2QGQA

Crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
296
structure length
272
Chain Sequence
EERPYAYVKISDGCGSLRSRSIEDITREVEDLLKEGKKEIILVAQDTTSYGIDLYRKQALPDLLRRLNSLNGEFWIRVMYLHPDHLTEEIISAMLELDKVVKYFDVPVQHGSDKILKLMGRTKSSEELKKMLSSIRERFPDAVLRTSIIVGFPGETEEDFEELKQFVEEIQFDKLGAFVYSDKVDPEMAKRRQEELLLLQAEISNSRLDRFVGKKLKFLVEGKEGKFLVGRTWTEAPEVDGVVFVRGKGKIGDFLEVVIKEHDEYDMWGSVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein TM_1862
publication title Post-translational Modification of Ribosomal Proteins: STRUCTURAL AND FUNCTIONAL CHARACTERIZATION OF RimO FROM THERMOTOGA MARITIMA, A RADICAL S-ADENOSYLMETHIONINE METHYLTHIOTRANSFERASE.
pubmed doi rcsb
source organism Thermotoga maritima msb8
molecule tags Structural genomics, unknown function
total genus 92
structure length 272
sequence length 296
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.8.4.4: [Ribosomal protein S12] (aspartate(89)-C(3))-methylthiotransferase.
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04055 Radical_SAM Radical SAM superfamily
A PF18693 TRAM_2 TRAM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2qgqA02
3.80.30.20 Alpha Beta Alpha-Beta Horseshoe pyruvate-formate lyase- activating enzyme tm_1862 like domain 2qgqA01
3CPFA 2K52A 5GADC 2CWPA 1KC8C 4YHHL 5IE8A 2Q2TA 4JBWA 3CPWA 4HJ5A 1J5EQ 1HR0W 1YJWA 1Q81C 2E5LL 2IX0A 3HOVG 3H0GG 2UUBQ 5HY6A 3CCUA 4YWMA 1Z47A 4A3CH 4LF6Q 4IFDG 2UUBL 3I4OA 3T1HQ 2ZTEA 4MTNA 5H1SE 3STBC 4LF6L 2CWAA 4LUZA 2BA0A 2VNUD 1KRSA 4BY7G 1SROA 3F1ZA 4C2MH 1VQDA 3F2CA 3F2BA 4GLXA 2UXBQ 4RG1A 1HNZL 3NENA 3KDFA 1KL9A 4JI6Q 4JV5Q 3RN2A 3RR5A 1GO3E 1QZGA 4JI2L 3J80c 5FJ8H 2UXDL 1A0IA 4A3BH 3S16H 2OQKA 4YY3Q 1PH9A 4JI6L 4DR6Q 4A3FH 2VQFL 3UE0A 1KAWA 3F8TA 1I94Q 1CSPA 1MJCA 3AFQA 4IOCA 3I4NH 1MJEA 3UE1A 2ZJPA 2Q2IA 1IBKQ 1I94L 1C0AA 4A3KG 3MEFA 1PFSA 2VQEL 2Y0SE 4NXNQ 2BA1A 2K14A 3NELA 1OXSC 3GTPH 1YNXA 4JBJA 4DV2Q 1UEBA 4EQ5A 5C0XG 2R92G 3HOUH 4JYAQ 3TS0A 4DR4L 4LNQA 3MXNB 4DV4Q 4DR1L 3U50C 1IL2A 4DV2L 3PO2H 3KLWA 4L5RC 2OTLA 1N33Q 1WCMH 1XNQQ 1TWGH 4DV4L 2GVBA 1VQMA 1Q7YC 1JT8A 1YZ6A 2ZM6Q 4DUZL 1VCIA 4HJ7A 2ZJQA 1N33L 3U58A 3W5OA 1SRUA 2Y0SG 3E0EA 4JG2A 2Z6KA 1YI2A 1XMOL 1XNQL 2K5HA 3ULLA 3CCJA 4C3IH 4JI8Q 4OWXB 1OTCA 4LUOA 2VW9A 1AE2A 1QUQA 1VQ5A 1OXXK 1HNXQ 4R4CA 2B29A 4UP7A 3H3VH 1VQLA 5LMNW 1L1OC 1E3PA 1FVIA 1PYBA 2HIVA 1RIPA 3CAMA 4DV3Q 3HOWH 5EAYA 1HNXL 1EIFA 4GKKQ 5E7NA 5FLMH 4B3TQ 4YWLA 3CQZH 3AEVA 4LW1A 1VQNA 4A3BG 4ALPA 1B7YB 4HJ8A 4A3EG 2R7ZG 4DV0Q 1NMFA 4B3TL 3RZOH 3ERSX 1P8LA 3I2ZA 4DK6C 1LM0A 4A3FG 2KHIA 4R4IA 3I4NG 3PIOA 4GOPB 4QJFA 3BJUA 1U5KA 3HFZB 1X65A 2OCEA 3EN2A 4AIMA 1FGUA 3RLOA 4AQYQ 4A75A 3I56A 4OXPA 4DK3C 3KFUA 3GTMH 2UXDQ 4JI5Q 1L2FA 3HOZH 4AQYL 2ES2A 2LXJA 1DGSA 2CKZB 3TREA 4JI5L 3CCQA 1X9NA 3J81j 4NXML 3HOUG 2AKWB 5IWAQ 2RHQB 2IHFA 1IZ6A 2QGQA 3E9HA 4IJHA 1VQ9A 2K5VA 1UE7A 3J7ZC 3PO2G 3I7FA 4NB3A 5JEAJ 1WCMG 4DAMA 2Q2UA 4KHPQ 3G71A 1NBWA 4BXXH 4QGUA 3TQYA 2VUMH 1HNWQ 5M3FG 2YTXA 4JI3L 5IP7H 4IO9A 4A3LH 3KF6A 3RN5A 1XMQL 4PZ6A 2EQSA 1HNWL 1GD7A 4DV1L 2MFIA 3BZCA 3GTOH 5BR8Q 3A0JA 4EX5A 2AMCB 1PH8A 4OO1G 1HJPA 4DV6L 2AWOA 2RF4A 1RL2A 3JC66 5BR8L 1PA6A 3CXCA 1T9HA 5AJ3L 1VQJA 3HKSA 1CKMA 5IYBG 5GAGC 1X3EA 3HOWG 1MIUA 2UU9Q 3KDFB 5FLMG 4R1JA 3PUWA 1A8VA 1EUJA 4LF5Q 2ID0A 4IPCA 2WAQE 