4RH0A

Spore photoproduct lyase c140a/s76c mutant with bound adomet
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
340
structure length
340
Chain Sequence
b'KPFVPKLVYFEPEALSYPLGKELYEKFTQMGIKIRETTSHNQVRGIPGETELARYRNAKSTLVVGVRRTLKFDSCKPSAEYAIPLATGCMGHCHYCYLQTTLGSKPYIRVYVNLDDIFAQAQKYINERAPEITRFEAAATSDIVGIDHLTHSLKKAIEFIGATDYGRLRFVTKYEHVDHLLDARHNGKTRFRFSINSRYVINHFEPGTSSFDGRLAAARKVAGAGYKLGFVVAPIYRHEGWERGYFELFQELARQLEGMDLSDLTFELIQHRFTKPAKRVIEQRYPKTRLDLDETKRKYKWGRYGIGKYVYRDEEAKELEDTMRRYIEQFFPGAYVQYFT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spore photoproduct lyase
publication title Rescuing DNA repair activity by rewiring the H-atom transfer pathway in the radical SAM enzyme, spore photoproduct lyase.
pubmed doi rcsb
source organism Geobacillus thermodenitrificans ng80-2
molecule tags Lyase
total genus 128
structure length 340
sequence length 340
ec nomenclature ec 4.1.99.14: Spore photoproduct lyase.
pdb deposition date 2014-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rh0A01
3.80.30.30 Alpha Beta Alpha-Beta Horseshoe pyruvate-formate lyase- activating enzyme pyruvate-formate lyase- activating enzyme 4rh0A02
4FHGA 4K9RA 4RH1A 4FHDA 4RH0A 4FHFA 4FHEA 4FHCA
chains in the Genus database with same CATH superfamily
4A5OA 1CBUA 1F0YA 1G8FA 3ACCA 3JYNA 3MJCA 3W7AA 9LDBA 3EWSA 3Q3CA 4I4TA 1MO4A 3AX6A 2PZKA 1AUQA 3DOOA 1VE9A 2J67A 4ZPXA 3V2GA 3ZQKA 4YBZA 2CVZA 1Q22A 4MUEA 2G1JA 1J2TA 4LC1A 3UFBA 4URYR 4ZYUA 1GFSA 1NHWA 1UFRA 5CCXA 4MQ5A 3O3MB 4BMCA 2QU8A 1XZIA 2GVNA 1PQ4A 2H4FA 1XGKA 3I2JA 3BHMA 4EPYA 3FMVA 1I4OA 2A33A 2CJWA 4MR9B 5ADWA 1D4OA 5KNBA 5C7IO 5CPFA 3BL5A 1UJMA 3KD2A 1SCKA 1B6RA 1TVCA 4RPGA 3VPXA 1SHKA 3QF7A 4YJ3A 1IOVA 1Z34A 1BJKA 1OMOA 4EY7A 4ALLA 1D09A 2VLIA 2NVUA 4NDAA 5D5QA 4ZI7B 1ZESA 4MQEA 3JARB 2ETXA 4Z4HA 4RSMA 3WRVA 3G3EA 1A72A 4Q4DA 3ND7A 4MTLA 4QTZA 5IS2A 3L1HA 1VHWA 1C14A 4IJ5A 4Q5IA 4MGHA 3OT5A 4DCNA 1JDTA 5BORA 4EJ2A 4Q7KA 4GFDA 2EFJA 3M4JA 2W6JA 1HGXA 3K94A 3MD9A 1B0UA 1MO5A 1R16A 4FOSA 4ZCPA 1P5ZB 2FSSA 3OOEA 4V39A 3PL1A 2B1IA 3VV2A 1M5RA 1E9DA 1MOQA 4QU5A 4V0SA 3HXLA 1X19A 4X7PA 5AKHA 3UANA 3WLKX 2PUGA 1MC8A 1M2OA 2J48A 1BDHA 1W87A 4ODIA 4X6YA 4TL9A 4LHVA 2DUJA 4CUKA 1ZJWA 2PUTA 5A2QA 4IDOA 1YXMA 3VTFA 1AUOA 1XB2A 1AH2A 4EG8A 2DULA 2FPGA 5FOXA 2PZGA 4ZCIA 2CE2X 1BXGB 1L7OA 3E9RA 4JGGA 4N3GA 1C3EA 5CM2Z 3HCDA 1NV8A 5BPHA 2X14A 3CINA 1LUAA 2I99A 1K6IA 1RYEA 1BD3A 1GGKA 2UYGA 2OCKA 1XDZA 4LN1A 4Y2SA 4BGEA 3NU1A 4EW6A 2GTPA 1Y5MA 2PD3A 1UXJA 2ILTA 1NXTA 3PQDA 2G77B 4JUBA 4Y2XA 5D85A 3T5PA 2GYUA 3ANYB 1K4KA 2A9JA 5K4AA 1Q7BA 1T43A 2O1EA 3Q3JB 4B45A 5J23A 3MJ4A 4FM9A 2VBGA 5TEVA 2RGDA 4O4IF 4QPPA 2DERA 5B58C 1ZM7A 2HEGA 1QO7A 4ZAXA 3R0XA 5ESXA 4EEKA 3OTOB 4NBVA 4QAJA 4WZAB 4A0HA 4CCAA 2O0LA 5IW8A 2YUTA 2VHJA 2ZRQA 5DGIA 2IRWA 4ASUD 4ZYYA 1YCFA 2WBLC 4EGSA 1CUHA 1O03A 1OBHA 2QSYA 4HUQA 3I01A 4HADA 1IM2A 1T5LA 2XBLA 1JYEA 2ZOSA 3A1UA 3I2GA 3KP1A 3PI7A 3QZUA 4UUBA 4X24A 3ND9A 2EWWA 3ZTWA 2DWQA 2MHCA 3RG8A 5JAUA 1VECA 1GIAA 4DYDA 5JI3E 1J8MF 3SXJA 1GPMA 1R0WA 2JIZA 2J0VA 3KTFA 1VKJA 4TYMA 1MAHA 2YV2A 4RZQA 3MTIA 4UW9A 5JZOA 1XDWA 2C2WA 3B48A 3WLFA 4FWTA 3KOMA 3TLAA 1NATA 2FSGA 3TVDA 1N0VC 1P1IA 3DCNA 2R8RA 4XYGA 1IN4A 1WBDA 1A4RA 1ZNWA 4ENQA 3DQQA 3ELYA 3PYXA 1DGQA 4HXEB 3IT0A 3RU9A 4AO6A 3ICEA 3AH8A 4UUAA 1OFUX 1R0SA 2R6DA 3L7LA 4FLMA 1ZVQA 4INJA 2QNRA 2WQZA 2A7XA 2QA5A 4K28A 2AFRA 1DELA 2Z08A 3Q3GE 3EEFA 3JQFC 4JFAA 1RRCA 1J8QA 3DKVA 3DBHB 4RLSA 1TZKA 3D43A 3D7NA 4MWSA 4DSUA 3QKTA 2GBLA 4R8VA 3N3BC 1KAHA 4NZNA 4BHTA 4X8HA 2VJBA 5DHUA 5E4YA 4PR3A 2P4UA 1NJ5A 1MAAA 4FMCF 4MRSA 1EVLA 2ANCA 5ERXA 1V3QE 1X1QA 1DWPA 1U8XX 2QD3A 3MMXA 4O33A 1E89A 1R8YA 1ZLYA 3L2OB 1ZUNA 2PSFA 3GGJA 3V9AA 5DN6A 5ECDA 3WADA 1RP1A 1M7GA 2FEAA 1UMBB 2O1XA 2QT0A 3DPUA 4HAWA 3FLAA 1TVKA 4IUYA 3M3DA 1XMVA 4BL5A 3JQGA 4D2IA 1FLAA 1JVBA 4P4SB 2CHQA 2QMHA 4ZCSA 1D6JA 4BGVA 3N8GA 2OXIA 3TIGA 1T2EA 4BNTA 4TKZA 3GJSA 3P0FA 2Q49A 4J0IA 3IKMB 2Z2IA 2IWHA 5I9IA 4KKVA 2I6TA 2DFVA 2QLBA 4LSZA 1VL2A 4IDDA 4R98A 1YRHA 4TV9B 3PJFA 5ER6A 1KU0A 2X3UA 3EVNA 2YHBA 1K89A 3CLSD 2HSWA 3L3BA 1M2EA 5D87A 4R2JA 1JIIA 2Q2WA 2WIGA 1XCOA 3LT5A 3NOQA 2D59A 5TGDA 2PVCA 4RFSB 3ZWDA 5IJ9A 4LV6A 1QZ3A 3WLLA 1ODFA 2QQGA 3HP4A 1HFJA 1LLFA 4JBNA 5FIUA 4FDUA 3WSWA 5HS4A 1DBIA 1SG9A 3OP4A 4AY6A 2BBSA 3L82B 4PN3A 3W0LB 2PGDA 1V9SA 2A3RA 2OXTA 4BMZA 5HP4A 1VHTA 2C2YA 2JZCA 2QUZA 2HWYA 4YFVA 5JD3A 1LF0A 5IMSA 2JEOA 5LD2C 7AT1A 2IC5A 2XCSB 2XDQB 3T06B 1C3VA 2OXFA 1YHZA 2BFWA 4NYJQ 2PGXA 2YXLA 3B5JA 3CSSA 4Q1AA 2ATCA 2WLSA 4UU7A 3OO1A 2CXUA 3JRWA 1P3DA 2REQA 3NRBA 4UHDA 3QV1A 4C30A 2ZANA 4Q9JA 5FDFA 1ZKDA 1LSJA 3HVKA 3ISJA 3PQ8A 2WT8A 3MXOA 4H3KB 3B6JA 4CIAA 2B3DA 2DT5A 4EUFA 4PV7A 2E2WA 1KAMA 5DM2A 2Z9BA 1XMOB 1G38A 1TFUA 1EVEA 1SHZA 1JSRA 1R12A 3E7XA 1IHYA 1QG2A 3ETNA 5JYBA 3CHYA 3X1KA 4YMHA 4X8MA 2R8ZA 4E2YA 1GU0A 2AC7A 2GLUA 3JYHA 4GYWA 1SAYA 3CRQA 4J1SA 4D7AA 1IU9A 4EK9A 5KJCA 3LYUA 4MVXA 2R4UA 3V1NA 2FN7A 4NBUA 2QTVB 3ZKWA 1WKCA 5JAPA 3LLVA 2ODQA 3C97A 3LQQA 2BEUB 3MRXA 5BUZA 2GESA 1SUAA 1W1IA 2R6CA 3KCQA 3SR4A 2VIIA 2YNMA 3AIMA 4BRZA 