 2NQ8A 4NAHA 4FFRA 1P7CA 3KR9A 1U04A 2QXYA 3PNYA 4OKSA 4W5NA 2PT7A 5FB3A 1ABFA 2VXYA 2SNIE 4L27A 2HXYA 3GJ8A 2H4XA 3UTCA 3GLHE 2HF2A 1B8VA 4FQ5A 1I36A 4V0LA 1XX6A 3EZNA 3JZAA 2OHXA 4Y2QA 4LAFA 2J9GA 4DBLE 1RCFA 4JV5B 2YV2A 4V1CI 2X0RA 1X1CA 2J3EA 1W49A 3PKZA 4GPD1 1CERA 4BQSA 4ZFNA 2BHRA 4F2DA 3ECSA 4JUFA 3IOEA 4MVWA 1RCUA 3DBVO 3HFJA 3R76A 2FRXA 2XNCA 2BM8A 4PG8A 1PJTA 4A91A 4JUBA 4YAEA 2BM1A 5ITZA 3NCHA 4RD3A 4ENPA 1XWIA 4PCVA 4F3YA 5IYZA 4LDNA 3KTFA 4ZCQA 4IIXA 4N49A 3AF2A 2C2MA 2BLNA 2JIOA 3KU1A 2XQKA 5G0SA 5AXCA 5MFPA 3E9RA 5ECGC 2RFLA 1TUBA 3N2IA 2G82A 1MFZA 1YZQA 1P5RA 4WKPA 4AZ3A 3MQ4A 3U7FB 4GWKA 3MUNA 5FUXA 3THWB 1LLUA 1UR5A 4BN5A 4GLLA 4JX9A 4JUDX 1TJ3A 5FBQB 4IJKA 3SBOA 1LPSA 1NURA 2FJPA 2PQ0A 1CHDA 2ZG6A 1MC1A 1TTQB 1VJ0A 1EINA 4E88A 1SXGA 1P1HA 2DPHA 1W4AA 4KUHA 4WNIA 3ZYZA 2MIIA 2BFCB 1L5OA 1OKKA 1VE5A 1MAAA 4FBMA 2YHIB 4D9IA 1N2HA 2EJVA 3H2SA 1PJ2A 4BQFA 4ENSA 1G7CA 1HI9A 2P27A 3M6VA 4FYIA 1H6BA 1SOAA 1HG0A 3C24A 4FILA 4N18A 3O8QB 3S1AA 2HMVA 2V96A 5ED0A 3EVGA 4B3IA 5H83A 2I71A 5JMWA 3TUZC 1U0RA 2IQIA 1CY1A 1P7WA 3FPEA 3KV1A 2OV1A 2EGUA 2UVDA 4CQMB 3C3WA 1CR4A 1YSCA 1T5TA 2BBWA 5EJ6A 2O8DB 2OHGA 4WDQA 1TW3A 4C7VA 4Z4FA 4LF6B 1VECA 3JQGA 4L22A 3HYRA 8ADHA 3OJFA 1AHPA 5HJEA 3PQ4A 5CCBA 5IWCA 4MGEA 1QV9A 4QHSA 4WCFA 5IZCA 1KQOA 4M6WB 4AIRA 4GC5A 5EPEA 2QLTA 4LQDA 3WXBA 1BX0A 1KZ4A 2SKDA 3BCUA 2M6KA 4TV8F 1CRQA 4YJKA 3UJ3X 2WHPA 1UIRA 3DOHA 2FPUA 1U9ZA 2YWCA 4MUGA 5M2QA 2XGGA 4P80A 4Y6LA 3DBIA 5GZ1A 1XL1A 3OIFA 4TUYA 3GLIE 3OBBA 4ZVMA 4A1FA 4O2AB 2WWRA 1K75A 1XJ0A 1XTKA 2B7LA 3I1YA 4IGIA 3VZCA 3ROFA 5G1PA 4E22A 3E3NA 5CA1A 4CEIB 1BMFA 2B34A 1DRWA 3PF9A 4ENRA 3S5JA 1FJ2A 3RUHA 1G6OA 2G8LA 4PG6A 5EKXA 1JAYA 1UPXA 2EEPA 1Y3DE 3KX2A 1JJ7A 4NDAA 4BTLA 2O7QA 5JHHB 5BN5B 1J8MF 5JNRA 2AR0A 3T8YA 2JHCA 4OXIA 1N0WA 2QUAA 1JT9A 1O8BA 4HGRA 1UJ4A 2Y1EA 1H1TA 2EFJA 1QYIA 3H11B 3WGTA 4G24A 3FYUC 2Y68A 2V7WA 4BGIA 3E18A 1Z83A 1RPTA 3PHHA 4DEYA 5K0BA 3OPQA 1GTJ1 4S1OA 5L53A 5U9CA 3NBYC 4JJ6A 4MKFA 4UBMA 3H75A 2CZGA 1GTL1 1NY5A 2GHIA 3V4PB 1LDBA 3FOEC 1ILEA 1TM2A 1NUHA 1TU4A 1ZUHA 2RJOA 3ASVA 3KKZA 1VFPA 3DMTA 3P9NA 3CEHA 4PRLA 4R0VA 5CURA 1ML4A 3OE4A 5HCIA 4BEBA 5I9NA 5EKUA 4ZK2A 4UDXX 5BYAA 2OAEA 3HLTA 5G3YA 3E48A 3A4TA 3HWX1 1YOBA 1Y5MA 2WVJA 3UOGA 1YR1A 4EWLA 1YQWA 3DZBA 4PAMA 1WZ2A 2VJBA 1IUKA 1H4QA 2W2KB 1NF8A 2FSIA 4M9CA 3IAAA 4ZODA 3TLMA 2ODEA 4DBVO 5E2IA 2EQBA 1MGOA 1E69A 3UNXA 5E95A 1Z25A 1T5HX 1WKBA 2JLQA 4IZ6A 3ZJ4A 5F98A 3GLHA 2GM5A 2YWFA 3T5GA 4K6FA 2DWUA 3KT3A 3V2UA 3V8BA 3QPUA 4BQRA 4WWHA 3IEMA 4O2LA 4OKIA 2UZAA 1I33A 2ISSD 4IOKA 1V39A 1M34B 1KAGA 4YUAA 1T8UA 4LE2A 4D0RA 1ZUIA 2J3DA 4IIJA 9GPBA 2VRNA 3HSSA 1CUUA 5DHTA 4UNPA 3D3KA 3TLKA 3R3UA 4EI8A 2VHEA 3BSYA 3GH3A 3KP1A 2XADA 4OJTA 5KJCA 4Q24A 3T4EA 4FIZA 4F3NA 2XDQB 3I2IA 3L6EA 3VDNB 3A3PA 2I33A 2W58A 3WP1B 1DBSA 4KACA 1VMKA 1V8DA 1BHO1 2FFAA 4AUMA 4BZPA 1OREA 3DO6A 3B12A 2QV0A 2ZTUA 2VKTA 1SUSA 2FX3A 3A4LA 1RNLA 4X7BA 3O4IA 3RI3A 3HXMA 2WHEA 5JDCA 3V97A 1X9GA 5IARA 5LZ2A 2XE6A 4KR6A 2BI8A 4O0MA 1NHWA 2XE4A 4MUEA 1T5OA 2C07A 1W0KA 3K35A 5IASA 3OTQA 1HETA 3T5DA 1ENZA 4ZWNA 3U56A 5E7MA 2VRCA 2GK4A 4O4LF 5I4CA 4IXNA 1HURA 3P71T 2W8ZA 1E6CA 2Q27A 4GC9A 1LPOA 3EEIA 2B8JA 4F71A 4D9CA 1Z2AA 3LXMA 1E3SA 5LOVA 2WHQA 3ESZA 5FAKA 3V4SA 2OZPA 2V6BA 3EE6A 1S2GA 3KCNA 4GM4A 3L9WA 1EDBA 4BZQA 5ALVA 4ZQBA 2VBCA 3TDNA 1YO6A 2H4ZA 3D31A 1DQYA 4BOYA 3DMYA 1B6GA 4ZEXA 1QGED 5JRDS 3FUTA 3G8YA 4PAGA 3DOJA 1GPMA 3NWEA 1EVJA 1IL0A 2EBHX 1CS4C 4LQ4A 3DMRA 1OH6A 2VR1A 1RYBA 4GP6A 4EJ6A 3EYWA 2CFCA 5LMUB 1L5SA 1IZ9A 3K9GA 4HWGA 1C3LA 1W85A 1E6MA 3WGIA 1XNQB 5AESA 2H3EA 2YS7A 2P9TA 4FYXA 3EODA 1CRPA 4GBGA 3B6EA 1T1GA 3CZRA 1U9IA 2CFSA 1JE0A 3PKJA 5CNJA 3SIWA 3NHZA 4WY2A 3IJEB 1Y6JA 2PWAA 3DQPA 1AZSC 5EXEA 4EEKA 3EXFA 2QLNA 4JR0A 1G66A 2AJLI 3AERB 3NWPA 4KWEA 2BE7A 1DWOA 1RT9A 1ZH0A 2C2XA 