5DLQE 2UU9L 2YTVA 4KLKA 1OXTA 4JI7Q 3PIPA 2NVXH 4OWTB 4LF5L 4O0AA 1X56A 2E5LQ 1YHBA 3GTJH 2IT1A 5C44G 4LFCL 1SLJA 4QY7A 4JI7L 3S15H 2MNAA 1QVGA 4X64L 1VQ7A 1VQHA 1XPOA 2B3GA 4C3HH 1VQFA 1JB7A 1IBLL 1KHIA 1PHJA 4POGA 3RZDH 3HOZG 1N9WA 4UPAA 2VL6A 4P71A 1PH6A 2YYZA 3U4VA 2WAQG 4JI0L 1LUZA 4WJ3M 4FDBA 1HNZQ 2HQLA 4PZ8A 5LMNQ 4X66Q 2PMZE 2NVYH 3G6EA 4JI2Q 2N49A 1PVOA 1C9OA 5JJKA 1QVCA 4BXXG 3HKZE 4IFDI 2NZOA 5LMNL 4P72A 3KYHC 4RMFA 4X65Q 4GS3A 5GROA 4X66L 5IP7G 4A76A 2V1CC 3J80i 4A3LG 4KHZA 2VQFQ 1Y1WG 1U0LA 4NPSA 4X65L 4A3EH 3TRZA 3CC2A 1Q46A 3BZKA 4OONA 3AFPA 2R7ZH 1HZBA 1S40A 1MKHA 3GTLH 3G48A 1KRTA 1Y14B 2D0OA 2VQEQ 3J81c 1NE3A 4ME3A 2OWOA 4GN5A 1Q1BA 1IXRA 3OW2A 1I3QH 1WOCA 2JEAI 3WWVA 3HKZG 2RCNA 3S2DH 4DR4Q 4QQBX 4DR5L 1D8LA 1X54A 2ZTDA 1GKHA 4DR1Q 3CC4A 3S2HH 3STBD 2Q2HA 5M5XH 4P75A 2YV5A 2E2JH 4H02A 1BBUA 3GTQH 1XPUA 4GLAC 2PQAA 3UDXA 3FP9A 3PGZA 5ELOA 3GO5A 4DUZQ 4LF8Q 1M90C 3S1QH 1VQKA 1I50H 1XMOQ 2NVQH 3LGJA 5C0XI 2Z0SA 1Q12A 5M3FH 4LF8L 2JA5H 1XTDA 2JA8G 4DR7L 4Y52H 4GOPC 2MO1A 1PYSB 4AH6A 4DR3L 1K8GA 1YJNA 5GAHC 1K9MC 1EIYB 4UY8C 2NVTH 4IPGA 4A3GG 5IP9H 3PCOB 1N32L 3S1RH 1PH3A 1P16A 2JA9A 4Y7NH 4XIGS 1W2BA 4GN3B 1QZHA 3HOXH 5IYBH 3GTGH 4TQUS 4HJ9A 2F3IA 5GAEC 3T1YQ 1EQRA 2YU9H 4JI4L 1ASZA 4HIMA 2IX1A 1SR3A 2HT1A 3M4OH 2JE6I 3E9IA 1UE1A 3PUXA 3KF6B 2GN5A 4LFAQ 1LYLA 4DUYL 3ULPA 3GDEA 3T1YL 1KQSA 4A93G 1HZ9A 3D0FA 4A3JH 4HIKA 5C3EH 2GVAA 3UDGA 5C4XH 2N3SA 4LFAL 3M3YH 4JBMA 5C44H 3JAMc 1HR0Q 1TWAH 2PI2A 2R7DA 4IPDA 2JA7H 4DAYB 3I4MH 3EBEA 2F4VQ 2JJQA 2OTJA 4A3IH 3OTOL 1PH2A 1JJ2A 1HR0L 1JMCA 4NXMQ 2IY5B 1E7ZA 3OYYA 3IRBA 2CQOA 1TWFH 3B6YA 2HIXA 2F4VL 3CD6A 1VQBA 1XJVA 1M1KC 3PUZA 2C35B 3K0XA 1V1QA 3PUYA 1E1OA 4IPHA 4IFDJ 1E24A 2KBNA 1YHQA 3J7A5 1NMGA 4AYBE 4JI3Q 2JA6H 3NEMA 5M5YH 1BKBA 3H15A 1XMQQ 1Q82C 4LF4L 1ASYA 4R4QA 3CMEA 4DV1Q 2PI2E 1N34L 3ICEA 4IJLA 2JA5G 2PNHA 2WFWA 4DNIA 4DV5Q 1CUKA 2DUDA 3PO3H 5JJIA 1Y1WH 4DKAC 4KHPL 4DV6Q 1VQ6A 4PMWA 2QEXA 3CCVA 2KCMA 2NN6G 1EOVA 1TWHH 5IP9G 5AJ3Q 4DV5L 1Q8KA 1QVFA 3ULJA 4JOIC 5IYDG 2NZHA 2E2IH 3HOYG 1WI5A 4A3MG 1E22A 2UUAL 4AYBG 1EYGA 3HOXG 1PH7A 2UUCL 4LF9Q 3PUVA 3S1MH 3EIVA 4OO1I 2JEBI 5M3MH 1BBWA 3K81C 4GNXB 1EWIA 1L0WA 4LF9L 1JJGA 1JE5A 1CKNA 1VQAA 3W1GA 4YCVA 4LFCQ 3H3VI 3L0OA 4A3JG 5C3EG 2VZAA 5IY0A 4DV7Q 4GNXA 3CW2C 1HZAA 5C4XG 5C0XJ 4X64Q 3PF5A 1GVPA 1N36Q 2LSSA 3F2DA 1PH1A 1IBLQ 2Z6KC 2D0PA 4DV7L 1K8AC 2B63H 1IBML 2JA7G 3I4MG 4A3DG 1XNRL 4K0KL 2JA8H 4A3IG 2K5NA 3TEHB 2A19A 3KJPA 1A62A 2H5XA 2RHSB 3RLNA 5ELNA 1N36L 4JI0Q 1V43A 2L15A 4APVA 1YITA 1H95A 2A8VA 4B3MQ 3FKIH 4OWWB 2I5HA 4X62Q 4A3GH 1S3OA 1Y1VH 2N8NA 2WB1E 1L1OA 2EIFA 4HIOA 1VQPA 3I55A 4B3ML 4L5QA 1UWVA 2PQAB 3ZJYC 4X62L 4LF7L 2JA6G 1BVSA 4UP9A 1FJGQ 3S1NH 5LMUL 1A63A 2R6GA 4QL5A 1B8AA 2KHJA 4B3SQ 3PO3G 3A5ZB 1FJGL 2MQHA 3S14H 1G6PA 1YVCA 1CKOA 4GLVB 2K50A 4A93H 4J15A 4GKJQ 4B3SL 4BY1G 1J5EL 1PH5A 2WB1G 3CF5A 5IYCG 2CFMA 3K7UC 3J81i 4BBSH 1QUQB 4WJ4A 4GKJL 1NTGA 2A1AA 1KIXA 1X6OA 5JEAG 4DR5Q 1K0RA 2FXQA 1IYJB 1LTLA 1WYDA 5M3MG 3T1HL 4QIWE 3PSIA 3CCSA 1J6QA 4POFA 2DGYA 3KF8B 5HGQA 1W3SA 2JQOA 1WFQA 2AWNA 2QA4A 2UXBL 4MNOA 4BA1I 3CCMA 4O2DA 1B70B 2AHOB 4JV5L 3S17H 1PV4A 4DR7Q 1AE3A 1VQGA 1G51A 4LWCA 3DM3A 1S72A 5M5WH 1YJ9A 4YCWA 2B63G 2N78A 4YY3L 4DR3Q 1K83H 4DR6L 1V9PA 3A74A 2ASBA 1N32Q 2YTYA 