8OHMA 4FYWA 4NAUA 4TMWA 4OXRA 1UJCA 2AG6A 4YPVA 4ZJZA 2I66A 2XVYA 3NHMA 2IUTA 4GX1A 3QHAA 3U3RA 2MR5A 2GS9A 1N33B 3BJMA 4X3OA 5F23A 3LKBA 2JLBA 2WKQA 1V0JA 4Q03A 4TKVA 4DQVA 4WRRA 1MEEA 1WETA 5CXQA 5JWOA 3D6MA 4PLTA 4OH1A 2GZRA 3AQ4A 3FZQA 3HDGA 1CNFA 1D4ZA 4UBOA 2GXSA 3VOTA 4EHDA 1MO3A 1G42A 5DHAA 3RTDA 3WIUA 4IDCA 3DV0B 3L7OA 4RGQA 5LYJB 2QZZA 3LBYA 4BO7A 1EE9A 3GGPA 4AX8A 1Q83A 3U31A 3W4JA 2ZAGA 4DEXA 5J59A 1FQWA 1JU4A 1DCKA 1RRGA 2B94A 2BI8A 4KR0A 3CN7A 2CB9A 2BZ0A 4ER3A 4GUDA 4IXDA 2H6EA 9GPBA 3I42A 2IHJA 2XD9A 4R8MA 1OH8A 2XQFA 1WQ1R 2J3EA 5EIOA 2PWAA 1ADYA 1P6QA 1RWNA 4MDYA 3FX2A 5JAQA 3HBLA 2Q1XA 4MR7A 5EMLA 5KAPA 2P7HA 1K5GA 3HVUA 4WBNB 4RJIA 2BPOA 4P7KA 4YXWA 4OA8A 4CLHA 4ENRA 1DHRA 2NADA 5L3SA 4LDZA 1QX4A 1AT1A 2B7LA 2UUPA 1M2VB 3U7IA 2FLWA 1T29A 1U0JA 1H8EA 1REQA 3GUYA 2JFVA 2C77A 3EAQA 4NEHB 2Y71A 3AXSA 3TB6A 5KHLB 3PC8C 4KYIB 2HRZA 3H1FA 1KL7A 1M2KA 4KGXA 3PHBE 2A35A 1MDFA 3DZIA 5SY4A 5HJ2A 3H4TA 2FE1A 5IT9A 4HAVA 1TFRA 2IHTA 3BKXA 4Y7DA 3ZTTA 4BO0A 4ZYVA 2DTXA 2HA2A 5FBKA 4EHHA 4KQ1A 3BGOS 3DFZA 4OREX 1X77A 4R16A 4EF5A 1NFQA 2PANA 5IF9A 1NXSA 3RIMA 1HE1C 3EZ9A 1JWBB 3UJ3X 3ETGA 5EE1A 1ZK2A 4KH1A 2Z4RA 1TD9A 5KJ1A 3GRFA 4EG3A 2HA3A 4E7OA 4C89A 3P9XA 3TRFA 1T5SA 1KYTA 2DCUA 3HEMA 1JB9A 2BFOA 4Q9DA 3T35A 4XGKA 3T5CA 2FDCA 1BVYF 2CDAA 4B8WA 3KOWA 4LK2A 1ML3A 1AG9A 3E1SA 3OBBA 3INYA 4G5FA 1U04A 5DNVA 2CK3A 4ZO4A 5F7JA 4LRWA 4IVRA 2FZ5A 3RHZA 1ILEA 2OCDA 1A9QA 1M1YB 2BJWA 1I2MA 1M8JA 3BIJA 1F8UA 5BN5B 3AVYA 5DWQA 3JYPA 4DSZA 4Z4IA 4HTFA 3FYDA 1YZVA 4BNXA 3DONA 2NXJA 4N7RA 5JXWA 4IBOA 4PPGA 5K3EA 1SUFA 3KVOA 4RA6B 4FHGA 4PTYA 5C5IA 4XQ0A 3G0HA 2W2VA 3RS2A 1JG3A 1S02A 1L5FA 2DAPA 1R9NA 3ECCA 2ERYA 2FZWA 1RPJA 2GASA 2JLCA 5GJWC 4PFQA 3VVCA 2HQRA 1RZRD 3RRNA 2V6FA 2Y6VA 1J07A 1OX6A 5KTRA 3NDPA 3NUQA 3QHQA 2VTBA 4RD3A 4FGZA 4NZZA 3IQFA 4BQIA 1Y0BA 1G6OA 2BFDB 1J8YF 1HORA 2W2NA 5DTRA 4MRNA 4DADA 1WOYA 2JDID 4MINA 2V0CA 3COSA 2D0DA 1ISFA 4C4ZA 2VZLA 4KBYA 2ZPTX 3E9YA 2G5GX 3E22A 4UM9D 3JYOA 4BE4A 2GXAA 1XNQB 3DAPA 2AMJA 2PT5A 1A95A 2XT6A 3HI4A 4NOJA 4QPZA 1TF5A 3CLUC 3UGTA 4JS0A 2ZDGA 4MI3A 3HZHA 1Z75A 2GDZA 3O26A 2BP7B 5F1YA 2ZVPX 2ZUFA 3L7MA 4N7MA 4Z1MA 3AL2A 2WIJA 4YP1A 1ABBA 3O4GA 1ZAKA 1F8XA 1TKAA 2OHOA 4U00A 4YRIA 2PLWA 1OLTA 4QTUB 3IXMA 1R8QA 3ELBA 1PJQA 3G02A 5LMNB 4R0VA 3THWA 1VCIA 2Q7OE 3B8HA 3VZCA 4IGEA 2GTHA 3I1FA 3HKEB 1HE8B 2VI5A 3MS2A 4LVOA 4NMWA 4RHXA 3U6BA 1Y8RA 2JBAB 5I48A 4LNUB 4P53A 4JOQA 4LMPA 4E22A 5AH0A 1GPUA 3IQXA 4L08A 3JWJA 2LR0A 1DUVG 2NWQA 4YRQA 2P9ZA 3G0CA 4G5YA 5B6IA 2QPOA 3NWPA 5H4HA 3THYB 2G25A 1DAGA 2EF0A 2O5RA 2Q5LA 3N0XA 4Q3AA 4X5OA 2G36A 4YV2A 2A9FA 3ZU4A 4KG7A 4S1TA 3ZKAA 3ZCRA 1F20A 1VB5A 4PIPA 5FWXB 2FHSA 4HF7A 5IAOA 3GLVA 3T4EA 3OJWA 1O7JA 2O3RA 4Q7EA 4W99A 2A9KA 2ACVA 1X9GA 3PIRA 5EJAA 1GDDA 3HV0A 1FJ2A 5J4HA 4PFSA 3MCTA 3B60A 2DEUA 1A8UA 1QMGA 2WFMA 3K05A 3JQ8B 2ZRMA 3WR5A 1PT7A 3QG5A 5F4ZA 1BG6A 2C03A 1YVRA 1GTZA 1Y9DA 2R8EA 2APJA 3PF8A 4YO8A 4YJKA 1ISRA 3ERCA 1LFAA 1VSTA 3H2BA 3Q41A 3VH2A 1E1RD 2WF7A 3D3WB 2WYWA 3TZLA 2WR8A 2X2OA 4PSAA 3H87A 1UAAA 1NT2A 1CB7A 4IJKA 1RXIA 5B2ZA 1URPA 1XK7A 1CB0A 1DT5A 1NBMD 4KMSA 2FPMA 4LKRA 1TMKA 1ODCA 3QLVC 1EM6A 2JAHA 2VO1A 2SECE 4AW9A 2Q5FA 2ZFUA 4YJ2A 3FY4A 1T91A 3RUHA 4RLHA 2PRZA 4PQYA 5KYUB 2FPPA 4O8ZA 1GQYA 5FYDA 4WAUA 1LTHR 3QBDA 4P8RA 5B1IA 3Q15C 4CMKA 1F17A 4S12A 3QITA 1K8QA 1U3DA 1NFRA 5LUBA 1UDAA 1I2CA 4PHFA 3FUWA 2W98A 3O8OB 4I1YA 1L1RA 3Q4GA 4Q9HA 1N2JA 5C80A 3FDZA 3IULA 2F48A 4YWHA 5AW2A 1QAOA 4AZ0A 4C7KA 4Z4FA 3I9FA 3GJZA 3PCXA 2WJPA 1NVGA 4KLAA 1S01A 3Q40A 1Y8QA 3BXPA 3EXHC 4R31A 5EI5A 3U9SA 3CLHA 3EDCA 5SYNA 4CG0A 6REQB 1MFPA 3PE6A 4DR6B 4PAOA 5HM6A 4OQ4A 5CGZA 3O9MA 8ADHA 4Q01A 2E4ZA 3PE3A 4BE7B 1N57A 2QR2A 2PSJA 1H0RA 3SEZA 4PYIA 1G5PA 4BRSA 4DXDA 1N2CA 2VP5A 4L6CA 3L8EA 4PM4A 5AJUA 3HJHA 1GA4A 1ZCBA 1IQUA 3ZS9A 2HBQA 1JDSA 4AKHA 1ZA2A 4ZV4A 1M5TA 1P80A 4NH0A 3EGIA 3I5XA 3QIAA 3UJ9A 4YX9A 1AZLA 1YDFA 1L7QA 3Q7QA 2VF2A 2W5UA 1E4VA 5JZBA 3Q1LA 4LVUA 4UMFA 1D1QA 1QYCA 3AETA 4U2GA 1NMXA 3L84A 1ARZA 3VBEA 4PSVA 4EEZA 4MV7A 3KSBC 1HEYA 1XCGB 3QYJA 4WK4B 1T6XA 1H8HD 1DO0A 2YHIB 3NHZA 2PQ6A 1XRQA 2Q8PA 2PXCA 4OQXA 1J99A 4FFMA 1OREA 1YZNA 3AEKA 3KDPA 4HKTA 1NYQA 4NMXB 4R3UC 1MLDA 1TJ3A 4MQFA 1S7CA 4BO5A 4C6TB 4YRKA 2Z2YA 3AEYA 2FU5C 3H4IA 4Q7MB 4L75A 3NIGB 3R9XB 3HJBA 4KN6A 3FZNA 2GFIA 3PFFA 4W6QA 4CKBA 1WXIA 3BEOA 4IKPA 2C5FA 4EVRA 1EVIA 2P5SA 4GYKA 5DM70 2AEEA 4GOXA 1E9BA 1UWLA 1ITZA 1OU0A 2PX0A 3DHWC 4OK3A 1RKVA 2JCYA 3M4XA 8ABPA 3I8OA 3TO5A 1NUTA 4C7XA 2ISCA 1SQ0A 4N12A 1BE0A 2OBXA 4YASA 4L85A 4RVCA 4FS8A 3W3AD 2Q0QA 1A8IA 1WDWB 4YT5A 1Q7EA 2VRCD 1NQTA 1Z08A 3EQ2A 3DE1X 3M6UA 3NBKA 4TSFD 5CJJA 5DCUA 1XVTA 2ZSHA 5EIBC 3I45A 3H6KA 4YC7A 4B3XA 4M9QA 4C21A 5LQSA 1ESMA 3N0TA 2HW8A 1R10A 2BGMA 4OYLA 4G0ZA 1PFYA 1Z7GA 1NPTO 1V1RB 1RLUA 2JJ8A 2XEXA 3DM5A 3GIDA 4JL8A 1OHHA 4N9QA 4RW0A 2NU8A 2AZ4A 4I5IA 2JI9A 2XUZA 2P2CA 3IP3A 1XJ0A 4OKIA 4S1WA 3PXGA 2ZTMA 6NULA 4MKGA 4R81A 4FI3C 4E15A 5IBCA 4LZLA 5ABPA 2VWHA 4EPVA 1J70A 1I3MA 4PRYA 5JTUA 2H48A 4BNHA 1KOGA 1YMVA 3LY9A 1HNZB 1N6RA 2VPZA 1MJ5A 3C7DB 3CLKA 3R77A 1LJ8A 4IHQA 