2PRZA 4N3NA 4AZ0A 4S05A 4I3FA 4TZ0A 1NN5A 3LDHA 2I6GA 3T7AA 1USUA 2VF7A 3ND7A 1EVZA 4GRIA 1TA4A 5KDLA 2XSZA 1Q91A 5EEHA 2W6MA 1OI4A 4GOXA 2RHWA 2ZJ7A 1XTZA 3BQ9A 3W5BA 4UUMA 1RKUA 1PG5A 4BIIA 3IKTA 1XBTA 1BNCA 1D2AA 3JR3A 3PXDA 1TEVA 3E84A 4P58A 5DF1A 5EE1A 2QGNA 5CVUA 5DYTA 4UTRA 1PT9A 3TLBA 2NUTA 5HIMA 2FUNB 4YXFA 2P68A 2IS6A 3JQ8A 1JLSA 4OXYA 3O21A 3IDQA 3L8EA 3PYXA 4YLYA 1YB4A 1AXGA 1J1IA 1YU9A 2VSQA 3WB0A 2RK3A 3KOZA 4TXMA 1UBTS 4B3SB 4H7EA 1WUKS 3NXSA 1G16A 1GCUA 2I62A 2ECQA 4P3OA 3O9ZA 3SHTA 4U7FA 3FKSA 3QMWA 4D8WA 1UPBA 4MUNA 2FA9A 3OCXA 4G37A 3I5YA 3A9RA 1IZ7A 1LI7A 1R8QA 1TM3E 2H65A 2ZTSA 1ADYA 1RFGE 4UAUA 5CX4A 2PXXA 3DAYA 3AVVA 4EY7A 3OM1A 4Y7CA 3TEJA 1MHPA 2J85A 1V4NA 2JK0A 3BGVA 4IV8A 1SAYA 3HVUA 2WTEA 3F3SA 4DHWA 4M87A 5KNCH 1MNAA 5C5DA 3DZ8A 3AJRA 3UWPA 2DKOA 3OQBA 1JQAA 2W11A 4WHMA 3SR4A 1T6XA 1CUBA 2FWAA 3NBAA 3PR1A 3PPWA 2ZWAA 4K46A 1KJWA 1ZITA 4S1VA 3WX0A 2H8KA 5LIPA 2VCYA 2BLLA 5HDQA 3KFXA 1KZ6A 2IPXA 1M10A 2ENUA 1N5IA 2NO0A 1PD0A 3RVBA 2KW5A 1H4TA 3WADA 1DAMA 5L6MB 4KR2A 3ZWMA 3AB7A 1GQFA 1AM4D 1B00A 3VTKA 1SHJA 3P26A 5CXUA 3DMTC 5LL6P 2F67A 3A1FA 4YI3A 5J5VA 2ORED 1ZY2A 3QBVA 4YRNA 2QY9A 5CDGA 4W1RA 2C4MA 2PX6A 3IA7A 1C1DA 4Y2UA 4ZYVA 4WAUA 5BSVA 5BWOA 4CF4A 4OGGA 4MV1A 3L4JA 2DHCA 5CYOA 3QYAA 3QYPA 4MIKA 1JG6A 4X45A 4EUKA 3L0SA 1IONA 1BAPA 4MMZB 1UBEA 4WLFA 2ZIVB 4C0HA 2YC2C 1I7DA 2ADOA 4G0VA 3H2JA 4HB4A 5AI9A 1DHRA 2W6PA 1L8XA 3TL6A 2GXAA 1XNRB 1ZVQA 3EISA 4CM7A 4XTCS 1IXZA 1XG5A 3UMJA 4DBLC 2V6MA 1HO3A 2FUG1 1GITA 4IF4A 3PT5A 1TVKB 3H9UA 1GV1A 2QVGA 1LBSA 1ZUD1 1HDEA 4L4YA 1POXA 3TLXA 5KSOA 1HT2E 3DHVA 3IP1A 3KXLA 4RBNA 4BWFB 3G8BA 1UBMS 3JASB 2R9VA 4MS1B 2VH5R 4IG4A 2JI6A 2WIDA 3W5UA 4RTOA 1O87A 2YJGA 4MEAA 3UIEA 2ECPA 5L4LA 5JMPA 2C7GA 4TQ9A 3TLGB 4CVNA 4FOLA 3G3EA 2UVPA 3GFBA 1KDRA 4BKQA 5T7BA 1CQIA 1GADO 1VOTA 2DR3A 4G86A 1R5NA 2M6LA 5IN4A 1T9ZA 1VA4A 3BL8A 3WNCA 2EFHB 4E4YA 4N3BA 5F35A 2I1QA 3CURA 4PLPA 1OT5A 4Q02A 5AHKA 5FHQA 4BNDA 3D7MA 1Q3TA 3P27A 1ZMTA 1AK1A 4J90A 1AMOA 1GLGA 1F8GA 4ZDKA 2OXFA 3ZJVA 1YB2A 2TMDA 2FWIA 1MEOA 1PO7A 5F9MA 3O8CA 1P80A 4KXFB 3CPHA 2CV0A 1CUHA 3CKLA 3D0RA 3EGEA 4MYRA 1SPBS 3KL2A 2FFJA 4UOEA 4A9AA 1V1RA 721PA 2WJAA 5DXFA 4CR8A 1UMBA 4DMCA 2PRSA 3RSSA 1U11A 3M49A 3GJ7A 4FYJA 1TT7A 2PMBA 2QORA 4Y6QA 2R6JA 2F59A 2VJOA 4KXXA 4PTLA 4QULA 4UTZA 5P21A 2ZZNA 4RTKA 4CLOB 4RK0A 3VYSB 2FSGA 4N39A 5J2UB 2XXAA 4K26A 3BRCA 3K8YA 3SBEA 1II8B 4IL5A 3CR3C 2HI0A 4YACA 1YZYA 1XYVA 1H2EA 3A7DA 4W8GA 5DNAA 3WB2A 4AURA 3V1NA 5KTMA 4TMZA 3BA1A 1P1RA 3DBRB 1TAHA 4W5OA 1YBHA 3EIWA 1PZXA 1M6VA 2QTLA 1G2PA 2CNWD 2VPQA 4UUBA 3U1TA 3RUEA 2G7MC 2YICA 1KDOA 4LZNA 4PFQA 1GCIA 1POWA 4RDHA 3PFHA 3ICQB 1JB9A 3OJXA 3F6BX 2KMLA 3H05A 2QAGB 2O8EA 3OPYA 1UOEA 2OHJA 2YH2A 3GZ4A 1E3QA 3EVCA 3IBTA 3PA8A 3SE0A 1NLZA 1UMCA 2G1UA 3ZHXA 2X0IA 3BWMA 4AG3A 4B85A 5FO1A 1C9DB 4ETIA 1NUSA 2WVGA 3A04A 3WYNA 4NCKA 1IVSA 1PWZA 4TV9F 3P32A 5E0KB 3SR0A 3TINA 4UDYX 3TSCA 4BQOA 4URXR 2JIMA 3SM3A 4RTNA 3H9EO 3SQXA 5D7NA 4JIMA 4DW8A 4FB5A 1AS2A 1L5YA 1WW2A 3SSMA 3LXUX 1P3DA 1EDZA 2VK2A 3WNZA 4BVEA 5LQNA 3B3QA 1QP0A 2JGDB 3O38A 1VIVA 2VNKA 4RMGA 3U7IA 4BNUA 4X65B 1ORWA 4AI6A 2HJRA 5C80A 4UEOA 3EAFA 3ELBA 2GK7A 2PPVA 3GFTA 4DN6A 5B4UA 1XMVA 5LXTA 3ADDA 1BH2A 1E96A 1JFFA 1ZCAA 3E9ZA 3WBKA 2VYVA 3RYIB 5E8JA 5IC4A 3T4PA 3OM8A 2C8JA 4MZXA 1XDSA 4BATA 4BMPB 5C4MA 1FCJA 5FI0B 1K6MA 1VC2A 4MV6A 3WYFA 4YAJA 1KY4A 3PJGA 4ZRDA 2RGEA 1GT91 1R6VA 4PPYA 3CUVA 4M2LA 4WIAA 2FPPA 3A7EA 4QJ4A 1BCRA 1UBHS 2QGQA 3ZH2A 1FYEA 1XF1A 4GUDA 4JP1A 3VH2A 3RV3A 3VQTA 1SQ5A 3JR7A 5DX8A 2C57A 1O1YA 4YRPA 3ZQ6A 3OQIB 4XVQA 1JYFA 3GLGE 1PKXA 5BPHA 3GVPA 7MDHA 1DCKA 2CVPA 4OOEA 4LWOA 5GV7A 3A11A 3K1AA 2KS6A 4WK0B 4DQUA 4NFSA 1C8VB 1JNYA 4S0ZA 3VYRB 3ONDA 4YQEA 1IXRC 4BTVA 2PSJA 3JQBA 3I6QA 4DNOA 3U80A 1K9SA 3GC6A 4GWGA 3OZEA 2QQ0A 4A7PA 2R1UA 4TV8A 3MGKA 