1VQ8A 2BH8A 4JOIA 1Q86C 1GM5A 1CSQA 1Q1EA 4HIDA 1PH4A 3FKIG 1EQQA 1IBKL 1Y1VG 4IOAA 1VQEA 3K7AH 4BBRH 1TXYA 1SMXA 2IHEA 3M85A 1I5FA 2R93H 3CC7A 5IYDH 3RNUA 4JI4Q 2VUMG 4A3MH 2XTIA 4NXNL 3HOYH 3AQQA 1TWCH 3L7ZC 3K8AA 1K3RA 3DLLA 4L5TA 1VQOA 1NY4A 1AH9A 4DUYQ 4JYAL 1FL0A 1VQCA 2R7FA 1E1TA 4YWKA 3CMAA 3SGIA 1OXUA 1OXVA 1YEZA 3UDIA 3M7NA 2WP8J 4L5SA 4DPGA 2UXCQ 5FLXc 3CCEA 3BU2A 2LXKA 4A3CG 3FHWA 3JAMi 5JJLA 3K80C 2ZM6L 3OTOQ 1YHAA 4BBSG 1NJIC 2CCZA 2UXCL 3RLFA 4A3DH 2I5LX 4LUVA 2KENA 4R4TA 4JI8L 1HZCA 3KJOA 2I0QA 2ATWA 1CKNB 4JCVE 1VQ4A 1D7QA 2ALYB 2K75A 2D62A 5FJ8G 4LF4Q 5GQOA 3Q8DA 4DV3L 4GNXC 1N34Q 4GKKL 4JI1Q 3W1BA 2K4KA 3ER0A 2OQ0A 1KD1C 3S24A 4KI0A 3PV0A 4JI1L 1WJJA 4DV0L 4GN4B 4HJAA 2XGTA 2BH2A 3HOVH 3H0GH 4C3JH 5J3BA 3NBHB 4JBKA 1X55A 4BY1H 2UUAQ 4OX9Q 3GD7A 3A5UA 1SN8A 4BBRG 1EFWA 5IYCH 2UUCQ 2R93G 1L1OB 2KCTA 4BA2I 3L2PA 4OX9L 4R4OA 5C4JH 1O7IA 3AYHB 4B3RQ 1KXLA 1JJCB 1UE6A 2NN6I 1SFOH 3CCLA 4BY7H 3KOJA 4PG3A 2MO0A 5IWAL 1C7YA 1X3GA 3U4ZA 4PZ7A 4P73A 4B3RL 1R9TH 1I6HH 4X6AH 2E8GA 3CP0A 4A4IA 1OLTA 1Z9FA 4UP8A 1G291 1VS0A 4MZ9A 4JC0A 3M4QA 2ZTCA 1IBMQ 3M9BA 2EXDA 2ZJRA 2F52A 4K0KQ 3UDFA 3M4PA 3G4SA 4LFBQ 3VDYA 1XPRA 4GOPA 2HHHQ 5K36G 1X3FA 1N8RC 3PF4A 5IT9c 4LFBL 1K73C 1UE5A 3CCRA 4A3KH 2HHHL 4XTCS 3GTKH 1YBYA 4DR2Q 4LF7Q 2JK8A 2E2HH 1YIJA 1XNRQ 2I5MX 2VS1A 1HH2P 1SE8A 3D31A 4P74A 4YCUA 1VQIA 2VY3A 4YHHQ 5LMUQ 2R92H 3TS2A 4DR2L 4TVAB
chains in the Genus database with same CATH superfamily
1Q8IA 4C2MB 3J81E 5IE8A 4KD4A 4HJ5A 1HR0W 5D14A 4CDDC 1Q81C 2E5LL 1EIGA 2IX0A 2UUBQ 4K5VA 1M4VA 5KRUA 5G3LF 2X69A 3U9SA 4IFDG 2AUKA 4OHJA 1C4QA 3T1HQ 2ZTEA 2CH4A 2VNUD 3D4RA 5CV8A 2UXBQ 3F1ZA 1BCPD 4I7AA 1ZYRD 3KDFA 2PCFB 3CHBD 1BBXC 1U4MA 1EWCA 3S16H 4YY3Q 1PH9A 4A3FH 2VQFL 4EQNA 3A54A 1TWGB 2MPMA 2ZJPA 1IBKQ 2VQEL 5T1IA 4IUQA 4XYQA 4DV2Q 4IN3A 5FLXE 3TS0A 4LNQA 1PLFA 1NNXA 2PQEA 3KLWA 4L5RC 4R8IA 3CQZB 4H0LC 1B3AA 3W5OA 3E0EA 3U58A 1XNQL 2K5HA 3CCJA 3MVVA 3A56A 4JI8Q 4OWXB 1AE2A 4CJ0B 1HNXQ 3H0GB 1V8QA 4LAAA 1RIPA 5EAYA 3HS0C 1EIFA 1H9SA 4GKKQ 1JE4A 1QNKA 4LW1A 4ALPA 1B7YB 1ILPA 2F0LA 4DV0Q 3RZOH 3FPPA 2F0UA 2KHIA 3I4NG 2I07B 3BJUA 3SR1A 4I65A 3J7AF 2EY1A 3EN2A 5CBAE 1FGUA 2G5DA 3RLOA 2WACA 2UXDQ 1KDBA 3C46A 2K5WA 3MZ5A 2LXJA 1DGSA 2CKZB 4IFDH 1WTRA 3VR5A 1IZ6A 2QGQA 3E9HA 2K5VA 3J7ZC 2E2DC 3I7FA 4NB3A 2AQ1B 4DAMA 2Q2UA 5IGBA 3QG1A 4QGUA 3TQYA 2VUMH 2EY6A 1HNWQ 2K04A 4IO9A 2L0CA 1KAAA 2A68D 3KF6A 4DV1L 5JPMC 1DYQA 3A0JA 4PNYA 1H9KA 2RF4A 3Q0AA 4RGTA 1T9HA 4ULLA 4DF7A 2Y0SB 4ZK9B 5GAGC 3HOWG 3KDFB 1EUJA 1PZKD 2OXPA 4L8JA 2ZT9C 2NVXH 4LF5L 1GUTA 2E5LQ 1YHBA 4ZAIA 4OL7A 4JI7L 1R4QB 2F0KA 3S15H 2QF7A 1X3QA 1A6XA 3S16B 3IFTA 1HFGA 2A74C 1HA5A 3FMCA 4A3FB 1QB5D 1VMCA 4DGZA 1LT6D 2RVLA 4IUTA 4RHRA 4PZ8A 3TN2A 1LTRD 2NVYH 3G6EA 2N49A 4MTKA 3CKIB 3U9OA 5JJKA 4BXXG 4GNXA 4RMFA 3KYHC 3I72A 4GS3A 5GROA 4A3LG 1F2MA 5M5XB 2VQFQ 1Y1WG 1U0LA 2BDOA 4X65L 3TRZA 3CC2A 4OONA 1Y14B 3V96A 2I46A 3OWEB 2VQEQ 4ME3A 5M3FB 2OWOA 4GN5A 3OW2A 2JEAI 5I9OA 2RCNA 1LTSD 1H9SB 2QCPX 3EVQA 1D8LA 2ZTDA 1GKHA 4P75A 2F0PA 1GUSA 2NWGA 1JORA 2BE5C 3GO5A 3S1QH 1M90C 2YU9B 2JYOA 5D3DA 1RHPA 5NUCA 1RTOA 2JA5H 4A3JB 3RZOB 1PYSB 4AH6A 4L6TB 4DR3L 1DOLA 1YJNA 1K9MC 1DXMA 4IPGA 1XWEA 5IP9H 3S1RH 1P16A 2JA9A 4XIGS 3ITPA 1SNOA 5GAEC 3T1YQ 5ELCA 1TIID 3KF8A 3M4OH 