2ZJ0A 4QU8A 3P9CA 3BE6A 3C70A 3QPCA 3AJ9A 2JGDA 5ALDA 2INGX 1FE8A 2ZU6A 2QVYX 1MENA 1U8CB 1YOVA 2LCFA 3X2EA 2AVNA 3CZCA 1X1CA 5CK5A 4Y2RA 3RUDA 4D99A 4B44A 4CG3A 1R6XA 3OTIA 5BW6B 4E21A 3PKJA 1N9ZA 3PGMA 4RTLA 3LLMA 1CP3A 1BU5A 1G7TA 2XNHA 2QW8A 4LY0A 2X23A 2AWNA 2CNWA 4HN4B 1U9IC 2F7SA 4K9KA 5LP6C 1GPWB 2BGRA 3O3NB 4INOA 1TE2A 3NHAA 4QKQA 5L51A 3U80A 1MR3F 5IXSA 1R9GA 1MORA 2H1IA 3PNLA 4OK6A 3W8EA 4CI9A 3OQ6A 1ZHHA 2I4LA 3H0EA 4K8OA 1EUDB 1CZKA 3JTEA 4AX4A 2IBSA 3EGXB 3P2OA 4F11A 2P6RA 2V7TA 2YR0A 1SU4A 4EZEA 3LUFA 3I1YA 5LQAA 5L95A 2HMTA 4GMGA 5LZ8A 4FXOA 4QNRA 3UUEA 3ZHYA 1KS2A 3TAXA 2HGSA 1C1DB 3EDRA 1M2NA 3NAZA 3E1GA 4D3DA 1BH2A 1RBQA 1TK9A 2VJMA 4TUYB 4B8YA 5BNIA 1YMQA 3DMHA 4GI5A 1NXVA 2OXRA 1W6RA 5DASA 4A1OA 4CU2A 3PP8A 5IX8A 1TTTA 3KWFA 2QJOA 3NPAA 3ZWXA 4RPHA 2Q4BA 1B2RA 1WMAA 2QPLA 2XTMA 3P2JA 2NAFA 2ROQA 4YUWA 4H31A 4C6RA 4P4LA 4LZWA 4P38A 5JAHA 4B3JA 3HO6A 3JZAA 4L57A 5FAXA 3INRA 5AW7A 1VYHA 2D1RA 3GFQA 4C08A 4GLOA 2QRLA 3C5WP 3OC0A 3WK9A 1VXRA 2PXAA 4GLFA 3ZCPA 1W34A 2ZIAA 3TIVA 4TM8A 1I7LA 1LF5A 2XRYA 3DBLB 2FRVA 4N5NA 3I5YA 1NDQA 1YE8A 3F4LA 5FI5A 2FTKE 1CG6A 1N1DA 4O4HF 4JUFA 4IHJB 3G88A 1B0ZA 4W9NC 3CGGA 4U9HS 3C3XA 3FI9A 4RADA 2O05A 5ILOA 2P6MA 1LBTA 2BMFA 4NJMA 4NPCA 3UG7A 5JCPA 4XA8A 1P39A 1O4VA 3FKSD 3HMQA 2EKZA 3MWLA 1NBIA 2OTCA 3HJCA 3KQHA 4M36A 1OA0A 1OWMA 4YAKA 1WCIA 1EA5A 1HY3A 3AHFA 3A1NA 5FLYA 3GRRA 3K5WA 3RIHA 3RSLA 2IH2A 4MVCA 5KNDD 5DTEA 1U8UA 3RS3A 1Q1AA 3TGLA 4RQUA 3HM9A 2GCIA 2IXGA 1VIDA 5HF9A 3QKUA 1RYYA 5GGYA 3KEQA 2I4OA 2BBWA 4W8GA 5GOZA 3NETA 4DCPA 3IIKA 4L51A 5IANA 5CAEB 2Q6LA 4P32A 4UDOA 1O0BA 3AV0B 4R9UC 3EXEB 3W5SA 1T4DA 1XAJA 3TNLA 5K0TA 1RQRA 1KVTA 5GM1A 1L3IA 5B55A 1N3YA 3LS2A 2ZLBA 2PIDA 3HKDB 3M1LA 2JLAA 2WD7A 3L6CA 4ND5A 4DMLA 2FWRA 4HMPA 1YB6A 2WD8A 3FSJX 1AF4A 1ZEJA 2VTVA 1T6BY 1SVIA 3QVSA 2BRUC 3TN7A 5JO0A 4LBZA 2QYOA 3GUCA 3L49A 5CPBA 4BVKA 4G5QA 4YAJA 5JSFA 3UAVA 1KVRA 4J2OA 1VI5A 3PPXA 4EW2A 1JEEA 3FHOA 3PC4A 2PT7A 5CDSA 2VRWA 1SELA 1FYFA 1XD2B 4I4CA 3P45A 4WLNA 1E63A 1V41E 2OEPA 5I51A 3JQBC 3ZWBA 3I72A 1UMKA 3IPLA 3UUWA 2IVFA 3GBVA 5BNZA 1MXHA 3IUSA 3NBZC 4YT2A 1D2CA 2JF0A 3N59A 4GPEA 3T0GA 1F06A 5CEEA 3BWEA 1RRFA 5KJ6A 2ZR9A 5HTOA 4CLXA 3HR8A 1HDXA 4C14A 3PNQA 3I4LA 2PSHA 4CFZA 3I3SR 3MCWA 2JCVA 5G4KB 3UWMA 2CUZA 2P4SA 4ZT3A 4IL5A 4KPUA 4QDUA 3ELUA 4E03A 2VRNA 3U3MA 1KRHA 1QKKA 1NW5A 1FNCA 3PDJA 5DTQA 1UEIA 5JRDS 3DUFA 1Q3TA 1SVUA 3PUXA 3WICA 2M1ZA 1JMKC 2PZEA 4MHOA 2FR8C 1EX6A 3L43A 2I7TA 1HZZA 4OAPA 5JJ5A 3OZRA 4QFDA 4QQKA 2ZATA 3P8ZA 2X9QA 3D6TB 5IARA 1E9SA 3D8TA 3JAWB 4HDNA 4MULA 4QD3A 2UV8A 4FDAA 3UZUA 4L4SA 4JKOA 3LHSA 4HY3A 4DCJA 4I66A 1PR2A 1OKKD 3IX7A 1H1LA 2C4UA 2XYQA 4M1TA 1QWOA 2E1RA 4YXFA 3C3MA 2BV3A 1SR8A 3CZ9A 3VR5D 3ZNOA 3NRCA 2HU7A 5JALA 4AT1A 2PT9A 4Q7QA 2QBYB 3A4MA 3IVGA 4L72A 1NRJB 1YR2A 3FWYA 5GONB 4EY6A 5HQTA 1Z63A 2J3MA 2Z95A 3AI3A 2I2BA 2FEWB 1TUBB 3WAKA 3KHKA 5A4KA 3AVXA 1RJEA 4EW3A 3MWEA 2I4IA 5H81A 4OBBA 1T4CB 3M5PA 4LQLA 3SYKA 3CUUA 3AHGA 3MMSA 4JEUA 1OCEA 2F3SA 4ASUA 2H11A 5AMXA 4N82A 2JJ2D 4QXQA 3TQRA 4DANA 1T3SA 3R44A 3EDQA 4WINA 1UWCA 3OKPA 4E30A 2FFBA 4XVUA 5EOVA 5KX5F 4DMUB 5K20A 4PGGA 4TM7A 3W9SA 5J47A 5A5VA 3HVRA 4KXLA 5GP1A 1EP1B 2XR1A 4WFIA 4JT2A 2GPBA 4F2GA 5AKLA 2XUDA 1PGJA 1DFHA 4YYEA 3R0IA 2CEAA 1V37A 4X1YA 1XF1A 3A11A 4XWWA 1W5SA 2GZMA 3IBYA 2Q5OA 3GPBA 3WSVA 4Q37A 1T8UA 1G2OA 2XA2A 3K0BA 1A5BB 1HDCA 2QAGC 1Z13A 4EFMA 5K2OA 4BFXA 3CJQA 4JI4B 1W4BA 4Y1FA 2DLCX 3CVYA 1W0CA 3DM9B 3WV5A 1KFCB 2CNNA 2VHXA 2ZJ4A 4GP7A 1LQ2A 1FU7A 1ZJJA 2C5BA 2G1UA 1FVOA 2HJWA 3DCYA 3ESDA 4OAOA 1AJEA 1DARA 3N7AA 3HYSA 3JWIA 3ZJYA 5BNWA 2XCLA 4FFRA 2W6NA 1EFTA 3A70A 3DKPA 4G25A 4O2AF 3SYMA 4YRDA 2NZYA 2R00C 1QGUA 2WTAA 4W82A 1HX7A 3KBOA 3RCBA 3GUVA 1C50A 5BY2A 3ZWVA 2YWXA 3RV3A 4QBFA 3SP1A 4KVZA 5M2QA 2VDOB 2IPAB 2HY7A 4AK9A 3H83A 4BIMA 4C0LA 3LOUA 3N86A 3JWHA 5L4SA 4QWMA 4P92A 4P5EA 4L3OA 3WGMA 4FGJA 1FTYA 5SZKB 3HWX1 4TXHA 1H5NA 4ZQCB 2B8NA 1GOTA 3UMVA 1S2DA 1QJCA 2OCAA 3L07A 3EXHB 4E1BA 1HLDA 2GM5A 3GJQA 3BBLA 2HB6A 2HBZA 5A9TA 1L7PA 3B13B 3KQVA 4A27A 1YF3A 4I50B 3DMTA 4V2IA 2Y92A 3VPGA 2GCEA 3B1WA 1K8RA 1LXCA 4HB0A 1NONA 2G63A 2FPWA 2OV1A 4J3FA 4U7GA 3GLGA 4PLCA 2ZK7A 3LJKA 3E3LA 5EUCA 5KX5A 4F9GA 1AGRA 3P9RA 3AEXA 3ZNPA 2FKNA 1AXGA 3QLTA 1TTQB 1WY5A 2W7TA 3OFND 3BZBA 3H13A 4A0QA 3BB1A 4V0MA 4YLYA 5KTOA 2EG9A 5LNK6 4JA2A 4RHTA 3UGJA 3L8HA 3NM6B 2MSDB 5AVJA 5HX7A 1GPBA 3FLEA 3PQ5A 5AJZA 1P6XA 1V3TA 4OXKA 1VYVA 2R66A 3G82C 2FAXA 4Q24A 4UDYX 3VRHA 1Z8NA 3WBFA 5KSOA 3ZGZA 2M2IA 3DD5A 3DHYA 5DU2A 1M33A 3NM5A 3RJ9A 2DKOA 5FPPA 2B4QA 2QN8A 2VA8A 1YJXA 4NCAA 3HS3A 1DMRA 1U8ZA 2CHGA 2PUWA 1RJGA 2N1MA 3ILHA 3MPOA 4Q3LA 3O4IA 2RGGA 3LCRA 3ZE9A 1IBLB 3R7WA 1R6TA 2HPZA 4QOIA 4UEQA 3BK7A 1KC1A 5GQSA 4CM4A 1GG5A 2AT1A 4O2AA 2QQ5A 1H2WA 3G5UA 3ZHUA 1VPDA 1HQCA 3N2KA 2FQWA 4QGGA 3RW9A 3EVTA 5ALEA 3V5NA 1KFEB 2ODTX 2QP4A 4UTRA 2Y1FA 3SSAA 1KH2A 3F8TA 5CG1A 1UDWA 2PSEA 5KSZA 4U2FA 5G02A 4AF6A 1CJCA 5KOYA 2HV8A 2UDPA 3EPPA 1LH0A 3JXEA 1NFFA 3PT9A 3SJCA 2IJGX 2A4KA 1NX9A 3EEQA 1KERA 4MGIR 1XTRA 4RZUA 2PV7A 4XSHA 3TOVA 5CLQA 1NI4B 3W6UA 4DA0A 5IH7A 