5CAEA 4B76A 2EGHA 1YZFA 1KI6B 3JD0A 3KU4A 2JGEA 3RC3A 1XKXA 1YVPA 2P6PA 2WJ3A 5D1HA 2Q0XA 4R1PA 2UYHA 1QFZA 1YR6A 1G60A 2BM0A 1XKTA 3C3AA 4DKXA 5AFSA 5IZ4A 2XMCA 2WFMA 4NVRA 3RFVA 2XBMA 3FD8A 2I6FA 4QUBA 2Y71A 4AF6A 4MGHA 4IXDA 1OFHA 2UZ1A 3F97A 3KTAB 1DQPA 3PGKA 4UTNA 2C9OA 1W88A 2E55A 3GLTA 3NO4A 1S5PA 4ZV7A 4AT1A 2XCOA 1PLJA 4CIXA 4KOAA 4HLNA 2I1VB 5AVRA 3B6JA 5H9WA 2ZVDA 4I4TF 2JEZA 4XFDA 2D4AA 3T1HB 3F4KA 3I9MA 4AROA 5C2JB 3UXHA 1IZ0A 1U8ZA 4L6AA 3DYVA 4MCJA 1NE2A 4FK8A 3M4XA 2MR5A 3IXQA 1QDLB 4TTJA 1RD4A 4GHWA 5IFLA 2VAXA 4BQIA 4DUPA 2AI1A 3GYBA 4XQGA 1PNRA 4QU9A 2OG1A 1OE0A 4COOA 3OEED 2C78A 3WA7A 1QVZA 1WVMA 2IU3A 4IGFA 5IF3A 5KMGA 3AG5A 4ILKA 1CW2B 2R84A 3BHJA 3JAKA 1NR7A 2WWIA 4ZALA 2JKYA 4CETA 2OHOA 3F8TA 2IZ6A 1U0FA 4O8CA 5KQRA 3TAUA 4D9GA 3BE6A 1MDBA 1HDXA 1QUEA 3OQJA 1I24A 1UK7A 1ECGA 1RLIA 4NPCA 3FCAA 1PDWA 2HIHA 3Q5DA 5EIEA 4C2UA 1YQQA 4WNAA 3U7GA 1A69A 3BJEA 5HZMA 4JU9A 4C0JA 1J1UA 4B3JA 5BMVB 2F90A 1EX7A 4HZUB 4EJ0A 1K27A 3KBBA 4R9VA 1TJ5A 1YGPA 4RLSA 4JLBA 5FUYA 3WJAA 1JJIA 3LT1A 3WO1A 3GELA 3PFBA 3N6RA 3P0HA 3QMPA 3H84A 1PL6A 1HV8A 5FNVA 3OFVA 5KYUB 2WRZA 2WUVA 4XKJA 4U7JA 1C9EA 1REQB 1UUFA 4LJLA 3HZRA 4JGGA 3S7ZA 4C87A 4FFNA 1CB0A 1CLUA 5THQA 4EY3A 5CM2Z 2GAAA 4LNUB 4CI0B 1DG1G 4R1UA 3NEPX 5IAJA 4BO0A 5ICSA 4HDSA 1H0HA 3RUAA 1RJDA 2IYSA 1KK3A 3OZDA 4YCBA 2BW0A 3OUUA 1EEHA 3S8MA 3X43A 2BGGA 1R0XA 9MHTA 2PUWA 3AI1A 1O2DA 1D2RA 1W0CA 3G5LA 4HWSA 3S7TA 2PLAA 2VHXA 4MZDA 3JZDA 2JGJA 1I1NA 4BVKA 5K99A 2Z5VA 4RHCA 1MQAA 1QTRA 4KI7A 2QLBA 1BXGB 1I14A 1DQRA 2QIOA 3ICPA 3LNTA 3LYAA 3IQFA 2ZGVA 5EJ4A 2O3SA 3GA5A 2HK7A 2ZT7A 3DF7A 2KE5A 3MOIA 4UFOA 4RTJA 1Z07A 4F4UA 3C3MA 2BMWA 1BZYA 4MWZA 4OBXA 2C29D 5FTLA 4FYVA 3BBLA 2ZPUA 2GF9A 3HH8A 5M04A 1IQ0A 4XH9B 4MVCA 3TLAA 1WCIB 1DKRA 3QRWA 5EFOA 3I23A 4K88A 1DO0A 1T4GA 4LPSA 4PLCA 1M73E 2FPGB 4M0KA 4DMLA 4OREX 3P0IA 4QLAA 3NORA 3ADBA 4BGUA 1M76A 2MYUA 3B9QA 5KQPA 3HVRA 4OB7A 4RLFA 4XUGB 3I5XA 1TZKA 3FPCA 1MOZA 3L6DA 2IEIA 2C9BA 1U8TA 4IUYA 5B7PA 4J7XA 3QTBA 1ZINA 4GMHA 1AY0A 1SUDA 2KWIA 3VDXA 4C4PA 2ZUCA 3HY3A 3PFNA 5JO9A 4JBGA 3GLGA 1NVMB 1XFDA 3P9IA 5IW8A 5B55A 1VYUA 3EMBA 5E1DA 3JD4A 4LXUA 2IZ1A 3A1WA 1XCMA 2R66A 1VKOA 4Y2YA 2VPWA 5COBA 1EVLA 3FTPA 4D6XA 1A88A 4EVSA 4JJZA 1JSLA 2C2HA 4LOLA 1I4WA 4N82A 4DCCA 1UBUS 3N3AC 2CJWA 2H85A 1BO6A 3K8ZA 2OP1A 2WBLC 3D43A 2YWDA 4EF4A 5AQ1A 4M8SA 3GRFA 4H35A 1Q95A 3RUPA 4F0JA 3ZXUB 3NTXA 4OTZA 2I29A 3NHYA 3Q8XB 3WP0A 1CUZA 1UZMA 4N6NA 1ND6A 3FYTA 1AQIA 3G88A 1WNTA 3N2KB 5FOVA 4KN5A 3C5EA 3L49A 3SXUA 3EZ9A 2XUOA 5LNK1 4A1OA 3PEYA 2JZNA 1DOZA 1KI9A 1SCJA 4MS3A 3RS2A 3MJDA 5IT4A 1JJBA 2QU8A 1RIFA 2PSHA 3R3YA 4NOJA 4WZZA 5AJHA 1HORA 1C7JA 1UMDB 2AEFA 2HN9A 3OEYA 5E1MA 5LZ8A 3QZUA 2QLMA 3R40A 3TWOA 4EECA 4BJ5A 2G06A 2HHLA 3I5UA 4PYQA 1WXWA 2FF5A 3ZQJA 4ZIRB 2D1TA 1VHDA 5BUQA 4FYPA 5A4DA 3R5KA 4W7HA 3TR0A 1MH9A 1O9GA 3TQRA 3JQBC 3FWZA 3RPEA 1UDBA 2LD4A 3KO8A 4M1KA 2IYAA 3PQDA 5JVDB 4M0FA 4BLQA 4YR7A 2YN2A 5JADA 2DAPA 4EHHA 1XCPA 1K8RA 4HGOA 5GJBA 5CITA 3AESB 3DNPA 1CUWA 1FDUA 1OXBB 2QZPA 2QTBA 3R3WA 5TT1A 4A15A 4ZU6X 1G0NA 2KPOA 1U7WA 3LYLA 2XUGA 4Y2VA 4V0NA 5IM4A 5J2TB 3KB2A 1F60A 3RB8A 4D3FA 1GL6A 3AINA 3GOHA 4MO2A 4Q4HA 1TMKA 4BAGA 4BB5A 3TIIA 1JG7A 4XASA 4PM4A 1OJ7A 4L8WB 5CTAA 3REQB 4R71A 3ESYA 1YA6A 1FQWA 3C3CA 1OKKD 2OAGA 4HDMB 4MWOA 4R2IA 3SC3A 3BL6A 5CEFA 5EVCA 5HUJA 5LU8A 3PDWA 2NO9A 2VO1A 3QU2A 4DQXA 4ZVNA 3TD2A 4KX3A 4JN6B 3C1UA 4GBMA 3V8EA 1XVVA 3TRFA 3LOUA 4Y0AA 1EYZA 3QEAZ 4WOPA 1L1EA 3BJZA 4ND8A 1D03A 1BD4A 1UFKA 1Q0TA 2Y1CA 1ND5A 4DG9A 4P82A 3CMMA 1MJGA 4J0JA 5HP4A 5H4GA 4INOA 1DKLA 3GJSA 4EYGA 3Q8MA 1NXQA 4P2GA 4PO9A 4ZVUA 1JPNA 1QF6A 3V5NA 3W1EA 4LKRA 3UK2A 2Y4NA 1FNNA 3CW9A 3BH0A 4C4SA 2P30A 3USES 1ESMA 2CN1A 2JBAA 2I54A 1Z6PA 4FMBB 5FFMA 3DNMA 2C77A 3DA8A 2WAMA 2B5VA 1X0XA 3JSXA 2L19A 2WYWA 2AKAB 2FPIA 1P5FA 