3E9IA 3ULPA 3KF6B 2GN5A 5J22A 1KQSA 2SEBD 1BUVT 1HZ9A 1TR5A 2JA6B 3I90A 1I4HA 2N3SA 3JAMc 1CI3M 2VUMB 2R7DA 4IPDA 3C3LA 1I4RA 1PH2A 1JMCA 2IY5B 2CHBD 4RA8A 3M7GA 3IRBA 1PZJD 2KUMA 1EY6A 1M1KC 2C35B 4MHEA 5CYUA 1CHPD 1SYEA 1E1OA 2EVBA 5IIFA 1E24A 1YHQA 4IFDJ 1X3PA 4AYBE 2CW0D 3NEMA 5M5YH 3P75A 4KHPQ 2DN8A 3CMEA 4DV1Q 2PNHA 3GP7A 4DV5Q 5JJIA 3BVMA 1Y1WH 2NVXB 3E0JA 1SNQA 1WTOA 1S5ED 3CCVA 4X3SA 3WOFA 1TWHH 1Q8KA 3ULJA 3S15B 2HDMA 2SOBA 4IUUA 1YNND 1D6EC 4AYBG 4B9XA 5JEAH 2UUCL 1V1OA 1TKWB 1X32A 5KEEA 4GNXB 1EWIA 2Z9HA 1CKNA 4IUNA 3H3VI 4K5XA 1I4XA 2NVYB 1Z6HA 2ZXRA 1XTCD 3PF5A 2L55A 1N36Q 2F3WA 3F2DA 2Z6KC 2DNCA 3K6OA 3I4MG 4Q5VA 4K0KL 4A3IG 2F0OA 2RHSB 4A93B 1V43A 2L15A 3NBHA 4B3MQ 4OEMB 4OWWB 4ABNA 4ZUIA 2N8NA 2KEDA 2F0JA 1EQVA 3I55A 1UWVA 4LF7L 4UP9A 3S1NH 2Z4HA 1Y8NB 4IALA 5LMUL 2KECA 4B3SQ 3A5ZB 3S14H 1RKNA 1YVCA 1NR2A 4XYOA 4J15A 4BBSH 1ML0D 3FVQA 2C5CA 2FXQA 1QG7A 5J1ZA 4KJNA 2F0FA 1J6QA 1E0BA 2IW3A 4QMGA 1SYCA 1PTOH 2DGYA 3KF8B 2RDGA 5DM73 1WFQA 3HOYB 3CCMA 1UUPA 1MSHA 1B70B 4JV5L 5A2QE 1EYAA 1S5BD 2O5IC 3A8KE 1AEXA 2B63G 5M5WH 4YCWA 2C9OA 4BS9A 2N78A 5E4XA 4DR3Q 3NTIA 4G7ZC 5EBCA 1VQ8A 2BH8A 1GM5A 1CSQA 1PH4A 5D3IB 3K7AH 2R93H 4NXNL 3AQQA 3L7ZC 4U68A 1EWHA 1K3RA 3HG9A 3DLLA 4G7HC 2XWBB 2R7FA 4YWKA 4EVOA 5DEHA 1G8ZD 3D4DA 3SGIA 1F2YA 2KVMA 3M7NA 2WP8J 4QUCA 4L5SA 3NSWA 5M5YB 1LLRD 3W2DA 2E74C 2XNAC 1IKMA 4LMQD 2I5LX 5FO8B 2J4XA 2D9UA 4ZQ3A 4R4TA 2ZXPA 5CORA 1TWHB 2NTTA 3KJOA 1SMYC 2I0QA 2ATWA 1TVXA 1CKNB 2A6HC 1SNDA 2D62A 3MXUA 5GQOA 2AUJD 2K4KA 4BY7B 2HCIA 1R9TB 4KI0A 1WJJA 4JVZA 2XGTA 1GHJA 2BH2A 3HOVH 2OF1A 1B50A 3NBHB 1X55A 5T1GA 3GD7A 2UUCQ 3HRZC 1D1IA 1UEAB 3L2PA 4OX9L 1J8IA 4R4OA 4B3RQ 1KXLA 1JJCB 4QIWB 5BN3A 3CCLA 4PG3A 3VA5A 3U4ZA 3OIPA 3UI2A 1OLTA 4NW2A 1VS0A 2ZTCA 1PMRA 2L11A 2EXDA 2WINB 3M9BA 2F52A 2ZJRA 4K0KQ 3M4PA 1X3FA 5IT9c 4KHVA 3K5MA 1K73C 3CCRA 2EJGC 1PXUA 3TP5A 3FEWX 1YBYA 1EL0A 4LF7Q 4BBSB 2E2HH 2A69C 2I5MX 5I2XA 3D31A 4YCUA 4P74A 1VQIA 5LMUQ 3K58A 5CGKA 1XNRL 4YHHL 2QEJC 1WTHA 2K6AA 1HHVA 1F9SA 3SK5A 2PZTA 1WVLA 3H0GG 1D2BA 1HUNA 5ELBA 1Z47A 1U9RA 1AFPA 5M5WB 2UUBL 5BN4A 3EROA 1VF5C 1ET9A 4I7ZC 2Z4IA 4UAIA 3BDOA 1VQDA 4C2MH 3F2BA 3K7AB 1HNZL 4JV5Q 3NENA 4JI6Q 2R93B 1EQTA 3HOUB 1GO3E 3J80c 2J7ZA 2EYLA 1A0IA 5CV6A 4A3BH 3P7JA 2OQKA 3Q22A 3NUCA 3LWEA 3AFQA 3IAYA 1HXYD 4MN3A 5EKLA 2Q2IA 5EPLA 4A3KG 3T4AC 3MEFA 1PFSA 2Y0SE 4NXNQ 3NELA 1OXSC 1LTID 3GTPH 1JB3A 1EEFD 1YNXA 1HQMC 3OHXC 1UEBA 4DR4L 3MWYW 3DM1A 4DR1L 1IL2A 4DV2L 3PO2H 3SDZA 1N33Q 4WORA 1TWGH 1YZ6A 3QO2A 1IKLA 4HR7B 2ZJQA 2Y0SG 4JG2A 2Z6KA 2B8GA 4NMZA 5E3FA 2CH4W 1WTVA 2B2TC 3ULLA 3N52A 1PRTF 4DA2A 4OO1H 4NDXA 2WIIB 1TS4A 4LUOA 2VW9A 1QUQA 1VQ5A 4RH1A 1OXXK 3OSOA 1NR4A 2B29A 5EPKA 3HOVB 1VQLA 1PYBA 2Z6BA 3CAMA 1HNXL 5FKAC 4B3TQ 4QCLA 1CK1A 3CQZH 1VQNA 4CKEA 3H94A 4G4KA 2IX3A 3I2ZA 4A3FG 1LM0A 1IW7D 2JN4A 1B3QA 1U5KA 1QNUA 1DOMA 1X65A 5KNCA 4AQYQ 1SYGA 4JI5Q 1K8MA 1TY0A 3HOZH 3TREA 2UXDL 3CCQA 2AKWB 1SBBB 4IJHA 1VQ9A 4ZCKA 4DXFA 3V2TA 3G71A 1TS5A 5M3FG 2YTXA 1O7YA 3J81L 4X3KA 1XMQL 2WKCA 3GTOH 1HNWL 2MFIA 5BR8Q 3MAQA 2AWOA 4DAYA 3JC66 3Q23A 3CXCA 2F0QA 1VQJA 2EPBA 1EIHA 2H4OA 1X3EA 3RZDB 3GV6A 2UU9Q 4RHSA 4R1JA 3BDLA 1SXTA 2WAQE 2YTVA 1OXTA 3LWUA 3PIPA 3QR8A 2IT1A 3MEHA 5HURA 1QILA 2A6ED 4QY7A 2L4NA 5FO7B 2MNAA 1HFNA 4A3BB 1PTOD 1VQHA 