3GPDG 1P60A 1RQNA 1DIOB 1ZCAA 1HRDA 1EZ4A 2QRVB 3EGEA 4GSLA 4LJ7A 1XYVA 4JD5A 4R1MA 3BBPA 4DR7B 4HI0E 4X6LA 3EEOA 2B35A 1S8NA 1YL7A 2AR9A 4N6OA 2FW0A 3EA4A 3OECA 5HDBB 1SO8A 1AHNA 1CP2A 3PNKA 4MI6A 2H00A 3LK6A 2I54A 3RGGA 1F60A 1Q17A 1T9AA 2YFQA 3Q7IA 4MW7A 1TQHA 1V4NA 1XVLA 2Q3LA 3K2BA 3KTOA 3HZZA 4U2EA 1GO2A 1CC1S 1GEGA 3FOFC 2C92A 2V7UA 1U6JA 4MLDA 4BFCA 3KKKA 3S2FA 4D92A 1SBCA 2VYND 4KMRA 2BIFA 1ZGCA 3ELDA 3GLIE 4KAAA 1S2MA 3ZE2B 1SM4A 2BFEB 3KQKA 1GUZA 5ITZA 4KODA 3T52A 4AQDA 4F6RA 4IJMA 4JZKA 1Z15A 3TI7A 1ZOIA 3KPJA 3MT9A 4UM7A 4A36A 3LPLA 1N2XA 4EHKA 1X7DA 4OLAA 3A9RA 3DAGA 2ZRKA 1IONA 4OX9B 2Y68A 1B74A 2WWYA 3BWBA 1F0NA 2RMKA 3HKBA 4YMGA 4LNHA 3GN1A 3R6DA 4N41A 2JEZA 2JS7A 3W8NA 2P1ZA 4N7JA 4JDUA 3HTXA 1JPUA 4B2PA 4YDQA 5LP6B 3LUGA 1XPUA 4L16A 1T9ZA 1NLMA 3LA6A 3PUZA 2WF8A 4RC9A 1YB7A 4YMUA 4AI6A 3LRTA 1WMSA 4Q1CA 1QNLA 3TM4A 1II0A 1ZX1A 5FI3A 2IHNA 4P3OA 4C3UA 3BRSA 3MSCA 4KH0A 1CF2O 1X7YB 1JLRA 2DPGA 4YAEA 1MX1A 4B1FA 3OQMA 3DJYA 3PZRA 1GCOA 3GVPA 2V5UA 1NP6A 3KM0A 1L4KA 3FIUA 4GYJA 4ISCA 1XVIA 3GOHA 4OUDA 1GTSA 5FADA 1JN0A 3EIUA 1M6WA 4ZCMA 4JU9A 1ZXXA 3QMPA 3K9BA 4XM2A 3CTMA 1HG0A 1SVSA 2IFTA 3TXAA 4ALIA 1RWPA 3LHKA 1HTWA 3Q3VA 2WU8A 4DDMA 4W1RA 1JDUA 1DMSA 3NBFA 5IKPA 5FOSA 3FTFA 3I30X 1E2GA 1YFJA 1DBPA 2OHXA 4H1UA 1IQRA 4LJ5A 4TS4A 2Z8YA 1Q0SA 2FW7A 3A9CA 3GFTA 2DOKA 3O31A 2AG8A 2XE8A 2YASA 3HJRA 3IH5A 4OLJA 5CXUA 2C7QA 4RZXA 3LLSA 1HLPA 3LC7O 1NRWA 4X1IA 1OI2A 1ZD9A 1BFKA 4RSRA 3JALB 2OHGA 1CUXA 2PL5A 3DDWA 3GXBA 4M53A 4CCYA 2WPDD 1CETA 1G20E 5T8KC 3QSYA 2GCOB 5E7MA 5F1PA 3QFCA 5FO1A 3U49A 4V1CB 5MFZA 2K7ZA 3DAYA 4R8SA 1ZSNA 3B8EA 3ETLA 1ICEA 2Z5GA 1USKA 1WDTA 3MLBA 3DBVO 2EKLA 5AOCA 3BD6A 3A2KA 2Z58A 1U2ZA 2JGEA 5A04A 4XX0A 4NC9A 4KFRA 5LWQA 3KSZO 4IUDS 2O6HA 3CX4A 3LT4A 2XDAA 2XGSA 5JXJA 1QQAA 3HVIA 5J4VA 4L0CA 1RZRA 1T2AA 3LP8A 1ECPA 1M6HA 4L5IA 1A7AA 1KK0A 4B6OA 1H2ZA 1P19A 1E7RA 1GXSA 5J2TF 3IKJA 1TEXA 3L7JA 3QVUA 4WASA 5B36A 2Q6TA 2QV0A 1FNMA 1Z26A 2RCYA 2VWPA 3AUTA 3O8CA 2JDIA 3UATA 5TMPA 2VHWA 1GRVA 1L1FA 1CEQA 1TK2A 1YE3A 5JEEA 4Q6WA 5JNSA 1UBCA 1AQYA 2WOJA 4L1KA 1TC1A 4ZVVA 1Z6XA 3P5SA 3RS0A 3QKWA 1NUHA 1VMKA 4JJ8A 1ESZA 1B6TA 1VB3A 2XB4A 5KSYA 1YJBA 1KOJA 3NIDB 3SHOA 4K1XA 4MA0A 1SKBA 2W58A 4QPDA 2JLWA 1RI1A 1TVMA 3OFKA 4FR5A 5K45A 1AQJA 2O9JA 5CCEA 2HK6A 1DVRA 3IHWA 4AZSA 5DX8A 1RM0A 3FZYA 3ISTA 3QBVA 3UVEA 4Q3DA 4JLSA 4G5HA 1IZZA 1C7FA 1Y98A 2JHAA 3IOBA 3ZWWA 4A5SA 1WWKA 1NIPA 1Z17A 4QIHA 4D8VA 2FZCA 1G8PA 2UVPA 1A9XA 4WNAB 3IE0A 2CXTA 4XLZA 5IYZB 3WS7A 1ZUD1 5B6PA 3U48A 4CVNA 2RJ3A 2BY4A 3VH3A 9ATCA 2B98A 4UHBA 1L5QA 1U9ZA 3KXLA 3UJPA 2AZDA 3D2CA 4JK3A 5BUCA 3AERA 1QR6A 3PKIA 1J0DA 1DG3A 2ZAYA 3ANMA 1YQGA 3F4KA 2V7PA 4U8HA 2H31A 1PNQA 2OBMA 4U6SA 1I0LA 2NU9A 4RFLA 2WJYA 1UZUA 3BAZA 3IVMA 2CLMB 1FLNA 1SC3A 4M1SA 1MJGM 4DLVA 2Q1SA 1SH7A 4RTJA 4M0EA 4MVJE 4C1NA 4ZCLA 1SCUB 3RJZA 5K05A 4JCCA 1FVFA 2XWBF 3EQ9A 5FUXA 4AUMA 3SFZA 3TSYA 1KY2A 1U3GA 2O2GA 4JEMA 2ZTVA 3RJMA 4JBGA 2JIOA 4KLRA 3RC8A 2DSNA 5ETJA 3STHA 4N01A 3TE7A 4ON9A 2P9YA 3DF9A 3OQNA 3GFGA 4KCGA 2W6ZA 4HLUA 1E1RA 1KO5A 4OQDA 1WDLA 4RJJA 2J3IA 3U6KA 3KB6A 5GZ3A 3G0OA 4DM3A 1IFXA 5D84A 4P34A 2HT1A 1H6CA 3MCAA 3FOCA 3KTAB 1CQIB 1NBMA 3N58A 3L6RA 1DC5A 3O7MA 4K0RA 4BO2A 4DDHA 4EA8A 3ICQB 2W93A 3AYXB 1YFLA 1QK4A 1U2GA 4C5AA 1N3LA 1NKVA 3RROA 5JSUA 1QIGA 1W85B 2ONYA 3E7PA 3FDIA 3ZHQA 3R6LA 4I6JA 3H6GA 2AEMA 1AGPA 1S8FA 3WNCA 4BUJA 1NJFA 2J9ZB 2AOWA 5LDGA 4C4TA 3AVVA 4KYVA 5KTSA 2XTNA 3AR2A 1NXPA 2Q6IA 1M34E 1RKBA 4XIYA 3GEIA 4BN4A 5JS8A 1SQSA 1WAMA 2Y1CA 2CXQA 1I4EB 1E5TA 1XA3A 2A5FA 3V48A 4KXUA 4YY3B 2B92A 3KXDA 4FQ8A 5MHTA 3DTNA 3NFYA 4DSTA 5BR7A 3QVMA 1NHGA 3JVEA 3PX7A 3R9WA 4I5DA 5G0WA 3NV9A 3PUIA 2QAGB 2NO9A 4K88A 4GXQA 3WE7A 5JSZA 3QBJA 4BLRA 2QV7A 3TAHA 3B85A 2G9ZA 4HNHA 2QD5A 1TW2A 2WUFA 1DBWA 1D6NA 2EDAA 3ASUA 3FTPA 2N42A 3G7SA 3O3OB 1EHIA 1C41A 2VJYA 1UBEA 4HP8A 1PWHA 4MKXA 4A73A 1FRNA 5DNWA 3HL4A 1DL5A 2Q1WA 1UBFA 2KYRA 4D4GA 1AK1A 4LRQA 4XQEA 1CQWA 1TIPA 3FWNA 2FPKA 1P2TA 2NU6B 4KMMA 5AR1A 1KZ6A 3I2YX 1EHCA 1M2JA 2GTIA 1N6HA 2PYZA 1JI3A 3LIIA 3OPYB 4LQDA 3JPYA 3PHJA 3KQTA 1O97D 3CLRC 2SNIE 5EKDA 4BEBA 2XKBA 2ZE5A 2B25A 3CIFA 3WKEA 1LNSA 1CUCA 3THXA 3FVRA 2X0DA 3UUFA 2HSZA 2C99A 3GY0A 1A2QA 3PSAA 3B51X 3IV9A 1MX3A 4TWIA 4C6HA 4E3WA 6ADHA 2BAGA 3GFFA 1QIDA 1E0SA 3FPEA 3NLLA 4FYKA 2ZJFA 5GVSA 4NG4A 3UAGA 4BNLA 3LWBA 1H8HA 5J5VA 2G9QA 2GOYA 3A9TA 1SC6A 4P33A 2ZRHA 4G5RA 2EIHA 3EVFA 1H2BA 3N2YA 1JKJA 2A0XA 2AQKA 2GCPA 3C3PA 4JLOA 1ZI8A 4ZO6A 5JQGB 5K0ZA 3LVFO 4GE3A 4CIVA 3QVJA 5T5QA 5BMVA 5KTKA 4J0QA 4ILKA 3T94A 2HUPA 4YAIA 4W5QA 1U99A 1IG3A 4ZOAA 3IBCA 3QNWA 3ROQA 4CM8A 4FYXA 4PLFA 4J0GA 3DTVD 1OH7A 4EYOA 2RGRA 2PU5A 3U4GA 1JHDA 4ZA2A 2VDWB 1OF1A 1GA6A 8LDHA 2NZUG 4DJJA 4JQYA 3DGFC 4QUKA 1F14A 2DH6A 3W3AA 3SCZA 4NK4A 3MLAA 2VK1A 3UWDA 2VRCA 4TSFA 3ROGA 2OG2A 1Y34E 4WN9B 4NCIA 4K9OA 4FB4A 1M0SA 2YRFA 3NOXA 4QXRA 2B4AA 4XYEA 3NVKI 4QDJA 3PUJA 1EFVB 3F46A 2JFYA 4A8JC 3I2IA 2I7CA 1M0WA 1WOMA 2CVFA 3VJKA 2NV0A 4DHEA 4G5XA 3BS4A 1WO8A 3URMA 1ZGAA 5CD1A 1OILA 2Y2UA 2WIBA 3CNEA 1L1EA 3RBVA 2J6BA 2OZVA 1D3AA 2IOFK 2ZJAA 