2Z0MA 3HVHA 1UXJA 1NUQA 2SCUA 4PNHA 1S7GA 2NO1A 2QUKA 4JEIA 1TPZA 1FL9A 3ZYCA 2JBHA 2OK7A 4XR9A 5JC8A 1Y0BA 1A4XA 4TXLA 1YE3A 2A94A 5JEEA 1BOOA 3PU6A 3M81A 3UMYA 1T1EA 3BE8A 5JALA 1LUAA 5GGYA 3Q6MA 4RMJA 1GQYA 3V7UA 3SDZA 5AW7A 3QXHA 4PSKA 5A9RA 1FEZA 1Q1ZA 4UMEA 3VHXB 1BMFD 4EAAA 1T3LA 4RGVA 5LQSA 4AD8A 3R44A 2IE8A 1WP9A 3K8QA 4Q3CA 2XDAA 3V00A 4ZEMA 3THXA 5CJPA 1Y7LA 4J91A 3ABOB 1ZAYA 1C7IA 2IOQA 3IPYA 4S1PA 1TZ2A 4PYIA 3TIGA 4IDNA 1RTKA 4V3BA 1ZIOA 2EGGA 5K3FB 1VKJA 2C8VA 2I6SA 2VYFA 2WA1A 2XTNA 4W9NC 1O95A 2GJSA 5KYTA 1XU7A 4BO5A 4F06A 5ILGA 3VOBA 1XEWX 1UK8A 2NXNA 1ZGAA 3STVA 1H5NA 4G23A 4KG7A 1I2DA 3P19A 2Q1WA 4PZPA 1SZDA 1OVMA 1MJHA 1T8TA 3R5JA 1O3YA 2WABA 4RE5A 4GW3A 3ZK8A 4YV7A 5LJIA 3OECA 4QT4A 2OO5A 2X8LA 5BSRA 3FCSB 1V1MA 1RQNA 4FVTA 5LPNA 5FHRA 3GY0A 5IM5A 3UENA 4TQAA 5KWJA 1DAFA 4X5OA 1JI3A 1D2NA 3GDGA 4UM5A 5B4VA 5EXXA 2KX7A 2YZ2A 2JLCA 1R66A 3WDMA 1PS8A 3WLAA 1BXRB 4BJHB 1FXSA 5C51B 1WCYA 1HWYA 3MA0A 3LQQA 3GJYA 1W5TA 4KIJA 1CLEA 1JHPA 3IUEA 4HQOA 5EWMA 3RKUA 3P2MA 1SC4A 3AF6A 3FNRA 1DJNA 1G4AE 2AMFA 1CUXA 2OILA 1N0VC 3KYBA 3LE8A 5DBGA 3U7JA 1R9JA 3LYUA 5HTKA 1EFVA 4DE5A 4GSYA 2P90A 4ZHQF 1YRHA 3HRKA 3PC2A 4P92A 1UQTA 2QD1A 1U5CA 1KAQA 1ZKDA 3WGMA 1KOGA 4HV4A 2H52A 3KLNA 3NAGA 3NETA 3OPVA 5LDGA 3ROTA 4UBKA 3AFHA 4A03A 5A5VA 4EYQA 4YUYA 1DDGA 6NULA 3NYIA 2GQ0A 1P17A 4J7AA 3HJBA 3DO8A 4XAQA 1NVEA 3K0KA 2AFIB 4MQ4A 2OBBA 2JLUA 1SVIA 3D7LA 3L82B 1Y4DE 2P9QA 3INTA 2Y1GA 4MKRA 4RCYA 4XGNA 4I66A 3AGPA 1T36A 3OFJA 1CY8A 1BROA 4ZOLB 1BKYA 3HB5X 4DJTA 2PANA 1UZNA 2SKEA 3HYSA 4Q0MA 5AM3A 2YJZA 1KFCB 5A0FA 1MW8X 1X3SA 4Z7OB 1UC8A 3SOPA 4D9NA 1VLLA 1SOUA 4JJ7A 5KJEA 4YA6A 1Z2OX 221PA 4D5GA 4E30A 2C7QA 2NP6A 2B6HA 3DSRA 3MYYA 3QXGA 2KJQA 4TTVA 4RANA 1O77A 4B31A 2QD5A 2Q4RA 4M98A 4UHFA 4G5YA 1JFTA 4X61A 3E9MA 2BEKA 1L7AA 4LDAA 3WHIA 1X7ZA 4LV6A 3FYUB 1AQUA 5E6RA 1W0KD 2O3RA 5TGDA 3RC9A 1QHEA 4D0NA 5L8VA 4FONA 2CXNA 1J9EA 3RU3A 5L3SA 1VZ2A 1ENOA 1E9BA 2QYTA 3HN2A 4OHWA 1SELA 4QGHA 2NYAA 3H4TA 3LNCA 3AHGA 3UATA 5I7AA 5J1SB 3U31A 1P0PA 4MH0R 2JG3A 4DQLA 2I0FA 1GR0A 4PAQA 3V8RA 5LIRA 1V3TA 1NFFA 4NU5A 3AKZA 1O96A 1VKHA 3WHPA 4LXXA 1NNUA 4OLHA 5CB4B 2CL5A 3B7GA 2CWWA 2MU1A 1OLUB 3VO2A 2QNRA 1NPDA 2E4AA 3I4LA 3VBEA 4OH1A 5IKEA 2DPGA 1G20E 4QVIA 3PP8A 4ZO4A 4CIDA 4DCSA 3CVVA 3VR1A 3C8MA 1LI5A 1A5BB 2FSPA 2VXCA 5IJZA 1ZJ4A 2P2LA 1Y4ZA 4D80A 1R0YA 1YBVA 2CL0X 3EEYA 3OT5A 4FFPA 4KYVA 3KQWA 4UDOA 4B2YA 2WYVA 5K8LA 3ESBA 5CDHA 2J3HA 3RIEA 3VISA 4DRYA 2BDTA 3F46A 1M1UA 3H6GA 4JQYA 1AZLA 3EUFA 2ZJOA 4YPVA 4AFNA 4LHZA 2Z08A 4MMYB 4I2VA 5IJAA 1AGRA 4U1RA 4ZGGA 1I9CA 1MH1A 1Z8DA 3TXXA 1VIYA 2OZLB 3ICEA 1ULUA 4N54A 4WFKA 3H2GA 3C85A 4QPCA 4QNMA 1GD1O 2XSZD 3LU1A 4TMTA 1CSEE 2IDKA 2P0AA 5GINE 4HDKB 1DKUA 2P4HX 1KKMA 4JR1A 3B9RA 4LMBA 1PQUA 3U13A 3VU0A 3F67A 2X3FA 1ISIA 2XRYA 3NAZA 4KQ6A 4K9SA 1L5MA 3LHKA 1XZEA 3FOAA 2E82A 3PGMA 1FFHA 3QKRA 4J76A 2PX3A 1VE9A 5JCOA 4U5QA 3ZVMA 2EEZA 1WHTA 3FR8A 4BKRA 3AY6A 4KITB 1JEOA 1YQ9A 3T7RA 4DLSA 3JQEA 3TS1A 2QTZA 4TMVA 1NVAA 4GX5A 2RAFA 4QJ3A 2V8BA 4FB4A 3NX4A 4CFYA 3I1IA 2GM4A 5FD8A 3NRJA 1QNLA 3MRVA 3FKSD 4KQJA 2J4DA 5U1PA 1HSOA 1ZHFA 3D59A 2BTOA 1V2HE 1Y3HA 2ZB8A 4CU2A 4N0QA 4AQ7A 4U4AA 5ITZB 2QPTA 2Q8NA 2VXBA 1DKOA 2X1HA 3VH4A 5IYZB 1U0BB 3TW8A 2E21A 3WAGA 2P2NA 3NDRA 4K9QA 5EJ9A 2VSNA 5CDSA 1TUBB 1D8TA 2OP0A 4PAWA 2JAOA 1VJCA 3D6NB 2P11A 2QG4A 3AFNA 4QOFA 3WLQA 1Z0ZA 2V6JA 1EX6A 3B8EA 5CGQB 4AZ3B 3ITEA 4FYHA 1MO5A 2QVLA 1G1AA 3ORHA 4CF5A 5CVDA 1P5JA 3ELYA 3L1KA 4G4SO 1IOLA 5IBRA 4UUAA 2Q1TA 3HWSA 3UHFA 3VC2A 1E2LA 4LF5B 4KH1A 2YZKA 3G2KA 4HPJB 2VNHA 3WNVA 3WLPA 2EW2A 1D6SA 3COPA 4M1EA 1E9AA 2BIFA 3M2PA 5ALOA 4ZREA 4EGAA 3U0BA 2X4DA 4QATA 5CX1A 1O4VA 1N9GA 5AICA 5ERGB 3KPWA 1J09A 5HG0A 2DFKB 2I4NA 2HSEA 5LUAA 2PSEA 4ZJYA 2QU7A 3G0IA 3G2HA 3QKIA 4FWIB 5FI3A 2J5RA 5BP7A 4JVMA 5BUZA 5LM3A 3T12A 5EQTA 