2B3GA 3KLSX 1JWSD 2R7ZB 1IBLL 1KHIA 4POGA 4UPAA 1MHWC 2YYZA 3U4VA 3K5LA 2K1BA 2WAQG 2K5QA 2Z8LA 5IGGA 1I4QA 1HNZQ 2KQ3A 4X66Q 4FHGA 2PMZE 5KNDA 1LV9A 4KN7C 5FLXL 1PVOA 2CVRA 4IFDI 3GTPB 2NZOA 4P72A 2VUMG 4KHZA 4NPSA 1Q46A 3BZKA 4DXGA 3PO2B 3GTLH 5DM63 1S40A 1I50B 2XRSD 5C4ZA 2D0OA 3J81c 4FXKC 1I3QH 3RMHA 3PMFA 2PZWA 5DAUA 4DR4Q 1B2TA 3I3CA 4DR1Q 3CC4A 1DD2A 4ILWA 3STBD 5M5XH 2BCOA 1BBUA 4V190 2PQAA 3FP9A 4LF8Q 5ELOA 4H44C 5C5LA 2L1BA 3R2TA 4FXDA 1I4GA 1Q12A 5M3FH 2K05A 1XTDA 4GZYC 4Y52H 1JC7A 1K8GA 2NBFA 1LT5D 2A73B 3T51B 1PH3A 3PQIA 2F0VA 2XN9C 1QZHA 1O80A 1M8AA 2F3IA 3HOZB 2YU9H 1KABA 4HTHA 3CANA 3DWQA 1UE1A 3T1YL 1LYLA 3GDEA 4A93G 4A3JH 4HIKA 3UDGA 1GJXA 3WDNA 1HR0Q 2PI2A 1LTTD 1WTQA 4DAYB 1JJ2A 3GTOB 1FYCA 1TWFH 5CV5A 3T53B 2HIXA 1JCKB 5JJZA 3PUZA 2IWHA 5EKKA 1RD9D 1JOQA 4CJ2C 2JA6H 2TMPA 4HAEA 3H15A 1XMQQ 2AQ3B 1LT4D 1ASYA 4R4QA 1DCZA 5COYA 2JA5G 4DKAC 4KHPL 3FPUB 1CTMA 3D6WA 2QEXA 2NN6G 3T16A 4DV5L 5IP9G 3PIP3 5CV4A 4FXGC 2NZHA 2E2IH 3HOYG 2UUAL 5I6YA 4LF9Q 2XIWA 1PH7A 2XRQD 2JEBI 5M3MH 1BBWA 3K81C 4A3GB 4F88A 1IL8A 1NAPA 4J1MA 1VQAA 1AZPA 3L0OA 2SDFA 1GOZA 3K5OA 1GVPA 3IKJA 1IBLQ 1K8AC 1IBML 1FNUA 2B2TA 2A19A 1N36L 1GUGA 3DWAA 3GTLB 1YITA 2DJFC 2L9HA 5IGFA 3MC0B 4X62Q 1Y1VH 1ZYRC 4B3ML 1I3QB 4CJ1B 2PQAB 2N88A 1FJGQ 1A63A 3H3VC 2KHJA 1E2WA 1GHKA 1G6PA 5ELDA 3KK7A 1CKOA 2MUYA 4GLVB 4A93H 4B3SL 1GXDC 1J5EL 1PH5A 5IYCG 3K7UC 2J0TD 1CQVA 4HSPA 1STHA 2EOTA 5I2YA 1X6OA 5JEAG 1D5MC 1C48A 4QIWE 1PRTB 4POFA 3EA6A 2AWNA 4MNOA 4XT1B 1G2TA 1AE3A 1G51A 4LWCA 3VA7A 2DNEA 4F7XA 1K83H 4DR6L 1IYUA 3TZUA 1TT2A 2YTYA 1BNZA 4JOIA 1Q86C 2NN6H 1VQEA 4BBRH 1SMXA 2IHEA 4TRDA 3M85A 2H1EA 4A3DB 5IGCA 3HOYH 2XTIA 3EJIA 3QJYA 3DMUA 1NCVA 3NP8A 4XQQA 4R8NA 1NY4A 4K2KA 1TWFB 1AH9A 1NSNS 2KHSA 1FL0A 1U4RA 1E1TA 5CC4A 3CMAA 3UDIA 3E6ZX 2UXCQ 3CCEA 1BCPF 3AMUA 3CU7A 3BYTB 3JAMi 3K80C 2ZM6L 4BBSG 1YHAA 2F0NA 1F2ZA 3NQTA 3RLFA 2Q8RE 2FJ2A 4LUVA 2KENA 2OEOA 1XYIA 4BY1B 2XSCA 1JR0D 4KMUC 2LMCB 4C1NK 1L0XB 2E2IB 1LTGD 1VQ4A 2K75A 5FJ8G 4JI1Q 1SFOB 2A68C 3MXNA 5M3MB 2OQ0A 3S24A 4DK1A 1Q3LA 4GN4B 1STGA 1NUCA 4C3JH 5J3BA 1RCVD 2UUAQ 1ESRA 1EFWA 2R93G 5IYCH 1MGSA 1SYBA 1O7IA 1ESFA 3AYHB 2N55A 5FOBB 1UE6A 2DJGC 4BWGB 1STNA 4BY7H 3LX0A 4ZKBB 4KK7A 1C7YA 1Y1VB 4P73A 4PZ7A 1R9TH 4B3RL 1I6HH 1FR3A 3G7LA 2E8GA 2JSOA 2HUGA 4J8QA 1Z9FA 5C5MA 4UP8A 5IGDA 2VB2X 1G291 4JC0A 1K3BC 1IBMQ 3UDFA 4LFBQ 3VDYA 5I6WA 3HZXA 2DY7A 1BR9A 1N8RC 1BOSA 3NTKA 1UE5A 4N9PA 1EU3A 3GTKH 4DR2Q 2QILA 4IQZA 1HH2P 1SE8A 3KBGA 1FNVA 4PMBA 3MHBA 2R92H 3TS2A 4E6IA 3CPFA 2K52A 1RF2D 5GADC 2D5DA 2Q2TA 3NXWA 3BG3A 1J5EQ 5A2QL 4XQNA 1YJWA 3BYYB 2F1MA 5I4DA 3HOVG 2F0TA 3CCUA 1SJHD 2F0DA 4YWMA 4TSSA 3TBIB 1LTAD 4LF6Q 4OIKA 3I4OA 1K83B 3AB9A 5H1SE 4LUZA 3R8BA 4DAVA 3F2CA 5JAVA 3NQIA 4KKTA 4BBRB 3RN2A 4ME5A 4N8X1 1QZGA 2FINB 5FJ8H 3I91A 1Y69U 4FF4A 4JI6L 4DR6Q 4NP5A 2VB3X 1KAWA 3UE0A 1I94Q 4IOCA 1MJEA 2PW5A 1STEA 4ZUJA 1BDOA 2EDGA 4MIUA 3R3OA 1F9RA 1EYDA 4RAUC 4FYDA 1STBA 4FHFA 4FHDA 5C0XG 3HOUH 3MXNB 3OW7A 4DV4Q 2F0GA 5CMDA 1EY5A 1WCMH 4HEDA 1JICA 1VQMA 1Q7YC 1JT8A 4H7BA 1A15A 4P2CB 1VCIA 1RDPD 2ZM6Q 4DUZL 1N33L 3IL8A 1XMOL 1AZQA 1LT3D 4C3IH 3TDQA 1OTCA 3H3VH 4C3JB 5LMNW 1L1OC 3Q24A 1FVIA 5FLMH 4RH6A 2DY8A 3AEVA 4HCEA 4RFBA 1HQRD 4OIJA 4A3BG 2R7ZG 4B3TL 3ERSX 4DK6C 3I70A 4R4IA 2O2LD 3PIOA 