2C1XA 2VSQA 4D9CA 2EJWA 2FPLA 2GEKA 2V8BA 4XSVA 3AUUA 1RXVA 1HG1A 8ATCA 4G4SO 4KE7A 5CYOA 1C81A 2WTMA 2F1RA 3FNEA 3MQ4A 4DQ0A 5KYXB 2HHHB 1J8FA 3EODA 1GJRA 2F8LA 2P3SA 5FRDA 1RBMA 3T9CA 1Y1KE 3UH1A 2FW6A 1JIVA 2I7VA 3P0HA 5DOVA 4LVNA 1UK6A 1PR0A 2DY1A 2F1JA 4ZDIA 1KORA 4RENA 1Y4ZA 2YQ4A 2QN7A 3CEAA 1HFEL 2XEDA 4EG0A 1RM4A 2CDRA 1OB2A 3KDAA 1NQOA 4JOCA 3M6VA 2IW1A 3JQEA 3MXTA 1Q11A 3FYCA 3OLWA 4MCHA 3BE4A 3HADA 3KSRA 3BB4A 1DC3A 2P69A 2YUIA 3PBKA 3WZMA 4Q00A 2FW8A 3AESB 5CK4A 1P9RA 4UC0A 4M89A 1U65A 2WNSA 2YJTD 1Z6QA 2ORED 4UMVA 4C43A 5CGQB 3AGQA 3RWOA 4JBLA 2AG5A 3ZJTA 1MQ9A 5IC5A 1KYVA 3X3HA 3NEAA 1VBMA 1CX9B 4MCJA 5GJCA 1UM9B 2EEZA 2DGDA 2ZETA 3SQLA 4CPDA 4D96A 1JKMA 4O4LB 5DM0A 1R7RA 1V5EA 5AK4A 1I5EA 1NVVR 4XFKA 5AXAA 5IZCA 121PA 1FZTA 5C4MA 4DCTA 4IILA 3BD8A 5CBPA 5CB4B 2WTUA 4QJ3A 4BMSA 3PVZA 1X80A 1GPKA 1D0SA 1Q2XA 3QKRB 3W79A 5LOVB 2OFWA 4ZT5A 3MQFA 3JS5A 4UULA 3CZPA 1TEZA 3TKYA 4YS6A 1VZ3A 3F8SA 1J5PA 4BV8A 2GO7A 2ZJ7A 3VDNB 3LBIA 4L2IB 4FCWA 4XJVA 4CDGA 4AZ3A 1U2PA 2ZI7A 1ENZA 3BWXA 3E1KA 4MUBA 5F73A 3K70B 2PUJA 4AIRA 3ABZA 3SGLA 1XMQB 3EGCA 4MITA 4FZVA 1ZQ9A 4NATA 3G0BA 4TWRA 4R71A 3QE2A 5C1PA 3TPFA 3OJ0A 3RUAA 1JR3D 5EQDA 4BJ1A 2H2AA 1N6IA 3KS9A 1L7BA 1R4ZA 4NMHA 1L6IA 4QO7A 4BZWA 1IZ8A 4EPRA 4W5HA 5B3LA 4ZAYA 1QHIA 2AXNA 4XB6B 3TLKA 2CZCA 2JPDA 1SBTA 4IH1A 1Z5WA 2GB4A 2I7XA 2MSKA 3GLKA 2I3AA 4NABA 3CZRA 1L0BA 1K1EA 3L8DA 4G5OA 4R1QA 4AJEA 1JLSA 4XFJA 1LDYA 3IBTA 2ACKA 2LKCA 1JALA 1ZWLA 4HUTA 1C9EA 4WBXC 3NHJA 1G7RA 1GZ4A 4XIFA 3FKSA 1H05A 3PQEA 4UASA 5DBGA 5DT9A 3PCTA 4WERA 3VNUA 4IHKA 4K9PA 2C8KA 1J4AA 5LCXA 4DMHA 3WMRA 1OFUA 2O4UX 3MTEA 3M83A 1H4TA 1TM2A 4LGCA 4G26A 9LDTA 1C1XB 5A4JA 3R4VA 4JXXA 5KNDA 2XKAA 1K0UA 3AEQA 1XEWY 1XBTA 3JR7A 1JHVA 1GR1A 4H3SA 2P5TB 4LTNA 1HTTA 5KOHA 3CRW1 5D51S 1PS8A 1TXGA 3GJ7A 2SKEA 3JW8A 4IDEA 4URZR 2D2EA 4X90A 1ZH4A 5IKOA 3K6SA 3I9NA 4B09A 2IYPA 2OHVA 3WP0A 3L93A 1HE3A 3TSZA 3EEYA 4HWTA 4E07A 4JH0A 1JG7A 1T3LA 1V6CA 1W75A 3G5AA 3B53X 2CNLA 5C0OE 5TT0A 4D4KA 3QRWA 3EFOB 3GCGA 3G2MA 3DBRB 3QX8A 3ZNNA 5JAZA 2CDNA 3EFHA 2CKDA 2IIBA 4DM7A 2UZ4A 5D86A 1EDOA 4UUPA 1LSSA 5GADl 3PR3A 3TZCA 1C9JA 1XZPA 4L4UA 4BTLA 2CVHA 2VQEB 5TX7A 2REBA 1GVNB 1U7OA 2J46A 3BE5A 4ZQBA 4JBIA 1A9RA 13PKA 3T95A 1KWKA 3ONVA 1GAQA 4R2WA 3P9IA 4WV3A 5F3DA 4NHEA 2JAQA 3C6MA 2VDKB 3WK6A 4L8VA 2ATIA 3AY7A 1CFJA 5T64A 4ACAA 3D7RA 2H2DA 4OL9A 2BWJA 1WKBA 1V11A 3W2TA 1Q7GA 1TOAA 1X13A 2BVNA 5AHRA 2BEWA 4ENUA 4AQYB 3L01A 4CM1A 5BV7A 3K5PA 4LDJA 5AVTA 3CF0A 4IXWA 3DE4X 3TFWA 1U4SA 2EWVA 2P5UA 2YW2A 3I2KA 3T4UA 1G21E 1SGWA 4M8IA 3ZR4B 1AK9A 1N9KA 3WLQA 4LBYA 5JI2E 5C2JB 1HI9A 3GP3A 3H8SA 3ZDEA 1DJMA 3OPVA 1BX1A 5ALJA 5E38A 1XTQA 3S44A 1TQDA 3VHLB 4G89A 1T1SA 5HEKA 3RT9A 3ESAA 1RLMA 3FCSB 4V24A 5K7SA 1D0VA 3G5TA 5FQNA 4DV1B 3ZE0B 5JVDB 5G41A 1OKKA 2JIMA 2R62A 2X4DA 4WY5A 3B2NA 2IF2A 3OY7A 3RS9A 3ZBUA 4L5YA 4HYTA 3VR5A 3GLIA 1UINA 3E9DA 5C8YB 3E5NA 3MT0A 1OV6A 3R0QA 4ZWNA 4V2UA 3BHJA 5BN1A 1L5HB 2HREA 5BV0A 3MAGA 1Q50A 3F4BA 1W47A 1A04A 3NT2A 4E4TA 3MOIA 621PA 4WKBA 4AN4A 4MUNA 3ZDAA 1PNTA 2CYAA 1M76A 3OD5A 1IC6A 2OYRA 1DAIA 3RFXA 1USIA 1VBFA 3K0CA 2C95A 1QRAA 5WRFA 4B3IA 3MD0A 2WG2A 4ZEXA 5A7HA 2JJ2A 3F5MA 1WXGA 1XHLA 1E6KA 2V55B 3MOGA 5TQVA 3ZY4A 4WFQA 4KQXA 2ODPA 4D6PA 3RE1A 1DJLA 3NYWA 1ZIDA 4RTSA 3BWCA 1K92A 1OXUA 4NBKA 3O4FA 4U39A 5CM9C 2BTEA 4CLOA 4RVDA 5JNLA 1AZWA 3UH0A 1L8XA 4EHFA 1QYXA 1FMJA 3P5BA 3PEEA 5HF5A 2RGXA 1ZR4A 2OBYA 4DTIA 4KO3S 2EKPA 4WESA 4RDCA 3O8RA 3GROA 1H6BA 3NANA 3NBMA 4D4JA 3R5KA 1TQ2A 3O4JA 4QUJA 4BMVA 2A9QA 3T9AA 4ZYZA 3VC3A 1XZDA 1STOA 3EZLA 2AYZA 1VJTA 1BHQ1 3FFXA 4C4PA 2ZCJA 2XNSA 1A9PA 3W90A 4MV3A 1TO2E 1NASA 3NVAA 1FFSA 1DG9A 1W96A 1O9HA 4AG5A 3KZCA 1ND6A 5H5JA 3D0RA 1NTRA 3JZDA 3SOPA 3CCFA 5C9ZA 4XH9B 4P36A 4RGBA 4F12A 1YR6A 3G59A 3TQTA 2WF6A 4Q9LA 2IELA 1SBZA 1WXDA 2OILA 2P40A 1TEVA 3EIEA 1JR3E 4LDRA 4N54A 4ZRDA 4PZDA 3TWOA 5JD6A 1HDGO 4M9UA 4CKEB 5IVHA 1XG5A 1SOAA 1G16A 3R6TA 5K3BA 5CFRA 4F4CA 4BKRA 3CZ4A 1K7FB 4J16C 4OKSA 3GRCA 4M1KA 1U3WA 2FGJA 3DMRA 4H7DA 4KL8S 4R3WA 4BQQA 5IJ0A 5TLSA 3U81A 1CUIA 1QIMA 5LM3A 2CHEA 3KSAC 1KNXA 3EAFA 4U7WA 3WB1A 1G20A 4PZEA 1GM5A 3COZA 2JCSA 1Z4OA 1OAAA 3KYDA 2ZM6B 5L3QB 2OPHA 3MFYA 1P18A 4QJIA 1IXKA 4MRAA 4KPFC 1HMPA 5GOTA 2ZBEA 2I7DA 4LWQA 1CFZA 2JCBA 1P74A 2JKZA 3HLKA 4MVJF 5ENVA 1DAMA 1AQIA 5ENZA 1FXUA 2IY7A 3W8FA 3OFNA 1XZEA 4BV3A 3N2ZB 5REQA 2ZWAA 3WJ1A 5LC1A 3CG4A 4TROA 3WGZA 4E0BA 4NXNB 2IYQA 4TKMA 3SQOA 5BN4A 2O50A 1EP2B 1CULC 4TWBA 1P31A 4PHTA 3DC7A 2VNKA 1LK7A 4ZAZA 1EX1A 1B42A 3P0EA 6AT1A 1C9DB 1NBHA 4IIUA 4KWTA 4TLAA 5CVUA 1MEJA 4B85A 1GTRA 1HZJA 4MLPA 5K01A 3MHPA 5K0GA 4GWKA 2VJOA 4G0NA 1TQ6A 2CHUA 3HQ4O 3U7EB 1SD1A 4AZVA 2OCGA 3UAZA 1E3WA 1QIFA 2L17A 3TGWA 3I4FA 2J9FB 1LLQA 4KK4A 2W6CX 3B6IA 1YKSA 3UKDA 5KVAA 1YBMA 3R9IA 3C3JA 4XB1A 2ZUCA 2NO5A 3ZQUA 4AP9A 2BFAA 2G82A 1Z35A 3LUHA 3IJRA 4D3ZA 5CG2A 1A5TA 4HPJB 1VLQA 4U9UA 3LG2A 1JHZA 2HTFA 1VPLA 1NP7A 3W4IA 3WIEA 4ICIA 4HFNA 4RK0A 1SQGA 2ZUSA 3IPCA 5D3KA 5JAIA 5F3WB 3LD9A 2CYCA 3DT8A 4LV8B 1GZ5A 5EJ2A 3CPSA 3LQYA 3S5UA 5IPFA 3GW8A 3VNQA 4B6JA 2VEDA 3MJFA 4MUMA 3U26A 