3ZY2A 3S1AB 1AJEA 4TQGA 3O6VA 1JIKA 3ANTA 1R37A 4QX6A 5LQDA 1E99A 1G6Q1 2O48X 4BFZA 4H08A 4MV8A 1LLDA 3TTSA 5KVCA 2VATA 4YT5A 4PBSA 4BJ1A 2O23A 1N36B 4YCAA 5FL3A 3IR6A 3KYJB 1XP5A 4U39A 2BHNA 1YBFA 1YE5A 2HM7A 3AEKA 3JQGB 3O3OB 4IKOA 1FFDA 4JLDA 3CLHA 4BMYA 2WLSA 1IBLB 5AVZA 1R1DA 4L08A 1DHTA 1MFPA 3BD9A 2WU3A 3LVRE 3WLHA 4WCFB 4ENWA 1WUHS 1Y48E 3QUSA 2G9NA 4OSPA 1WVGA 2HJ9A 4C7MA 3ZBUA 1WDKA 2PKXA 4MRNA 2PGNA 2ZRFA 1NATA 1Q77A 2CF6A 1K8ZB 3V4VB 2WHPB 4AO6A 1AKWA 1JWBB 3T1YB 3HHPA 3DBHA 2HWXA 5BSUA 2H4YA 4TUYB 1SC1A 3OWXA 4FP9A 1UMKA 3TCXB 2A4KA 1T5DX 4KQHA 3AZQA 3A6FA 3GLKA 4YRSA 5CXXA 5JY1A 4RACA 3TTWA 3R7LA 3IDOA 3DLIA 1M0WA 3RIMA 5CA1B 1IZ8A 3KQKA 3K9QO 2GVDC 3KFLA 1KJ9A 5ER9A 1XZDA 5EXDA 1OZFA 5IDWA 4DA4A 2Q3LA 2IC5A 1TL7C 2G67A 3ACCA 5E7QA 2XBLA 2ZRAA 1CEQA 1LEHA 1G20A 5F33A 4ALNA 1DCMA 1M66A 4NJOA 2PZBA 1FB5A 3D6TB 4QEDA 2ZJFA 2R79A 4Y6RA 5DE3A 4A0QA 4ER5A 5C32A 1X7WA 1JIXA 1IDN1 2CL6X 2IYNA 2W43A 3AO0B 4RS3A 1X94A 1W5AA 2OZKA 2XQVA 4XYMA 1YS6A 4CV3A 1TQ8A 5CDYA 4OX9Y 1CHNA 3VKUA 5AK6A 4BQQA 5JPIA 3JRWA 1NU6A 4IZOA 2MMGA 5I01A 5AM4A 4JENA 1XRQA 3STTA 1OXVA 1TGYA 4HEJA 4IJUA 2CB0A 2O6HA 3CS3A 4Q6WA 4Y2SA 5HILA 4BFVA 3ZY6A 4EGFA 5FWNA 1TKCA 2Y2UA 4HRVA 5BORA 1P2VA 4RA6A 3NHAA 4B35A 1SBCA 3E2MA 1FFBA 1JIIA 1GFSA 3SYNA 3FSJX 5L51A 1N2GA 1DO8A 3EZ6A 4ID3A 4JP8A 4EY4A 3FLMA 1I2MA 5BWMA 4DYVA 2XVYA 5JFOA 1TPYA 3BSFA 3IOCA 2X77A 4I4NA 4W1PA 1RYFA 4WN9A 3RREA 3W2HA 5TS3A 3IKMB 4B79A 3S2FA 3QBEA 4DV6B 4OQZA 3F4LA 4EKGA 3GLHB 5PGMA 3N86A 4R3UC 3A9VA 3ZDBA 1DGQA 4ESVA 4BV9A 4OFXA 5LWHA 3I73A 1YZGA 3SIRA 1G7RA 2XTMA 1H66A 2K5UA 5AKZA 2JGAA 1KI3A 2L42A 2IEAA 3MXTA 1NQ5A 5CP8A 4IIJB 4GX1A 4HI0E 5C46F 3U61B 3P5SA 3T1NA 4AKSA 2HJHA 5IAOA 1P1CA 2X0NA 2BZ1A 1KKUA 1NL3A 1HDCA 1QLJA 2ZVJA 2H18A 3L02A 3MVEA 3T0GA 2ZR0A 5AOVA 1UKYA 2VAVA 4TXHA 3GAMA 3F6SA 3VV3A 2WAYA 1C0PA 4D9BA 2B4TO 1FMCA 1SVMA 2VYVD 4PFKA 5AHXA 2BMEA 4JCOA 3SSOA 3AYZB 1OVGA 3H4IA 1UBSB 3KZNA 3PVSA 4W99A 1O5OA 1SXQA 4RTMA 2WYIA 4E32A 5JNSA 2Z5GA 3KM0A 4QDUA 3MPUA 5JJKA 1AX9A 2G9RA 2N9UA 5JCOC 1Z4JA 4G0NA 1DPGA 4FE7A 1NJ1A 3IUNA 1NYQA 4L50A 3K9HA 2WU0A 4M0PA 1P44A 2E18A 3IX7A 4AN0A 1DFGA 3LY7A 3S1SA 3IV9A 1FE8A 1CF9A 5K2OA 4Q4DA 1DKQA 5GZ6A 4MWBA 3NFYA 4MCIA 1D2HA 4G85A 3WYEA 1TNDA 2O2SA 3FMIA 3EW7A 3KXDA 3MRTA 5LOVB 1BIFA 3KOWA 1ZA1A 1DMRA 1Q44A 1NVGA 1Q19A 2YJ3A 4WECA 3V7WA 2ZIAA 4TTIA 5A5EA 2NG1A 1W9HA 5EKDA 3F6EX 1F9EA 4G2NA 3RSHA 4C1BA 5GZ3A 3UHJA 4I6GA 3LLUA 3QVLA 5AOBA 2IK8A 4IMIB 2CLHB 3SLGA 1F3LA 1JILA 3R9XA 5TRTA 1ORDA 3I72A 2PJDA 3O4JA 4NJEA 2G7ZA 3DF9A 4OJNA 4DR2B 4NE2A 1VL2A 2A5JA 4EJMA 3KEMA 3L2OB 1ACLA 1H2ZA 2QN8A 2ZFUA 3NLLA 1JKMA 4IM7A 3Q7PA 3D64A 2Z9DA 5TGTA 1KSFX 4YFYA 1UBOS 2J7PA 2R25B 2VDWA 1N6RA 3J7TA 5B2FA 4I1OA 4Y6GB 1E2KA 1FRNA 3W9UA 2MYNA 1L5QA 2VHZA 4IV0A 3QPBA 1IN1A 5JZSA 1J8VA 3ND6A 2IYOA 1KSGA 1E6KA 3EXFB 4JL5A 3O47A 4L8YA 1R18A 1SHUX 4M9QA 4YV0A 5BR4A 7ABPA 3GLIB 4AZ0B 4HWKA 3MFYA 3VDMA 4L4XA 4C0LA 2IBTA 1KY5A 3S99A 5EHZA 4HVLA 1WXEA 2XA1A 3ZTYA 2ZITA 3ESAA 3MB5A 3L7CA 4PLTA 5C3MA 4J3FA 3HUUA 4QVKA 5T64A 1A9QA 4MV4A 3EH2A 3QHAA 2O07A 2F1KA 3HDYA 4NEHB 4ZP1A 3WBBA 1Z63A 4X8MA 3WK5A 1F4PA 4BYGA 3H13A 1VYTA 3CX3A 3W9SA 4NXMB 4IH1A 1PGQA 1DBIA 2OC9A 4DT1B 1YZHA 1ZO8A 1BRTA 1Z0FA 2A1TR 2HY7A 3IQWA 4FUTA 1MAUA 2H57A 2VP4A 5DTEA 2NUTB 1NMZA 1MB2A 1RMQA 2GF2A 4N8SA 3BQMB 3E3MA 3JQ8B 3DD1A 4PC2A 2ONYA 2VYNA 4KLRA 5SICE 2D2EA 2HUNA 3A3OA 3MPOA 4ZVPA 2Q46A 4TYYA 4ER6A 1FXWA 3I9V6 1ADCA 3UGTA 1VIAA 3MW8A 2BZGA 3H5LA 1GEGA 1T4DA 3L7DA 4QYIA 5TVGA 5J4YA 2QZ9A 3HB0A 2O5EA 4W82A 2OXCA 4JVNA 5GAJA 1IDOA 1ULHA 2HSJA 2VZ8A 2RHTA 4LQCA 3WQRA 1FJXA 1J56A 4N3CA 1QAOA 3EIQA 4JB0A 4OXRA 4WFIA 1J8DA 5B36A 3U1VA 2G4VA 2Q2NA 4RHUA 5AJUA 4E4RA 3DYIA 1OC4A 4NFYA 2I2XB 5JPCA 3GJTA 4KO4S 5LJLA 2YIJA 1Z4NA 2X5XA 3VC7A 4EA7A 2Z5LA 4NDNE 1SVWA 1NE7A 4QYMA 4B0OA 5C5EA 3SQMA 