1I6HB 3HFZB 2NUCA 4HSVA 2RBMA 4AIMA 4OXPA 5ELEA 2F0HA 1YNNC 1ONLA 3QWNA 4K9RA 1QE6A 1L2FA 4AQYL 5FO9B 4JI5L 1ZKOA 4NXML 4PV1C 1PFNA 2IHFA 2F0IA 3TZDA 4FNFA 3PO2G 1UE7A 3GTKB 3WOEA 5JEAJ 1SAPA 5IT9E 1NBWA 3HEJA 5IP7H 5CV7A 1CA6A 2R92B 5BN5A 3RN5A 1AW7A 1YNJD 4PZ6A 2EQSA 3BZCA 1PH8A 1ET6A 4OO1G 1LO5D 4KD3A 4ZLTF 1O78A 4DV6L 5KYLA 5BR8L 1PA6A 5AJ3L 2R61A 4WRDA 1CKMA 1WD1A 1MIUA 1JOKA 4Z9CB 1A8VA 2ID0A 5C0XH 5DLQE 2UU9L 1PRTC 2E76C 2F3VA 3C1FA 5IGEA 1ICFB 3OOCA 3GTJH 3H6MA 5EKIA 1SLJA 4QF4A 1STYA 1QVGA 3O13A 2B2VC 1XPOA 4C3HH 4A3EB 1PHJA 1CA5A 3RZDH 3HOZG 1N9WA 1HUMA 2VL6A 4P71A 1BXTA 1PH6A 4FO2A 3J80E 1LUZA 1ZEQX 3EFXD 1TS2A 2HQLA 5LMNQ 1PYWD 3L3OC 1VDZA 1CHQD 1C9OA 1QVCA 4A76A 3S2HB 4OELB 4X66L 3J80i 2R7ZH 1JWUD 1WCMB 3G48A 2NVQB 1B53A 1Q1BA 1IXRA 1S5FD 1WOCA 3BZDB 3WWVA 3S2DH 4C3IB 1X54A 4KKSA 3ERQA 2E2JH 4UHVA 5JVH3 3GTGB 1WTXA 4DUZQ 2RSOA 1VQKA 1I50H 1ILQA 1XMOQ 3LGJA 3NPPA 2Z0SA 5C6AA 4LF8L 5I9PA 2F03A 3RD4A 4ZYSA 2RDHA 4GOPC 5EPJA 1EIYB 3BDCA 4UY8C 2NVTH 5C44B 4A3GG 2KJXA 1TWAB 3PCOB 3PIO3 3NE5B 4KTAA 1QJOA 1W2BA 4GN3B 4FF1A 1B44D 3HOXH 4TQUS 1BO0A 2QKIC 3QOLA 3T56B 2JE6I 4LFAQ 3PUXA 4CDCC 3D0FA 1EY9A 5C3EH 5F2DA 5C4XH 1RJTA 5FK9C 1EEID 3P20A 4JBMA 2HQEA 1A2TA 2JA7H 1KNAA 2LKVA 2XWJB 3EBEA 2F4VQ 4HMJA 3BVGA 4RKLA 4O42A 4YIJA 3OTOL 1HR0L 3ND8A 4NXMQ 2V4DA 2CQOA 3MA2B 1EY0A 1IHZA 1F9PA 1QOHA 2KCNA 1XJVA 3FDTA 1S5CD 4JPBW 1ICWA 3K0XA 1II3A 1V1QA 3PUYA 4IPHA 1FNWA 4CKBA 3HKZB 3TP8A 4FF3A 1O7ZA 3VYSA 2Q8TA 3ICEA 1H9MA 2PI2E 4IJLA 4CHTB 2WFWA 4DNIA 3PO3H 1KLUD 4DV6Q 1VQ6A 3H91A 4PMWA 3GTJB 1EOVA 5AJ3Q 2B2WA 1QVFA 4JOIC 1WTWA 1WI5A 1EY7A 3VR2A 1E22A 2X6LA 2JA8B 4C3HB 5C3WA 1CFMA 3M4YA 2FHTA 1BF4A 3OIQA 3LNNA 5E4WC 3S1MH 1Q90A 3E5SA 3E3XA 1VF7A 1L0WA 4LF9L 1JJGA 1GUOA 1JOOA 4XT3B 5EBDA 4A3JG 1BQQT 4RGNA 4DV7Q 3CW2C 1HZAA 1SSOA 5C0XJ 4TKOB 3P1HA 1PH1A 4A3DG 2D0PA 3MFYA 2PNRC 2K5NA 2RCFA 1A62A 2H5XA 4FVMA 2O4XA 4HCSA 4APVA 1XXGA 2A8VA 2B2YC 3FKIH 2EXZA 2I5HA 3X3NA 4A3GH 2O5JC 2RKSA 1EYCA 1L1OA 2EIFA 4HIOA 1VQPA 1KTKA 1HCZA 4L5QA 4DAPA 2JA6G 4X62L 3KBXA 1BVSA 3S2DB 1HPCA 3DEOA 4IUVA 1PFMA 2KOLA 2SNMA 2E2JB 3MXPA 3G6JB 1FJGL 3DEPA 3S17B 1MSGA 4GKJQ 4K14A 4BY1G 3CF5A 2CFMA 4N8FA 3J81i 5KNBA 1QUQB 5EGTA 4PQXA 1NTGA 1A3TA 1SNCA 1K0RA 1IYJB 1ENAA 3SXHA 4XDXA 5M3MG 2NVTB 3CCSA 2A5HA 4ODGA 1SYDA 1W3SA 2JQOA 5ELFA 4A3MB 3TP6A 3HOXB 1VQGA 3CRLC 2K01A 3MXGA 1V9PA 1F77A 5AFWA 2EZVA 5C3EB 3T13A 5C4XB 1SYFA 3GV3A 3ZYYX 1TQOA 1Y1VG 4IOAA 1TXYA 2JA7B 1GUNA 1I5FA 2P5ZX 3CC7A 3RUZA 1CM9A 1TWCH 3K8AA 3AU7A 1VQOA 1RTNA 2WKDA 5KYIA 4JYAL 1Y8OB 1VQCA 1IW7C 2M00A 2F0EA 2MGSA 1OXVA 4LK1C 1EOTA 4C1NI 4CDFC 3D3RA 1B1ZA 3VYTA 2K33A 4DPGA 2BE5D 2JXMB 5FLXc 2LXKA 4A3CG 2B2VA 3OTOQ 2UXCL 2CCZA 4A3DH 5K36H 3PO3B 4FF2A 3NWTA 2AQ2B 2WB1B 2PO4A 2PW7A 4JCVE 4KJOA 5C4JB 4DV3L 3Q8DA 4FHCA 3S1MB 1E2VA 3W1BA 1KD1C 3ER0A 4JI1L 4HJAA 1MI2A 1S5DD 3V05A 3J7YW 3H09A 1G91A 4JBKA 4BY1H 3A5UA 1SN8A 4BBRG 1L1OB 1FGBD 3ONAB 5LL6X 2EYJA 4A3KB 2NN6I 4B9WA 1SFOH 4CKCA 2MO0A 5IWAL 3FKIB 1X3GA 4HN7A 3TSSA 1F9QA 3R93A 2QDLA 2A6EC 4F87A 4MZ9A 3DWPA 3M4QA 3TMEA 1PTOC 3KLSA 4DNTB 5CV9A 4GOPA 2HHHQ 1CQFA 3VYUA 1TU2B 4LFBL 4LJZC 5CBEE 2KEEA 2ICIA 1B9NA 4XTCS 2JK8A 1YIJA 1BCPC 1DONA 1JWMD 2VY3A 4DR2L 3MFGA 5IODA 1EZ6A 2CWPA 4PMCA 1KC8C 4JBWA 3CPWA 2MP1A 4RCOA 4ZRZA 3SK6A 1H9JA 