3GT3A 3NBQA 2XT0A 4ZREA 4CFSA 1EINA 4FD3A 1S3GA 1XTPA 2H8KA 3NHBA 3QV2A 3IDAA 4RELA 3WJAA 1O8BA 2H7CA 4BV2A 1KEEB 4KUEA 1KPHA 3MTJA 1IRIA 2WZDA 5D2CA 3LP6A 5DWDA 1U2QA 2NO6A 4RLQA 1KBOA 1T15A 4A8JB 1ZIXA 2J32A 3UFXA 3NC1C 5JAOA 3ZD6A 1Q0PA 4C87A 1QHYA 4OI1A 2XQGA 1MJGA 2ECKA 3GZNA 2Z2JA 5JEDA 2N46A 3WMEA 821PA 3IHKA 4X91A 3IOYA 1BEZA 1IWOA 1PHRA 2ZIVB 3LBAA 4I6GA 5CH3A 2BFBB 2ODNA 5DLPA 2VYNA 1A27A 4XVRA 1ULBA 3N0VA 4ROTA 1HE5A 2PX4A 4Q16A 2JFPA 1X9IA 1GZHB 1ZLXA 1E2QA 5BVGB 4W5OA 4Y7CA 3AEUA 3G2PA 1Y63A 4RCYA 2NNLD 3OCCA 4PO3X 4CMCA 5I9SA 1PJRA 1R6AA 1SXJE 2YWDA 3AUYA 4EB3A 4CF7A 3W5IA 3KU1A 1EG7A 3L40A 1DJQA 3G0DA 3KQSA 3QYFA 5JJBA 1EFHA 4Z8YA 1VIMA 4P2BA 3LF2A 3KE9A 4OQFA 4UBKA 2PLAA 3DZ8A 5JIBA 1J24A 2ZRNA 1FVHA 2OAP1 2ZJBA 3NDIA 1GVHA 3OOYA 4QICA 4UUQA 4A6EA 2YINC 4F6CA 1X94A 2YKGA 4IEFB 1C80A 4NTZA 4R5MA 5DBIA 2AFHE 5JY1A 3VQTA 5JY6A 5ARCA 2LCIA 1A50B 2VS1A 3DL4A 2OP0A 3F96A 1SVKA 2GF0A 2JJMA 1VJ0A 2GHTA 3GNLA 2J7KA 3EVCA 1JNYA 3GZTB 3MG9A 2QRUA 3FYHA 1XI2A 1AO3A 3OIWA 3L6UA 4ZHQB 1EEHA 2BH9A 4QOSA 5FTLA 2PJDA 1E2LA 4N1AA 4PPYA 2G0AA 5ALVA 1WXXA 1XRSB 2WUGA 2YOGA 3QA9A 3N74A 1BXRB 3HHEA 4I6EA 3Q5GA 2RHDA 1Z2AA 4M2LA 3IEKA 1OLUB 3SIXA 1Z6AA 3BRCA 2C7RA 3LXUX 4PU0A 3GO4A 4ZI7A 2XZOA 1C1HA 2AI2A 2HH9A 3JARA 4D0LB 4F3NA 3JSAA 1TYEB 3SX2A 4KIWA 3Q0TA 2DCMA 1RAAA 3KKLA 4NCHA 3RIEA 4CM6A 1KI6B 3P2IA 3K3PA 4E46A 3LP5A 3FPLA 4EMBA 1Y4DE 1Z4IA 3TZBA 2FN3A 3R1IA 5LBUA 4B75A 3T5GA 1WZUA 2WKPA 5LKAA 1BW9B 3I2FA 4MR8A 2WPDA 2ODAA 3L7DA 4F7DA 5DV9A 3A3YA 1VJRA 3HFRA 5G1NA 1H65A 1L4UA 3JZFA 1E6WA 3AKYA 4KN8A 1LW6E 3QLJA 2G5PA 4DIUA 3I9V1 2EOAA 4BWYA 3PQ2A 3N6XA 3EMKA 4F6LA 3H4MA 4FS3A 4MGEA 4N0QA 2O54A 3WGTA 3R5XA 1CZRA 3CV3A 1RQGA 5LVAA 3VSDA 5HHTA 1OIXA 2QTMA 4IIJF 2QPTA 3AB3A 5ALFA 2OV2A 4HDMA 4JHLA 5L40A 3WKDA 3ZLJA 2OKCA 1VJCA 1YZHA 3CSDA 4OFBA 2EQAA 2VHZA 1QB7A 1PZEA 4RACA 2NVUB 3STUA 1H0SA 4UE6A 4AB1A 3QI2A 4LDAA 4MQEB 1ODIA 4CM8B 5JH7B 3PHGA 5C3UA 5ELXA 4YGXB 2O0HA 2VPYA 2K7FA 1UZAA 3L77A 1PBNA 1RLJA 4ZANA 4NDNE 2WVGA 5CIWA 4BY9E 1VRCA 1VBKA 2EFYA 4FXPA 1DHTA 2IU4A 1KC3A 1P45A 1HRKA 3JAKA 4R69A 4W7SA 3VDMA 4S1VA 4ES6A 1FEZA 1R6VA 3ICVA 3RHFA 1M8PA 5CJ2A 5EHGA 1NNUA 3OZAA 3EFBA 4QPCA 3QJGA 5DXJA 2ID9A 4QYIB 1B41A 4CMEA 3E3OA 3REQA 1H5QA 2C4NA 2ON6A 3G2IA 4ND4A 1ZRMA 3IAS6 4BEVA 2R3SA 3F7NA 1TU4A 3KYBA 1RRMA 1E66A 4A8HA 1MU0A 5HOEA 2AC2A 3R0ZA 1TYAE 3ASYA 3JU3A 5P21A 4J6FA 5L7YA 3WLAA 4V1CI 1XTKA 3R75A 2IWRA 3QEJA 3E03A 4DV0B 1PJBA 2C4MA 2GA8A 4MKHA 2AXPA 3ZGLA 3G8BA 2EFCB 4DPKA 5KIAA 1NF3A 2PA3A 4DPLA 1HL3A 1QO9A 2XODA 2UZ3A 3H11B 5FNZA 3A6EA 2UYHA 4QYWA 3U3KA 4R2HA 2I1WA 3NTOA 1VIAA 4CTJA 1YU9A 1YI8A 3QWIA 4E2FA 4ZIRA 5C18A 4KGVA 3C48A 2O06A 3EVZA 1X8LA 1X7GA 4HS4A 1BA2A 2PZLA 5FI0B 3L04A 4CETA 4LYYA 1WUYA 3E3NA 2FQYA 2MJLA 3H4VA 2JL1A 1EDEA 5IFLA 4QRDA 3J80A 4KLNA 4HAXA 4IIJA 4GAEA 3NIFB 1E2DA 1X14A 3OPMA 2PPVA 3U7HB 3VO8A 2HCTA 4WZBE 4F4HA 4P4SA 2YX1A 3NJ4A 2PL1A 2UU9B 1WQ3A 3T7RA 1N2IA 3RBXA 3RVDA 3ZVMA 3O2NA 2IYVA 2R1TB 4Z4GA 3TCXB 1O57A 1ZH6A 3L0CA 4GW3A 4UNNA 1DKUA 1PJ2A 1WCYA 1O6CA 2WV9A 4TV9A 2IV3A 1Z0SA 4FB5A 2IEYA 1PF7E 4AS2A 1WULS 4WKPA 1EUZA 4ALKA 2HRRA 2CL6X 3C5CA 4RFSA 5EUQB 3Q7RA 721PA 3WLRA 3V4FA 3FTDA 4R9SA 1FW8A 4AECA 4EARA 5D7BA 3QSGA 3M33A 4Z0NA 4DC9A 1YDGA 3QQPA 1BOOA 4GQIA 4QDKA 5AOAA 1UDBA 1TX4B 4CYMA 4D74A 4KQKA 1ZN2A 2QU7A 3F5DA 1I9GA 3SHVA 1XTSA 4FILA 1XUOA 3W5VA 5KZMB 4R54A 2XDQA 4ZC8A 2QX6A 4CT4B 2JK1A 2Q29A 2H2GA 4W1SA 1YWGO 4RSGA 3DMNA 5ANRB 4G8CA 4IDBA 5K4GA 2HU5A 2XUHA 2J4CA 1TVKB 2GBCA 2GPYA 3G2OA 4MAFA 4QT0A 1XHFA 5IMBA 1A82A 3LDUA 4E11A 2JIBA 4O4IB 2EYQA 1ZN8A 3M5WA 4HR7A 4Q4AB 3WLMA 2QMEA 3FOWA 3MC1A 1Y3BE 3WRWA 4Z6KA 1DU4A 3MGGA 1E7WA 1W35A 1K9VF 5F21A 3BTVA 3LGSA 4DLKA 1SWVA 4PGFA 2PA0A 5TC4A 5A62A 1AXRA 5IWAB 1U9CA 1YBAA 3EVDA 2O8CA 3G9ZA 2FQXA 5HQJA 4CJXA 3WZLA 4QTTB 4QUDA 2HBYA 4MYCA 2DKFA 4US1R 1QAMA 1GPNA 4PCVA 2I2CA 1CY6A 5AUQA 5IJ9B 4B3GA 3EMDA 1FQJA 3F3YA 3HFJA 3KAQA 3MTBA 2Z4SA 3KZKA 1QONA 4L5JA 2QTVA 4MWDA 3ZOZA 3CH5A 3WTBA 5I4BA 1PL8A 2RHRA 3RIXA 3D3QA 1CUSA 2V7VA 3HUUA 1NRIA 3T1NA 4KSCA 3FB1A 4OXYA 1T6ZA 3C7CB 3Q3EA 4IF6A 3GDOA 3Q2IA 2DUUA 2JI7A 2QGFA 4II7A 1YK1A 3FBGA 2R6GA 1N0WA 4XIJA 5DP2A 5BQ3A 3V4RA 2O59A 2JFOA 1BROA 3D5TA 4JJ7A 4DKXA 3IR6A 1J1IA 5ICGA 4CLEA 3KJHA 2W48A 4I55F 2H2FA 2QJRA 1PSDA 4M0DA 3O7WA 2REQB 2XCTB 2BGTA 3W8DA 1EK2A 1M0TA 1SG6A 4B3DA 4F46A 1UBGA 2P2YA 5KOIA 2NZ2A 4MA5A 1NKTA 4EUSA 4HDQB 2SICE 3VR6D 1AGYA 4GPTA 3DV0A 1GRQA 2IXEA 1ETUA 3W3AH 1NNI1 4FMCB 1XNRB 1N1MA 3DTVA 5JRJA 1FRQA 1NVVQ 2N9UA 1AKWA 3ZGXA 4MWCA 2Q3HA 2AN9A 3SBXA 4DZZA 4MHTA 3OQHA 4U6QA 1YQTA 1JJVA 3AF3A 1SURA 2G6BA 3DLAA 4ALJA 3EIXA 3PB3A 3RQIA 3IDOA 1E3MA 3KV1A 4P4UA 2ZB4A 1W9HA 1R9MA 2JHGA 2AFIE 2MU1A 3IA7A 5GV7A 4ZICA 4OSPA 4C01A 1TM3E 4WBNA 1LLDA 2Z4TA 2YN0A 5CNJA 1XZAA 3RSCA 4FW8A 4KHPB 2WJ4A 2D1QA 4F3KA 5IEBA 1WQ4A 2C2XA 2VL7A 3IUMA 3OPYI 4H18A 4LBVA 3LPMA 1QIIA 2Z3ZA 4LXXA 2DY0A 5AI6A 2HL6A 5THKA 4FYVA 4OJTA 1DEAA 3A1SA 3CH4B 4QOJA 2PFSA 2RAPA 2JAUA 3BFKA 4RHEA 4XGNA 5T4EA 3V4PB 1X6VA 4X45A 3ASZA 5MDHA 4QE3A 3RLFA 1WUTA 2J5QA 3EK2A 1AVTA 3BULA 3U60B 1SU6A 2OZLA 