1H2XA 4QUEA 4OK3A 2M6RA 4AJPA 1YDHA 2ZSJA 4NS4A 2FE4A 1RHMA 3IURA 3B89A 3NB0A 3TJZA 3I4CA 2ZQYA 3PUHA 3R9WA 1L5KA 1NY6A 2ZT6A 4KE8A 4BNLA 1HT0A 3V2HA 2NZYA 2EFGA 1QR6A 4ZYZA 3BGIA 1G0OA 2FZCA 2QA5A 4NATA 5C7LO 2C96A 2R751 1Z22A 2V7PA 2RH5A 3CB4A 4YROA 1Z7WA 2X8JA 2XVZA 3AETA 1B26A 2M32A 1U9CA 4FDVA 3GV0A 4BXOB 4CM4A 1TRHA 4BNNA 3R5TA 3I62A 2ATVA 4L5JA 3K92A 3PD1A 1UEJA 3L7MA 3QUTA 4DQKA 3PUZA 3HEBA 1QGDA 3I05A 3NHBA 2PRJA 3KKKA 3WHKA 5BUCA 5CG1A 5FCDA 3E1GA 4YN3A 1D2GA 2Z8XA 3IXMA 3NT5A 5J63A 3CX7A 4LDPA 4IG9A 3UCFA 1ILWA 2G1KA 1EXDA 2X0EA 1C1DB 3E4CA 4G4IA 3RBAA 2X14A 3E70C 1PR0A 1J4AA 5A5GA 4RF2A 2JI7A 2PBZA 3GLIA 2I3DA 5HIJA 2FSUA 3QWHA 1YHNA 2H9AA 4Y1FA 4A4DA 1P2TA 3P0RA 5E4FA 3KBOA 3G2PA 3FNBA 4R68A 4YPOA 5JPDA 2V5VA 3TXYA 3L7JA 3IMFA 3ZHSA 4ERXA 1V4VA 4ZEOA 5K3SA 5K8TA 4JL8A 1PR2A 2W6QA 3D5EA 3KVYA 5FJIA 5DYIA 3L6OO 3UMVA 4X93A 1E58A 1G8YA 3N0TA 3QX3A 4D8VA 1EWKA 4OYRA 3GFSA 1E7SA 1WJGA 1LPAB 2C4UA 1Q1EA 2HU5A 4C04A 2W4IA 2WIJA 3N8HA 4MJXA 1UBGA 3AR3A 4CF7A 4B3HA 2F1JA 2QN7A 3L0IB 4QICA 5C18A 1W2WB 4HMOA 1CFZA 2W00A 3K0CA 2UVPB 2QR5A 1FYVA 2G5GX 5G4LA 1U7TA 4XD7A 3SY8A 1CQIB 2PGJA 2NN3C 3U9SA 5KQLA 3U3JA 3SVTA 1ZOPA 3WL5A 3KDAA 2HCFA 2JGLA 1I13A 1GPH1 1EWTA 3HZHA 2Q5JA 2GMWA 2Q6LA 2WYHA 3U3MA 2DF8A 2R1VA 4PR0A 4CWAA 3HB1A 4BNDB 1T5BA 3OTGA 4CE6A 2AMLA 3CX6A 2H06A 3H9JA 4FUQA 3D6VA 5HNKA 1JFSA 1APBA 1EMDA 1NKSA 4NKRA 2W6ZA 2A58A 1R8YA 4OK5A 1JMYA 3ISJA 4UMDA 4DB2A 3ER6A 1WU8A 2FR8A 3UXYA 1ADFA 4F93B 3CT6A 5ALXA 2AK3A 4P4NA 1QHSA 2YBDA 2C1XA 3NH9A 1A9SA 1V1RB 1Y80A 1B1CA 2CNNA 1UMBB 1FNSA 1U9YA 2NT4A 1SVUA 5E3IA 1XMJA 3NQ41 4Q21A 4Q9JA 1YJQA 4RSHA 1ZYUA 1MOQA 4FX2A 3CKMA 1GNPA 3FF1A 3CKYA 2BM9A 1PW5A 4UQPA 1QU2A 3HCWA 2XXAB 3ITDA 5JS1A 1LF5A 5H16A 3MCZA 4MGKR 4LYAA 1Y8RA 4MKIA 4ND4A 1ULAA 3O93A 4LWZA 1MZPA 4EO9A 4G5FA 4OAQA 4NYMQ 5JXIA 2C2KA 1G9SA 3ODPA 1GG9A 4PLGA 5IBPA 1V3UA 3D3QA 2QYOA 3EASA 3LPAA 4NICA 4ARZA 3MJRA 3EIEA 1OCEA 3HCBA 4KIGA 3CCFA 3OU2A 3S44A 2ZR9A 3MJCA 3E0QA 3CLRC 1RVDA 3BXGA 1AG9A 3TVTA 1M6VB 2AVNA 4I1YA 2FWJA 3WMWA 4E07A 5M7EA 2A3RA 2O8NA 3O7WA 2FVYA 3GLRA 4GBED 1YHYA 3PWKA 4HFRA 3DKRA 3AQ4A 4DDHA 2GD0A 5JXWA 1TCCA 1UFRA 3DEYX 3F2IA 4G26A 4ZAFA 4DA7A 2C61A 3OPYB 4JGBA 1P61B 2O8EB 1U0HC 4JUAA 3UPDA 1JAXA 1UMCB 1BDBA 1VG0B 4LE0A 2V6IA 4NU8X 1NASA 3ZHBA 4IQGA 2JLXA 2E0IA 3D7NA 2CXXA 3PHJA 4Y0VA 3WNBA 2CCJA 1MAVA 5D3ZA 2OBMA 3UWDA 1YS2X 2QVZX 2BKEA 4TLMB 5AKEA 3GCWA 3H87A 4F85A 1LPNA 4H3HB 3KKQA 2VAWA 1RXYA 3HZOA 4ESHA 1KFKB 3OWOA 1YXMA 5KUTA 1A96A 2TMGA 3ZWNA 4KFCA 2ASVA 3WGHA 2P35A 5LXTB 4MW7A 5HQJA 4B3MB 4JYCA 2H4JA 1JFFB 2JPDA 3K72B 3LUPA 2HK8A 3O9MA 4A8JA 4BC0A 1P2UA 3QVSA 4QA9A 1YUBA 3DLTA 3TMKA 1DG3A 4JELA 4D82A 4LSWA 1GNSA 3LDFA 5IK2A 5LUBA 1T0BA 3WTCA 1MVNA 1R2QA 3LQKA 2FPPB 1BCRB 1P2BA 4YY3B 1B14A 1E7YA 1MENA 3VTFA 1P5ZB 4RX1A 4BN4A 3L46A 5JQGF 3NIBA 1WUIS 2J3JA 2JW5A 2JZOA 4JI6B 4TRMA 1N2BA 5I9BA 4JU8A 2I9KA 3FPKA 4RXMA 4Q3LA 3FCUB 4OP1A 1J1ZA 1I1HA 4TWBA 3BTVA 3OSZA 3SAJA 1NT4A 4YV1A 3K1AB 4XJXA 2IYEA 1EHCA 3TCKA 2FPSA 2D00A 4OXKA 5H3HA 4DLZA 2L17A 1TIPA 1MAWA 4BBAA 1ZCFA 2AMJA 2NP7A 1XRLA 1YQXA 4KMMA 1IG0A 3EQ9A 2RAUA 3W9BA 1XV5A 2W2OA 3E9NA 3QE0A 1FRVA 4TTPA 3ED1A 4TV8B 4REQA 5CAEB 2P9FA 1O6CA 2RI0A 3ZWWA 4ESOA 3GUVA 2X58A 4WBNA 1GKYA 1B2LA 1CIVA 1L7QA 1WDTA 1XTTA 1PS0A 2IOHA 2HQ1A 3RUIA 4BFWA 3PQ2A 5HKAA 1GYRA 2Z83A 4U0KA 3RC2A 2WTMA 3N2YA 4P3YA 1LFDB 1OGYA 3DHYA 4LZWA 1NNI1 2YBEA 3RGWS 1NOKA 3LAWA 1O95D 4J2HA 4YDRA 3SC2A 5IEJA 1JBQA 1RADA 3GAZA 3K6RA 1GDTA 2X4GA 2UZ1B 5FTWA 1JDUA 4HVAA 2YQZA 3FOWA 4C5CA 2E5WA 1W88B 3AKDA 4ILEA 5I7FA 1R0LA 1G8KA 2JCSA 3O0DA 1C7RA 1USIA 1R3DA 5DM0A 1TCUA 1RHQA 4YDQA 4B0PA 1G17A 2GRAA 4FFMA 2BEJA 2Z8YM 2FY8A 3FIUA 4CM9A 2Q3CA 2CZCA 1NW9B 4WKOA 3GA7A 2HMYB 4HCJA 3MAAC 3DEKA 4BP9A 3G0BA 1QS0A 2QJFA 2XEDA 2XXBA 3BXPA 3IT1A 4J1TA 3SZOA 1LBQA 3W78A 4WT7A 1TKBA 