4C3JG 5HY6A 1SNPA 2F0MA 2X6GA 1D1KA 4A3CH 1QWYA 4IZ8A 4MTNA 2EYPA 3STBC 1XX8A 2CWAA 2RDFA 4LF6L 2BA0A 3A8IE 5KGUA 1KRSA 4BY7G 1SROA 4GLXA 4KN4C 4RG1A 1KL9A 1SEBD 2EYHA 4K6DA 2FFKB 3RR5A 3JAML 4JI2L 1TWCB 3OPOA 4KY7A 1E2ZA 4HMIA 2FMCA 3R2IA 1A3VA 1H9RA 2CQAA 3F8TA 5CR3A 1CSPA 1MJCA 3I4NH 2LFNA 3UE1A 1SE4A 1I94L 1C0AA 5TSSA 1SDFA 2BA1A 2K14A 4IURA 4JBJA 1PTOF 4EQ5A 2R92G 4JYAQ 2MHVA 2EYMA 1B9MA 3JAME 3J7AV 3U50C 2OTLA 2B2UC 3EQLC 1XNQQ 4DV4L 2GVBA 1CZGA 4HJ7A 4N9TA 1SRUA 1YI2A 2IJ0A 2D2CC 4B08A 2B8FA 3VR4A 3QIAA 2B2YA 2QDBA 4R4CA 4UP7A 1EU4A 4KY5A 4DK0A 1E3PA 2HIVA 4Q0FA 3HOWH 1TY2A 4JK1C 2NZ1D 4DV3Q 3BS1A 1LABA 5E7NA 4YWLA 2WAQB 2XVSA 4RGOS 4DFAA 4HJ8A 2F0WA 4A3EG 1NMFA 1P8LA 1G2SA 4GOPB 4DNRB 2BOSA 4QJFA 3A7LA 3OMCA 4CDEC 2OCEA 5JPNC 1K0SA 4A75A 3I56A 4DK3C 3KFUA 3GTMH 4DN4M 1GUWA 4RKBA 5IOCA 5DNFA 1KDCA 3HP3A 2ES2A 1X9NA 3HOUG 3J81j 4WJWA 5IWAQ 3QB3A 5K5PA 1PZID 1MBYA 2RHQB 2PMZB 1SMYD 4V0BA 1DZ1A 3OMGA 1WCMG 2A6HD 4BXXH 4XXEA 1OO9B 3NK9A 4JI3L 4A3LH 1DM0B 4O1NA 1HRJA 1GD7A 1O7LA 2AMCB 4C3IG 4EX5A 4FHEA 1HJPA 1WD0A 1RL2A 4K5WA 2K7VA 2VXWA 3HKSA 1KNEA 5IYBG 2RSNA 4CGYB 2EY2A 5FLMG 3PUWA 4LF5Q 2E75C 4IPCA 4KLKA 4JI7Q 4OWTB 3SK4A 4O0AA 1X56A 5C44G 4LFCL 2WV6D 4K8IA 3SE0A 2FMMA 4X64L 1VQ7A 1R4PB 1VQFA 1JB7A 2L5TA 2ZXOA 4FP5D 3TP7A 2K28A 3ND9A 3I4NB 2G9DA 4WJ3M 4JI0L 4ID6A 3NBIA 2HD3A 4FDBA 1G6ZA 4JI2Q 2ENBA 2A69D 3HKZE 5EJWA 5LMNL 4X65Q 5IP7G 2K03A 2RA4A 3D8GA 1PRTD 2V1CC 5LL6S 4J6HA 3D6CA 3Q6SA 1DOKA 4A3EH 1KLGD 3AFPA 1HZBA 1QCBD 1MKHA 3S1QB 1KRTA 3KLRA 1NE3A 4X3UA 2LS01 2JA5B 2B2WC 3HKZG 1B4OA 1V1PA 2EY5A 4QQBX 4DR5L 3S2HH 1TS3A 3I8ZA 4JW0A 3S1RB 2Q2HA 4OGQC 2YV5A 1A2UA 1S4ZA 4H02A 4L63B 3GTQH 1XPUA 4GLAC 4M8AA 3UDXA 3PGZA 3GQBA 3HOWB 2NVQH 5C0XI 3M4OB 2JA8G 4DR7L 3X3MA 4C3HG 4UDUC 2GA4B 2MO1A 1VMPA 4RGMA 5GAHC 3KUPA 1N32L 2IPKD 2PPBC 4Y7NH 1SNMA 4KKUA 2EYFA 3GTMB 1W6JA 5C3XA 5IYBH 1ZXTA 3GTGH 4HJ9A 4JI4L 1EQRA 2CW0C 1ASZA 4HIMA 2IX1A 1SR3A 2B39A 5J39A 2HT1A 2OT2A 4DUYL 1HTLD 1LTBD 5IT9L 3MTSA 1UAPA 2GVAA 4S3SA 4LFAL 3M3YH 4EQOA 5C44H 1TWAH 2KCCA 3I4MH 4RH0A 3W3AA 2JJQA 1FD7D 1Y1WB 2QW7A 2OTJA 4A3IH 1E7ZA 3OYYA 1EY8A 3B6YA 2F4VL 3CD6A 1VQBA 1IYVA 5A35A 2LY7A 2MJ8A 2F4IA 1D5ZC 2KBNA 2BDNA 1Z7TA 3J7A5 1NMGA 4JI3Q 3SEBA 1BKBA 4K6LA 5G3LD 1Q82C 2ICEC 2K32A 4LF4L 4KY6A 1N34L 2TSSA 4CBVA 1CUKA 2DUDA 3QOJA 1K8OA 2JP1A 4DU9A 2EYOA 2KCMA 3I73A 3C1EA 2M9VA 1C8CA 2F0SA 5IYDG 1RODA 4A3MG 1WTPA 5LHY1 1EYGA 3K5NA 3HOXG 3J80L 1JQYD 3PUVA 1W6KA 3EIVA 2EE1A 4OO1I 3K59A 5L37A 1F2LA 1SE3A 4XQJA 3NTHA 4K2LA 1JE5A 4QUFA 3W1GA 4YCVA 4LFCQ 4U673 5C3EG 2VZAA 2B2UA 5IY0A 5C4XG 2R3ZA 4RWSC 3VR3A 4X64Q 3S1NB 2LSSA 2JA7G 2B63H 4DV7L 1EFID 1AP0A 3S14B 2JA8H 4H13C 3VR6A 3TEHB 2PYKA 3URYA 4EQPA 3KJPA 4JI0Q 1UNSA 5ELNA 3RLNA 1V1PB 1T5XD 3D4WA 1H95A 5ISRA 2WB1E 1S3OA 2HCCA 1SE2A 4F8MA 4G7OC 3ZJYC 1A3UA 1PTOB 2R6GA 4QL5A 1B8AA 5KIXA 3PO3G 1PDQA 2MQHA 3GTQB 1L0YB 2K50A 5E1FA 5JOBA 5HGTA 2WB1G 3DUZA 1J9OA 4WJ4A 4R9WA 3NWSA 4G57A 2A1AA 4GKJL 3IFDA 1KIXA 4DR5Q 1BCPB 4NKLA 1LTLA 1WYDA 3T1HL 4WFN3 3PSIA 4ZKCB 2Z1CA 5C4HA 2NTSA 5HGQA 4Y7NB 2RQXA 2QA4A 2UXBL 4BA1I 4O2DA 2AHOB 4AYBB 3S17H 1PV4A 4DR7Q 1U4PA 3DM3A 1S72A 1YJ9A 3K0YA 4YY3L 3BVZA 3A74A 2G9HD 2ASBA 5EQ0A 3A8JE 4QB4A 1N32Q 1CZWA 1Q1EA 4HIDA 3M3YB 3FKIG 1EQQA 1IBKL 1PFBA 3I4MB 5IYDH 3RNUA 4JI4Q 