1ML4A 2YMQA 2ZKLA 8GPBA 1UIMA 3AUFA 3D1JA 3IE1A 4WDQA 1NV9A 3L9XA 1YRBA 5TPZD 5JT1A 4TV8F 1AKNA 1MVNA 1XF9A 2XH8A 4HUJA 2QLTA 2ZWVA 3FNBA 3CB2A 2R8XA 3H5WA 4LA4A 1X0VA 3E7WA 2JI4A 3QOFA 4I55A 2P1RA 4R0MA 4RULA 3C6KA 2WICA 1NR5A 3Q12A 4EFDA 3C8HA 5KUTA 4MR7B 4PCLA 4Q9IA 5CURA 5A03A 1ZM2A 2I71A 1XZHA 4EP1A 2ECPA 3U44B 1M1YA 1VDZA 1I8TA 3HL0A 2R87A 4RM3A 5BN5A 3HFSA 1GFIA 3DF7A 4TMFA 3SZGA 4IYJA 3FTCA 3LPAA 3IJEB 3TINA 4O2RA 1UK8A 4PSCA 4C0HA 2AD1A 2W6PA 1LY1A 3MUOA 1AU9A 1CY2A 4AURA 3FHLA 5JPIA 4AXBA 1RI4A 2O2EA 3FGZA 3OBIA 3GMIA 1R18A 2C4TA 3M5CA 4Q1FA 3ZD7A 1IPEA 2Q28A 1CIVA 4AO8A 2XECA 4TWJA 3W4KA 1JMYA 1NSYA 3G8YA 4F9FA 4EB0A 4U8GA 2GUGA 3RHTA 4YWJA 2PGAA 2QX7A 5LZ5A 1KYIA 2DLNA 3OPXA 2IODA 1XJWA 3BTOA 3WAGA 4TRRA 4WEQA 2BGLA 1J21A 4FGWA 4GT1A 5BQXA 3TAUA 3I0MA 1OX4B 1V96A 1XZGA 1MTOA 1ZZEA 4BU1A 4JP8A 3GEHA 2BZSA 1KFBB 2IVZA 4QAQA 1KZ4A 2F59A 1F7VA 2PTHA 2QOEA 1R2QA 4FSDA 3ZWQA 1PD0A 3DT9A 3O0DA 4ISBA 1JR3A 2JIQA 4HWPA 4ZEVA 1DKMA 2OO3A 3H2ZA 2JAWA 3BD9A 3LQ1A 1GEEA 2XIQA 4BMDA 3BGDA 3H9EO 2RI6A 2FA9A 2X6RA 4FBMA 2ZBQA 1FXWA 3U4IA 1Y5LA 4DV6B 4HTFB 1JJFA 5EZSA 2G6TA 3VX3A 1NBOA 1QHNA 3MJRA 2GM3A 3QXXA 4TV8A 4EUKA 5HKKD 2IH5A 3CX8A 2B61A 2JBAA 2E4AA 4Q0MA 1XPJA 5CRIA 5FBZA 1Q7CA 5B7GA 4G9EA 2X7XA 1UBMS 3FZGA 1NNEA 3HI6A 1MRSA 4IIXA 1SKAA 4ZAVA 3TZHA 1UKAA 1JHYA 5FHQA 3PWSA 1JECA 2VTBB 1ZIOA 3S7TA 3W5DA 2Q07A 2ENWA 4PSKA 4W5TA 4KQIA 2V5AA 2A0YA 2IYRA 3A1TA 4PG5A 2H54A 5BVHB 5D1NA 1CZNA 2Q5EA 4M8LA 2YZ2A 1ACJA 2JLXA 4ZZ1A 3H1BA 5CLLA 5CHYA 5FWXA 3T3EA 4C2BA 2O8NA 2QVGA 2WDZA 2XVZA 3EVBA 1DTWA 4J2HA 4MR8B 5SY6A 3AF6A 1W7AA 1MKYA 2JASA 3JRNA 1MUUA 3OUZA 1VE6A 5EHNA 4Z7OB 2IH4A 4KC0A 2JAXA 3PUYA 3QA3E 1IOZA 4INPA 3B9QA 2OUKA 4W6ZA 1Y9AA 2CCKA 5CXXA 5B3JA 3V8PA 2OQIA 1UZLA 2I6QA 1S8AA 2DQSA 2JH9A 2XY4A 3THWB 4BO9A 2HK7A 1T9GR 2BKAA 3R40A 1HZZC 2IYSA 3EUFA 3D3WA 1QP8A 4L9WA 1FDOA 2EHJA 3FKJA 1UKBA 1Y8RB 3QMVA 4B3BA 3AF2A 4E2WA 1KI2A 1E96A 3L6BA 1NZFA 2ZSAA 3FM9A 4YMVA 2BM0A 2B7CA 3KOUA 3NR2A 4NU6A 3AIKA 3C1AA 1F4VA 2X13A 1EWYA 4IIEA 2J9RA 2VJCA 3RVLA 3TE6A 4BOYA 3B1ZA 3C8UA 1QG4A 4DR1B 1U4OA 4RY9A 1W44A 2WM8A 3PGXA 3V2IA 1C0IA 1R6DA 1YHNA 3W05A 5GJBA 2CFIA 4QEKA 4L4YA 4ARZA 4BB9A 2LW7A 1F9EA 1QDUA 2IXTA 5CB0A 4TS9A 5UKDA 1Y1SA 4G0WA 3UMYA 4QPNA 4JSRA 4MW1A 4Y2TA 2BFMA 3WGLA 5CNMA 1KBZA 1YQ9A 2ZB8A 1NYTA 2CB0A 4DFDA 4L0DA 5E6RB 4RZSA 3TB4A 1DKOA 3EOAI 3NH9A 2IGTA 1SHLA 3FCUB 3UQYS 3WLOA 1KZHA 4M1EA 2NW6A 4BFLA 4OGWA 2Z6VA 1I2ZA 2NZJA 4P3XA 1PV4A 1KQNA 1Z73A 2EKDA 3H6HA 2OD7A 4EJ0A 4EVQA 1ZPDA 1LNZA 2C54A 2MOKA 2PX8A 2R8YA 3D6NB 3HXTA 1YCHA 4RE6A 6REQA 2Z6QA 4PR0A 3P0JA 5H3CA 1C9YA 1LPBB 1I7PA 1L7DA 1Z7EA 1S89A 2AN1A 2VP3A 4R2IA 4F93B 3A9SA 3TRDA 4G01B 5K3SA 2WF9A 3BN3A 4XZ3A 3AUSA 1SXJA 3DOIA 4HQLA 3D6UA 5AICA 1VI2A 1ZK0A 1QGDA 1LS6A 1U1DA 1W5FA 2MR6A 2ZI9A 3B82A 4GGMX 4RMNA 3VHXA 4CKXA 3BCSA 1QV7A 4HQ0A 2II6A 4F1WA 3DOUA 2JI6A 3HR4A 2W2TA 4WLUA 4L76A 3D59A 2GNAA 1EFCA 4TQ9A 1FFDA 2GZHA 4R1LA 3ZCTA 4PIMA 2V7BA 4JB0A 1Z4PX 3RKSA 2K6GA 3FDZB 4P7FA 4FHCA 1O89A 2BKXA 4UVHA 4AZ0B 3MUEA 1BDBA 3PCRB 2PE5A 4OSOA 4QSMA 5KWSA 4KQEA 1ZK1A 1JZTA 3WKCA 2W4IA 1QIJA 2EATA 3A7EA 2VTEA 1UADA 4DWWA 4IOKA 5DMHA 1RWVA 3DMTC 1SVMA 5EJEA 3S81A 3HVJA 2YVAA 6LDHA 5JXGA 3AVUA 2OCIA 3EB9A 1DLIA 3KVVA 2F00A 7YASA 1CUDA 2G88A 1N2CB 1QH9A 1R4NB 2EJVA 2Q3DA 5CW2A 3ZJ5A 3KZVA 5F9FA 1QE3A 4ZD6A 3T9DA 1EWKA 2Q4EA 4GECA 3SXPA 4FYPA 4ZU6X 4BJ6A 2XKKA 3UPUA 1U0NA 2BONA 2QWXA 1JYSA 1X1DA 2D4AA 3OWOA 5FQOA 1WNTA 2PUBA 1A0OA 4R2XA 1VGVA 2WFZA 3D7MA 1GZDA 4EKEA 4AS1A 1C0PA 2JRCA 3MIIA 4LWZA 3V8EA 3WMXA 2YICA 2OQ2A 3OO0A 5I4CA 1S96A 2R1VA 1KDTA 1SPXA 3PDCA 5DN9A 1KJ9A 1P7CA 1V1RA 1Z4MA 1U5CA 4EDFA 3ZE7A 4IYRA 2MINB 3L02A 3NVMB 1AX9A 4RH0A 4YP5A 1GFZA 2IZ1A 3MGBA 3WLTA 5DCYA 3T15A 2FVYA 3FPBA 3CZMA 4MGZR 4EGFA 1V35A 3KLMX 4ZVUA 4JSYA 3RFVA 3NJRA 4MUIA 4YUXA 4RWEA 4EEXA 2DQKA 3EGWA 1PW7A 1OASA 1Z0UA 4PINA 4TVKA 3T54A 1H0KA 5HRCA 5EZYF 5CXSA 1I13A 2KLHA 3BEDA 1LBHA 5ALMA 4DAOA 3MERA 4D02A 2VUTA 5LN1A 4LFBB 2D62A 1HYEA 3KYCA 3IB3A 1E5XA 3UT0A 4CKBB 1RXEA 3CH7A 1RC0A 1E32A 3O94A 4DJFC 5BRJA 3MBOA 4GVLA 3ZHTA 2DFPA 2FEMA 4X63A 4M9RA 1E3DA 1HT3A 1G3UA 4J76A 2BR5A 5EE5B 5EIWA 3FN4A 1LWNA 1H2YA 1GTG1 2PMKA 1YT5A 3N9IA 3QE3A 5L6MB 2KPOA 3GA5A 2CFRA 3UWKA 2GBIA 1E3SA 1L7XA 1Y89A 1JNXX 1VBNA 3P32A 3R24A 4Q3EA 3GD5A 2JGRA 2CXPA 4F96A 3LKVA 4GKBA 3HBMA 2NSDA 2OE2A 3AHHA 3KR0A 4JEIA 3KC2A 1AV7A 2AEJA 1TNDA 3H42B 4KB5A 4R9VA 3VBCA 3ZV5A 2C2OA 1BAPA 4KGDA 4PC3A 4JIGA 2ZUVA 2X19A 3K35A 4FUQA 4JT9A 2V4MA 3CRMA 5JOQA 1YVEI 3B12A 2PLFA 2OENG 3GJTA 3EGXA 5MN4A 4FW9A 1VE3A 2YJ5A 5KHAA 3A31A 4LZAA 5HRUA 3DSRA 1EWRA 2C2ZA 2WU4A 4JASB 5ALGA 4REMA 1BGWA 4XUCA 3UO8B 2EBUA 3RYIA 2GEJA 4YAUA 3PX3A 1UPXA 1HO3A 4S3MA 1Z06A 3HDQA 2X0IA 1C1DA 2YVKA 3KEOA 1U0EA 5K3DA 3RFFA 3WQSB 4EQZA 5HKBA 3NEYA 1A2OA 1PZHA 4TUYA 4PHCA 2YIDA 1DNPA 2XRZA 3R41A 2JGDB 5BSEA 4X61A 4DREA 1D8AA 1FRVA 1P7PA 3CH6A 1TUIA 1JAIA 4M99A 4E5SA 1TGYA 2CXNA 4CM7A 3RRMA 3K70D 1YAJA 5IKXA 1BCSB 1NQWA 2QD1A 3LL7A 2AUMA 4LDQA 4C20A 3AF0A 1OLXA 1QPBA 4U5QA 2GYVA 5C52B 1I4TD 4MUXA 4KLCA 1DFIA 5PGMA 2D0OB 1ZVVA 1LGYA 