4KH0A 1ISSA 1RZVA 3DLBA 1QC5A 1KJNA 5KMGB 3KLOA 4AYWA 3MUEA 1JHAA 1XA3A 3SS9X 4V0OA 5LBUA 4AMUA 3HMKA 5CFPA 1PS9A 3L7LA 1P4AA 3JAKB 3IP5A 1QO9A 2W93A 1FYWA 3WQQA 2YTZA 5H82A 3AR9A 2X9QA 3CG4A 4KBGA 5HGXA 4KRXA 1I2BA 2C4VA 1MVOA 1TZMA 2PWZA 3OOYA 4JC0A 4CKEA 1J00A 4ZMSA 1JGTA 5AM2A 5EZ6B 4PWZA 1B8OA 2J33A 3KZVA 4I46A 4ER0A 10MHA 1W1WA 4WNAB 3WL8A 4PG5A 4WW0A 4GIBA 1RQ7A 3KR1A 4FINA 1JA9A 5ALGA 3QU7A 1MG5A 2OT3B 3IAS6 1C8LA 3R3SA 1DB3A 2H4HA 3NV7A 2YVUA 2G17A 1JRLA 1TCVA 3TUIC 3VYWA 1GHTA 5J43A 1U2DC 3OQVA 2VDKB 5FNVB 1JAZA 3MQ2A 1K88A 4QELA 5D01A 5BSWA 2PR2A 1W93A 5C8ZA 3J80A 3N8DA 2UXBB 1U7HA 3WDKA 4DCOA 5ADHA 5CR9A 2FE1A 3VR0A 5JD4A 5K09A 4G0ZA 5C35A 5K8VA 2HC9A 5IVIA 5EJAA 4HDSB 5CW2A 3MC1A 1NYTA 2A35A 3B1YA 1SR8A 3MOSA 1V8PA 1K8XB 3CGWA 3JYPA 3SOZA 7YASA 3A9TA 1BCSA 3BHNA 4MSUA 3G68A 2VRBA 3GRKA 4DJFC 1FJHA 4C05A 4DIEA 1O5TA 3A4YA 3KYCA 1RBZA 4K6CA 5A62A 3AEUA 4LVCA 1YQUA 3HJAA 2A1UA 5I9SA 4DIUA 5AUOB 2IL1A 2X15A 3KJHA 4YRIA 1DJLA 1NVDA 1XEAA 2RHBA 3CN9A 4LJ8A 1LVHA 3JYLA 3NWOA 3U6KA 1AIPA 1PX0A 3EIFA 3RT9A 2OSBA 2ODNA 1EVIA 4NBSA 4X1YA 3SNHA 1JJVA 5DNUA 7ADHA 2CZQA 1WXXA 1HTBA 3O90A 2CB9A 1NQWA 3KPJA 3KE8A 2OG2A 4LBVA 4DF3A 1W5SA 3RGGA 2AW3A 2IHJA 3K4HA 4FWBA 4KX5A 1IC6A 5AKXA 3EQ8A 3HTXA 4UC0A 5F5LA 3MCUA 3UK1A 5MGBA 3HLYA 1M8GA 1TU0A 2A67A 3DEIA 3IERA 3RJZA 5EP4A 4JLPA 3KKNA 2Y93A 2YZ7A 5CNMA 1QB7A 1A8UA 3NVAA 2CC2A 3GEDA 4L2IA 4GL2A 1H9CA 5I5EA 1YB1A 1QK4A 4GU5A 1WUYA 3EGDA 4RK5A 5CT8A 3NYWA 1U6KA 1VLVA 2OQRA 2WILA 1MF7A 4ZANA 5EESA 3VAYA 1VE7A 2RKBA 3ZZ0A 3GLGB 4N7BA 2BY4A 3PWTA 5KX5A 3MTGA 1TMGE 4ISCA 4EVIA 1X1AA 5A1TA 1KP9A 1IUPA 5BV0A 3EEFA 4QKQA 4YDSA 4Q4AA 1PZEA 5GQSA 1K6XA 3B36A 1N1EA 1TUEA 1ZH4A 4L72A 4O3FA 3FCXA 4L95C 4DLKA 2CVZA 1AV7A 821PA 4HWTA 2P7HA 4AECA 5D86A 2CJWB 2X1VA 3TEFA 1RM5A 2XE7A 4BV8A 2FAXA 1Z15A 4ZN6A 1X13A 2O57A 4LYFA 5K03A 2ODQA 5K0TA 1GPYA 1W94A 3E7WA 4OGFA 4A8JC 5JBIA 4G36A 2VH1A 2EJWA 3KZCA 4LJ4A 4U6SA 3RU7A 3ZOKA 4B7XA 3OTWA 5JWHA 2ATCA 4ND3A 4WK4B 5DGCA 2GD6A 4FI3F 1SIOA 3EN0A 4NYIQ 1YK1A 1ZVVA 2WSMA 2D1YA 3GFGA 3SXUB 3WK9A 3E9DA 3RVKA 5LZ9A 3VH3A 1SQFA 2D5IA 4Z53A 3ZDDA 4DEXA 2ZRPA 4P38A 4MS3B 2PLWA 1HY3A 3MINA 1XDGA 1U28A 4UKDA 2FZGA 3PDUA 1KO8A 1FTQA 3QLVA 2DOKA 4K0RA 3ANLA 4FKBA 4LIPD 4AVYA 4IWNA 4JL6A 1HDRA 3MGAA 3UJBA 4DMGA 1P29A 2KM1A 1JL3A 1U6JA 4GR5A 1P7PA 1Z5UA 1N5OX 1WBDA 1H4VB 2VSFA 1N8KA 1X39A 2EX4A 3RJTA 5J3JA 2XZPA 3FDFA 1N6KA 3WGLA 2D0PB 3GWGA 1XHFA 5K45A 2FW1A 1U0NA 2IYTA 2ZWOA 3IAEA 2Z8ZA 4DCUA 2LR0A 3E7DA 2FQQA 3ILVA 3L8DA 4QUIA 4B71A 2ESRA 4G01B 4KODA 1YRAA 2OD9A 4HNTA 4CG3A 4QG3A 1PLKA 2HBRA 4UXHA 4Q9DA 2PX0A 1GUBA 1S3SA 2VT6A 4UU8A 2E3JA 5ECYA 1XMOB 3WLJA 2J30A 4BRZA 1DXQA 4DJEC 3VR5A 4YMUA 3W8RA 5JXGA 2E4VA 4JLAA 1DTWA 4YRKA 3AY7A 4O08A 4MINA 3T95A 3LV8A 1CDEA 4O63O 5LYJA 2P3SA 4Q4HB 3U9TA 2XTAA 3E7PA 5F5NA 1INLA 3LWBA 1C5KA 3OZXA 1EM6A 2B6NA 1BWQA 4KYIB 2DZDA 4MYHA 5FLYA 5K0GA 3A2MA 4LXIA 4NHEA 5FO0A 3ASYA 3BRSA 1PEKE 4H4CA 1C81A 4J7UA 3AL0C 2D4HA 2IGTA 1KMHA 2BCJQ 1KYWA 4URWR 4HNQA 3AI3A 3LPLA 1VXRA 2X7HA 2GEDA 3PNVA 4B4WA 3CLTC 4ND8B 1Y3IA 4PYRA 2JIRA 2ZAIA 3FETA 1GPKA 4PRKA 3V4LA 2P9ZA 1NZJA 2FH5B 2WJ4A 2XCQA 4J1TC 1MXFA 1UM8A 3B5IA 3G2JA 5BSGA 2RBEA 1ZVMA 2AN5A 1OROA 3QWIA 4FZRA 2JLBA 3EPRA 5KPDA 1QP4A 4YJ2F 4ND1A 4U3JA 1PCXA 4MOWA 2JBAB 4IICA 4MVJG 1NC1A 1RR6A 4IMJB 4XIFA 1VHTA 3BB4A 2FR0A 2K2QB 3PZBA 5ICCA 5DYGA 1NBIA 3G2LA 5KREA 4EGSA 2FPIB 1OXMA 3HBJA 2D7JA 3CU5A 1ZK4A 1I4EB 3A1VA 2RK4A 3FYSA 1R5OA 2A9VA 3C5HA 3LFUA 1RI2A 5DNEA 4KIUA 1XAHA 2GJ8A 1D7AA 1X7GA 2XUIA 4GLJA 1RABA 1T3HA 4ZJPA 1ORIA 5C8YF 4LTMA 1NX6A 1GYQA 2NX2A 3KFVA 1FTGA 1FU4A 1QGOA 2HSWA 5HMLA 4JLUA 2IVFA 4US1R 5LDDC 1MV5A 1O58A 2B4AA 4BX8A 4FHFA 3IO5A 3KT8A 1DJOA 1KKLA 2B5OA 4M37A 4WK2B 1P9LA 3SQLA 1I3NA 3PICA 4E6EA 3RSGA 4TROA 2XWBF 4PS1A 3OY2A 3E81A 4P84A 5TEWA 1R6AA 1YDEA 521PA 4C29A 