4UU1A 3KNZA 5ALIA 3NHYA 3SK0A 4S1OA 3UCFA 4AYTA 3BFVA 3T9FA 2RSLA 3DBLA 1UEJA 3EAGA 1QGAA 4HWGA 3CX6A 1Y37A 3PSHA 1B7GO 3EG5A 3I52A 1R9JA 1UT6A 5HKLA 3V6MA 1GZ3A 1ZM9A 2XLBA 4LIPD 4N5IX 3SHWA 5FX2A 4IHJA 1MO6A 4MOWA 3T34A 2J0QA 4C0SA 1GNPA 1WLSA 2QNBA 4ZXFA 4WVFA 1IUPA 3PTLA 3WV4A 1R0BA 4AG6A 4JJ6A 3O8NA 3TLGB 2ZTSA 3Q3HA 2HLNA 4MYSA 5JCZA 1N5DA 4LY6A 2QLLA 1GZ7A 2OSVA 2WAYA 2VJMB 5FNVF 3TJZA 3GX1A 1SXIA 2REXB 4AKIA 5FWDA 2NV2B 4KRYA 2CWWA 3L4EA 3QWAA 4X7RA 1AKEA 1GGMA 1XCBA 4YACA 1DKNA 3ACDA 2GCNA 4BGIA 1N8SA 4H0NA 3VHQA 1C8LA 2O4CA 1N7IA 2C5AA 4O0MA 4AKEA 5AD1A 5BUQA 2ZDHA 4DLNA 2ID8A 3ZHVA 1JAZA 2ICAA 5CAEA 1QH1B 4N3NA 5JHGB 2G5TA 4GI2A 4GM0A 3EXEA 3PWZA 3SF8B 4OOFA 2M9MA 1C4KA 2R6AA 1W4AA 2VSOA 2GVDC 2Z1DA 1V5IA 2IA5A 2W6MA 3HKDA 3QVTA 4JITA 1JAYA 5HIMA 3A8TA 1KDYA 3RU2A 4W1QA 5EXXA 4B71A 3UAXA 7ABPA 3RTGA 1WB6A 1AUXA 3H75A 5IJZA 1GZVA 1QYVA 1BMDA 5D3ZA 4E5KA 4ZKDA 4A15A 3QU4A 1UMDB 2A78A 1XTTA 4OU4A 3G0IA 4TTJA 4R1OA 5IUKC 3VKHA 1QAQA 2YBEA 1EE2A 2C57A 3LPNA 4H3HB 1QYIA 1PK9A 1JXOA 4M87A 1MB2A 2PXXA 3PJGA 2QGNA 2BGJA 3BICA 1NR7A 2R60A 2ZSJA 3D54D 3VPHA 1HLFA 2VHQA 3HCWA 4HNQA 2CWDA 4KWHA 3JQAB 1WCIB 2HA6A 4QBHA 1THGA 3BH0A 4FKZA 1CJKC 4DSOA 1EP9A 5IAJA 4BMXA 4KR3A 5I7FA 2HJVA 2O2HA 5CT6A 4FZJA 1ZICA 4GC9A 2XHZA 2DZDA 4M0UA 3VR1A 2KBEA 5G4KA 5KPDA 1OI7A 2QZJA 3O2SB 5A3RA 4Y67A 2XUPA 3ZG6A 4MK4A 5EAIA 1WBBA 4PPFA 3UJHA 1E7QA 4BZPA 3ZI0A 2WNHA 3BGSA 4H7EA 4JR2A 2BFCA 3N6VA 1GLGA 1OH5A 1V6AA 3FFBA 2DUNA 2R7KA 1ZXBA 3C0KA 5FNVA 3ZJ4A 1Z22A 3L7BA 5AVKA 5CP8A 2YDXA 2WD7B 3BG5A 1DEXA 4AROA 4E32A 4NSNA 1AB6A 2JGFA 1E6MA 3JAWA 4OF4A 3M6AA 4NXMB 5IJAA 3VNRA 2C1ZA 5CX1A 1KGSA 3GLTA 4UBNA 1RCUA 5AW0A 1WXWA 1YJCA 4NOMA 1OZAA 4COKA 3PXDA 4FFLA 3DYIA 1WZCA 2OB2A 1RWWA 3AXTA 1DCMA 1E6EA 2WJZB 1U1IA 3I53A 2XOXA 1V7CA 4HH1A 5U4XA 4KXWA 5A4DA 1JFTA 2QGZA 3EOBI 3OJLA 1TUBA 2X2PA 3CVOA 3II6X 5AYVA 5JYCA 1ISSA 1Y82A 2RK6A 2GCGA 3RT1A 3ZI7A 1T4CA 5D8DA 5J43A 4FP9A 3AKCA 1TUGA 1PQYA 5F5LA 3GRYA 3FH0A 5EHXA 1BX0A 1Q20A 2FI1A 4AUNA 4O4HB 3LQ2A 1R6BX 5AVOA 1T2VA 4AJIA 4FMDF 4IXNA 3CYFA 5BR4A 3VZPA 4HEHA 1DX9A 2WE7A 1IY0A 1CHDA 3MGAA 4DY4A 4ZXPA 1X8XA 2FNAA 4BFTA 4OG2A 5AKKA 1TJ5A 1GUAA 4MW0A 1U7XA 3CF4A 3H2HA 3OURA 2QN3A 3QYAA 1X2EA 3NXSA 2NOAA 3QNUA 2Q5HA 3OLZA 4EDHA 1F1BA 4ZV9A 1D2GA 1JLKA 1R8XA 1Z68A 1E5LA 3BD7A 3PL5A 4CV2A 3ZU6A 1C9MA 3JD4A 4C5CA 4H6VA 3SWWA 1PGOA 1H1LB 4DLYA 1CEYA 1DWOA 1FY2A 3UMFA 3OKAA 1Q0UA 3DWEX 3IIMA 4HLUC 4AJKA 1T3ZA 4WH0A 1SBIA 4BEJA 4L07A 1N5RA 3WA6A 4ER7A 2BJVA 1P9WA 1PJ3A 2QR3A 1ZWKA 4MJ3A 2FCAA 3QE9Y 4JGIA 2P2LA 3PA8A 4PZCA 5CDGA 3VYWA 5F7XA 4WFJA 3KB8A 3LKDA 1P4GA 5LFAA 1FTQA 2C9YA 3WYNA 4IWNA 5I7SA 5HA5A 3ED5A 3UK6A 1OPXA 2IV2X 1U2GC 1XKTA 4D9NA 3O4RA 5LU9A 3CJTA 1SOVA 2BL4A 3CY6A 4L5AA 1W30A 2K87A 4EABA 2W2PA 4G36A 1WB5A 2FJ0A 4EO4A 1OFGA 2QD4A 4QFBA 3DE6X 4XD7D 4KR9A 4Z51A 4PS0A 2H5JA 4A3SA 4ESVA 4W7HA 4FNAA 1Z25A 5AKYA 4BNIA 1Z33A 4A8PA 2AN4A 1JXQA 4RH1A 3T1YB 1T3GA 1L8AA 1XRPA 4MQ6A 3RJTA 2PHZA 5I7HA 3EMBA 1A8QA 3V6LA 3PPIA 4NCXA 3U4DA 2OCPA 5DLQC 1IUKA 3QTBA 4P5PA 3VNSA 2XXAB 4JUCA 2IYTA 1XVVA 3ER6A 5LL6P 3ZXSA 2W4QA 2Z6AA 2PH3A 3C7KA 3KELA 5IUJC 3IGFA 5JUWA 5EJ9A 2PBLA 3DXZA 3I6QA 3HMKA 4LXGA 3AP1A 1R6UA 3Q88A 3BWMA 5BSHA 3ETDA 2WJWA 3C6QA 2XB2A 2QTHA 2VHCA 3N6RA 4DMFA 3CLRD 4EZBA 1T5HX 4NNJA 4GI3A 3IL2A 2WJHA 3AUAA 1SIUA 1P1JA 4UBJA 3RK0A 4RU1A 2ZROA 2NP7A 2XUOA 4R7TA 5IT5A 3QQ5A 1Z88A 2LIVA 1COWD 4ESOA 1R0CA 4BVFA 1LV7A 2PH5A 2IUUA 3FRHA 2ZYHA 3QU9A 2QE7D 4GMDA 4L4RA 1J2RA 2HJRA 3EUAA 1RBZA 3NATA 4P93A 4EHIA 3JY6A 1HBJA 4MIEA 1IEQA 4ZO8A 3R7FA 2R7LA 4HFRA 4S2EA 2XUAA 3EPKA 1J42A 3LVBA 2EW2A 3ER8A 2AH5A 2H9YA 4DZRA 5KNLA 4V03A 3WL5A 1BN6A 4LFAB 4DLTA 5F77A 4ZVSA 2RGUA 4RMGA 3GLGB 2OBNA 1UBRS 3F5FA 1F4LA 4IWYA 1CRLA 1JQLB 2JAOA 2VF8A 3RUCA 2I6SA 3W7BA 2PVPA 5KX5B 4EI7A 4Y2QA 2D5CA 3RVMA 3S68A 3UA3A 2MYPA 4MMZB 3NP9A 3P2MA 4FHZA 2QRVA 4BBJA 3LL4A 2IYYA 4EHAA 4WLEA 3V1TC 3CZ5A 4HRXA 2C61A 1WSWA 3HN6A 2YZGA 2KE5A 3BL8A 3EDYA 4MV6A 5CH8A 4IJVA 3QPVA 5G4LA 2QIOA 3C3EA 1ETHA 5GV8A 4MB0A 2GHQA 1TF7A 2QJFA 5FFNA 4B7ZA 1RWOA 1KEVA 1Z7BA 3BREA 4G67A 4DA8A 1ID8A 1Z39A 4DLSA 2OB1A 3EARA 2EKQA 2Q9UA 2QL6A 3NVDA 4KTVE 4YBRA 4OB6A 5C35A 5DT2A 5J2UF 2HQSA 2HYIC 3AWIA 1H69A 4TLLB 3R7WB 4EKGA 2VQFB 5AKIA 3PXCX 5A06A 2VQSA 3VR3D 2FKAA 3D31A 4O2AB 2P67A 1ZI9A 2WFLA 3VR6A 3CX3A 4KPEC 3N2KB 4GXTA 1IK6A 1XZQA 2OXCA 1ODJA 5ELLA 3S1SA 5LMZA 2F8TA 4JWKA 3PNSA 4BO6A 5F98A 3OTWA 2LRHA 3CSUA 1T24A 4RDHA 2C4WA 1B76A 3MJHA 3VVBA 4BFSA 5IAAA 1UJ6A 2JVIA 1EAYA 4TXMA 2HDHA 1WB4A 1GFWA 4N49A 4N76A 2QDKA 1CERA 4HGPA 2G1AA 3D2BA 3IAHA 4JT4A 4MV0A 3UGKA 4V0LA 3NH6A 3C5EA 4RBNA 5A9SB 3EBOA 3FTEA 4OOEA 3IBSA 1WPRA 1WU7A 1ZGZA 5AM5A 3VC2A 1GPJA 1UC9A 2GX6A 2IF0A 4BV9A 1X7YA 2BUCA 5DBEX 3UXEA 4GVXA 4M88A 1PJCA 2HCFA 1LPOA 5DYTA 3ETEA 1AKRA 3OKCA 1KZGB 1ORWA 2GZSA 4KO4S 4OAQA 3WLHA 3IUNA 4HT3B 2YVLA 2CNDA 4PZPA 5FFMA 1L9XA 3IPXA 3REFA 1W36B 1YV9A 2G70A 1DB3A 2FP4B 3RIYA 4FLFA 3RFUA 5H83A 1V2HE 3HLTA 5JDCC 4ONEA 1LBSA 1P2UA 2JBWA 4HPXB 2F67A 4D9MA 1POXA 3JVIA 5TPZA 4J9UE 4BUZA 3VZRA 4POAA 2CLSA 3RVRA 1OTYA 3GGDA 3M49A 4I8XA 3X1MA