4EG6A 3JAMA 1HFJA 3AV3A 1GN8A 2J3MA 4H4DA 2Q9UA 3ZNPA 1RE1A 2MTBA 3H1GA 4E7OA 5JQGA 1DWUA 3CWZA 2FKAA 4KO1S 3UK6A 1G5TA 3OX2A 3STUA 3GLQA 3URMA 3G23A 2QMOA 2O7SA 1RE0A 4FEEA 4GMXA 3ILYA 3AUYA 3FZNA 4MKZA 1RZUA 4Q7KA 2AS0A 1B8UA 2B3DA 4NK4A 4RJJA 5AM0A 4IIUA 3QNMA 4B83A 4D57A 2RD2A 2VUTA 4L4SA 4H0NA 3SYTA 1Z6QA 2HNKA 3AIOA 3KV3O 5K3AA 2HDWA 1MN6A 4OU5A 1N7IA 4MHOA 2JFWA 3H9BA 4YUZA 1V1MB 4ALLA 2QQFA 3MJSA 3Q12A 4YUVA 2ATEA 3Q98A 1RHKA 4NMMA 1M8FA 4QUJA 4YAUA 4Z4IA 2PH3A 4TVKA 4MDHA 1WCV1 5MHTA 3G7UA 1A4IA 4AMVA 4DEVA 4W6ZA 3VSDA 5JCPA 3Q3EA 3IUBA 4H60A 4OL9A 3PT9A 5CEJA 2G36A 1UIMA 3RRFA 2XQJA 3GDOA 4F92B 2YFHA 5EXPA 4P36A 5EWMB 2Z2ZA 4IUCS 4C4YA 1JTEA 3A3NA 2HT6A 4LDQA 4MVJE 5CBKA 2HBZA 3GHHA 1KJYA 2V7UA 4IDOA 3ZK7A 2K7FA 3EDQA 3OE1A 1EFVB 1IY9A 1QG6A 3RQSA 1PFYA 3PNSA 1UOQA 1ZD2P 3OC6A 1R50A 4XE5A 1AGNA 1KJQA 1ZM7A 3KLBA 4OCZA 1Y6RA 2Q1XA 1SVLA 4L78A 4BN0A 2LDBA 2JLWA 1U0LA 2ZS7A 1ZD4A 3N7UA 1XMXA 3DZFA 5CXQA 1YNOA 5BR8B 5JSQA 3QEKA 3DV2A 3DKVA 3ESCA 5UKDA 1K6JA 3AOEC 3AR4A 3W6OA 4F3RA 2ZI7A 4Y67A 5BN1A 5KHLB 3D6AA 1OFTA 3VGJA 1RM4A 4HAWA 4WSOA 1T36B 1J2JA 2PV0A 3KOUA 3LPDA 4CQLA 1X38A 3OAAD 4M0MA 4KQGA 1ZNWA 3SJBA 2Q45A 3MLAA 3QYFA 2VTVA 3QITA 1R9GA 2NU9A 1GAQA 4O33A 4XIGS 4DLTA 5CD1A 1Z33A 3U3ZA 1R88A 2BELA 3GDWA 3BZWA 3L7KA 2W2TA 1AKQA 4UEJA 1U2PA 3UW3A 2GFQA 3C8UA 2O3TA 4P7JA 4LTNA 2XNJA 3LO8A 1EHIA 1X7ZB 2I4LA 5E6RB 4U7DA 5A5FA 3KQUA 3A58B 4CGYA 3BH6A 5A0TA 1YQEA 3TQFA 2EWWA 1KI2A 5AYVA 3VOTA 3EZXA 4WJZA 5L3SB 3QLVC 3MG9A 5M5BA 1CXZA 2GTIA 2JLZA 3W4IA 3IP9A 2H48A 3HEMA 5EMLA 4BNYA 3AJEA 3AL2A 2BFEA 3BMQA 3QSGA 2PGIA 2QAIA 5FBKA 2OKGA 3BXFA 2NAPA 1GPAA 1FIUA 4HYQA 2C59A 3H17A 2Q5HA 3O75A 2EYUA 1Z5WA 1KARA 4B3FX 2QG9A 3AXSA 1O96B 1DKPA 3JSAA 3MMPA 5FBZA 2Z95A 3PHGA 4MLCA 1T26A 2OQVA 3KXPA 3HXOA 3VKVA 1B3BA 3IUPA 1GA4A 3Q10A 4ZC1A 2DBRA 3CLRD 3WFZA 5K0EA 1IN4A 5IPFA 4JMPA 3ANNA 1GPUA 2P9GA 4PICA 3TNDA 2MWMA 5EI5A 3QPAA 1YR2A 5H81A 1JLLA 4AP5A 1M0EA 1M2JA 3DUWA 1LW6E 4LXHA 1DQNA 5GONF 2WJGA 4P93A 1GTRA 2F00A 4RELA 3TW6A 3FGPA 4OMCA 4MYDA 1Z4OA 3CT4A 3AV0B 3B1FA 3NHLA 5FWYA 1L7BA 3H19A 5KWIA 3RU9A 2NSYA 4WDRA 1O6BA 1SVOA 2C2ZA 3OCYA 4O8ZA 3EMKA 4OJYA 1LB1B 4AQYB 2WZQA 5AJZA 1DZIA 2EL7A 1OAKA 1LVUA 4JBNA 1DXYA 1X9HA 3ZWDA 4HRAA 3MTQA 2HA0A 1WG8A 3H5AA 2DFPA 3THRA 4EL5A 4OO3A 1WHSA 2VF8A 4RIEA 3VAZA 1JEQA 1MQ9A 1PV2A 2OESA 1G8SA 1Q84A 5JY6A 1EVEA 1SCQA 1O54A 3TZQA 5ALRA 5IVPA 2WF7A 3R3VA 3RHFA 5I7HA 2OCYC 4MRSA 4MS4A 1I6LA 1I0IA 2XGMA 2YHSA 1ZC3A 3NNDA 3D3WA 4XIJA 4HUQA 2E89A 2JFBA 2JRLA 3C6XA 3DZKA 3NIGB 2D8MA 3QKRB 4MR7A 4MK4A 5BSHA 5H9VA 1BFDA 1VMDA 1WHTB 3L8YA 1VDZA 5FQOA 2VYND 2WM2A 3QI2A 4CIAA 2JC3A 2EV9A 5BNFA 5DKFA 4DC0A 4R69A 2ZKIA 1ZM9A 1S2LA 3RRNA 1GQQA 2JARA 3CBGA 1YDGA 2QZJA 4QUKA 3N2EA 4C3UA 2NO5A 3WBFA 1PJBA 5CA0A 5HK9A 3I01A 1L5FA 4DXHA 5CIWA 2XYVA 3IVRA 1IY0A 3KALA 4JX8A 1Z6TA 2CFTA 2QN2A 2VUIB 4IEIA 5IUKC 4MRPA 3MCAA 1BW9A 1YH3A 1YZNA 2A9PA 3KJGA 3TW8B 1TC2A 1LA2A 2BE9A 4WXEA 2ROQA 3HI4A 3OLCX 4FFSA 5K4AA 2M2IA 2OZVA 1JMKC 3EUAA 3K7EA 3FI9A 2Q8QA 1FFYA 3MT7A 3JZMA 5HRCA 4FOTA 1Q12A 2HOQA 1DC6A 2MSCB 4DADA 1JG1A 4YMGA 2FN8A 4MVJA 3FUUA 3DUFA 2VFAA 4N1AA 1TTTA 3QFHA 4QUHA 1M54A 1QHGA 2JAXA 1KYTA 3AB3A 4D6PA 1E2NA 3RAJA 3HCPA 4CJXA 5JZVA 2JHFA 2DT5A 1GPWB 2BRUA 2F48A 5AXDA 4W1QA 1TM7E 1XN4A 5CX1B 4XEHA 1YACA 3HR8A 1N9GB 3PQCA 1OBCA 5DBOA 4M9UA 1G18A 4FT4A 1HFKA 3SVLA 2HA4A 2VQDA 4KSYA 1IBKB 4M1WA 5TDHA 4XOIA 3TDMA 4XSGA 2P2DA 1G9XA 3KQMA 3O26A 1SWVA 1OH5A 5TV2A 4PLZA 4ECAA 2G76A 1WTAA 3QA9A 3MAJA 2C88A 4PWYA 4U6QA 3N53A 3ZCPA 1PT8A 2I6QA 3AH8A 3KOMA 1ECBA 1VCNA 3RCBA 4BO1A 1HYEA 2JFOA 2FFHA 4LW8A 3V34A 3PPYA 2IYYA 1BX3A 5CCDA 3K9FC 2WG2A 4IQ4A 2FGKA 1MBZA 3C39A 4PQRA 3VPCA 1W4CA 1E2JA 3AEKB 4Q00A 5T3UA 5HBGA 4C0QC 3IPLA 3W5JA 1FZQA 2GB4A 2HQSA 5CLQA 5AK3A 5AKLA 4BB9A 2VPXA 5B1SA 4D8XA 1R0KA 2GCNA 3M5CA 1FDIA