4A3MH 1DJRD 4A3IB 4L5TA 4IUPA 1SJED 4DUYQ 3OWFA 3A7AB 1LACA 1OXUA 1YEZA 1AN8A 2L12A 2SNSA 3BU2A 3DXJC 3FHWA 5JJLA 1KDAA 3A55A 1NJIC 1Y8PB 2EJFC 1ENCA 3L9AX 4C56C 2HDLA 3S9WA 3VYRA 4RCNA 1EZ8A 4JI8L 3SK8A 1MD2D 1HZCA 3I4LA 1D7QA 2ALYB 3N6RA 1I6VC 1STAA 3C2PA 4LF4Q 4GNXC 4KV6A 1N34Q 4GKKL 1YNJC 3SVMA 1ENFA 1EY4A 3PV0A 4DV0L 3H0GH 2KA7A 3HGBA 4OX9Q 1D5XC 1HA6A 2NB0A 1CT1D 3SHLA 2B63B 1HTPA 1I4PA 2KCTA 3CRKC 3K57A 4BA2I 5M9OA 5C4JH 5D65A 3KOJA 2E2HB 4X3TA 3DHQA 4M1UB 4X6AH 2K5DA 3CP0A 4A4IA 2M2LA 2Q8IB 5JVG3 3G4SA 1XPRA 2EJMA 5K36G 3PF4A 3FRPB 2NYZD 1U4LA 3NHHA 4A3KH 2HHHL 3F2UA 1K28A 4K8JA 2PZUA 1XNRQ 2VS1A 1T5EA 4YHHQ 4EGVA 2IL8A 4TVAB
chains in the Genus database with same CATH topology
3CPFA 2K52A 5GADC 2CWPA 1KC8C 4YHHL 5IE8A 2Q2TA 4JBWA 3CPWA 4HJ5A 1J5EQ 1HR0W 1YJWA 1Q81C 2E5LL 2IX0A 3HOVG 3H0GG 2UUBQ 5HY6A 3CCUA 4YWMA 1Z47A 4A3CH 4LF6Q 4IFDG 2UUBL 3I4OA 3T1HQ 2ZTEA 4MTNA 5H1SE 3STBC 4LF6L 2CWAA 4LUZA 2BA0A 2VNUD 1KRSA 4BY7G 1SROA 3F1ZA 4C2MH 1VQDA 3F2CA 3F2BA 4GLXA 2UXBQ 4RG1A 1HNZL 3NENA 3KDFA 1KL9A 4JI6Q 4JV5Q 3RN2A 3RR5A 1GO3E 1QZGA 4JI2L 3J80c 5FJ8H 2UXDL 1A0IA 4A3BH 3S16H 2OQKA 4YY3Q 1PH9A 4JI6L 4DR6Q 4A3FH 2VQFL 3UE0A 1KAWA 3F8TA 1I94Q 1CSPA 1MJCA 3AFQA 4IOCA 3I4NH 1MJEA 3UE1A 2ZJPA 2Q2IA 1IBKQ 1I94L 1C0AA 4A3KG 3MEFA 1PFSA 2VQEL 2Y0SE 4NXNQ 2BA1A 2K14A 3NELA 1OXSC 3GTPH 1YNXA 4JBJA 4DV2Q 1UEBA 4EQ5A 5C0XG 2R92G 3HOUH 4JYAQ 3TS0A 4DR4L 4LNQA 3MXNB 4DV4Q 4DR1L 3U50C 1IL2A 4DV2L 3PO2H 3KLWA 4L5RC 2OTLA 1N33Q 1WCMH 1XNQQ 1TWGH 4DV4L 2GVBA 1VQMA 1Q7YC 1JT8A 1YZ6A 2ZM6Q 4DUZL 1VCIA 4HJ7A 2ZJQA 1N33L 3U58A 3W5OA 1SRUA 2Y0SG 3E0EA 4JG2A 2Z6KA 1YI2A 1XMOL 1XNQL 2K5HA 3ULLA 3CCJA 4C3IH 4JI8Q 4OWXB 1OTCA 4LUOA 2VW9A 1AE2A 1QUQA 1VQ5A 1OXXK 1HNXQ 4R4CA 2B29A 4UP7A 3H3VH 1VQLA 5LMNW 1L1OC 1E3PA 1FVIA 1PYBA 2HIVA 1RIPA 3CAMA 4DV3Q 3HOWH 5EAYA 1HNXL 1EIFA 4GKKQ 5E7NA 5FLMH 4B3TQ 4YWLA 3CQZH 3AEVA 4LW1A 1VQNA 4A3BG 4ALPA 1B7YB 4HJ8A 4A3EG 2R7ZG 4DV0Q 1NMFA 4B3TL 3RZOH 3ERSX 1P8LA 3I2ZA 4DK6C 1LM0A 4A3FG 2KHIA 4R4IA 3I4NG 3PIOA 4GOPB 4QJFA 3BJUA 1U5KA 3HFZB 1X65A 2OCEA 3EN2A 4AIMA 1FGUA 3RLOA 4AQYQ 4A75A 3I56A 4OXPA 4DK3C 3KFUA 3GTMH 2UXDQ 4JI5Q 1L2FA 3HOZH 4AQYL 2ES2A 2LXJA 1DGSA 2CKZB 3TREA 4JI5L 3CCQA 1X9NA 3J81j 4NXML 3HOUG 2AKWB 5IWAQ 2RHQB 2IHFA 1IZ6A 2QGQA 3E9HA 4IJHA 1VQ9A 2K5VA 1UE7A 3J7ZC 3PO2G 3I7FA 4NB3A 5JEAJ 1WCMG 4DAMA 2Q2UA 4KHPQ 3G71A 1NBWA 4BXXH 4QGUA 3TQYA 2VUMH 1HNWQ 5M3FG 2YTXA 4JI3L 5IP7H 4IO9A 4A3LH 3KF6A 3RN5A 1XMQL 4PZ6A 2EQSA 1HNWL 1GD7A 4DV1L 2MFIA 3BZCA 3GTOH 5BR8Q 3A0JA 4EX5A 2AMCB 1PH8A 4OO1G 1HJPA 4DV6L 2AWOA 2RF4A 1RL2A 3JC66 5BR8L 1PA6A 3CXCA 1T9HA 5AJ3L 1VQJA 3HKSA 1CKMA 5IYBG 5GAGC 1X3EA 3HOWG 1MIUA 2UU9Q 3KDFB 5FLMG 4R1JA 3PUWA 1A8VA 1EUJA 4LF5Q 2ID0A 4IPCA 2WAQE 5DLQE 2UU9L 2YTVA 4KLKA 1OXTA 4JI7Q 3PIPA 2NVXH 4OWTB 4LF5L 4O0AA 1X56A 2E5LQ 1YHBA 3GTJH 2IT1A 5C44G 4LFCL 1SLJA 4QY7A 4JI7L 3S15H 2MNAA 1QVGA 4X64L 1VQ7A 1VQHA 1XPOA 2B3GA 4C3HH 1VQFA 1JB7A 1IBLL 1KHIA 1PHJA 4POGA 3RZDH 3HOZG 1N9WA 4UPAA 2VL6A 4P71A 1PH6A 2YYZA 3U4VA 2WAQG 4JI0L 1LUZA 4WJ3M 4FDBA 1HNZQ 2HQLA 4PZ8A 5LMNQ 4X66Q 2PMZE 2NVYH 3G6EA 4JI2Q 2N49A 1PVOA 1C9OA 5JJKA 1QVCA 4BXXG 3HKZE 4IFDI 2NZOA 5LMNL 4P72A 3KYHC 4RMFA 4X65Q 4GS3A 5GROA 4X66L 5IP7G 4A76A 2V1CC 3J80i 4A3LG 4KHZA 2VQFQ 1Y1WG 1U0LA 4NPSA 4X65L 4A3EH 3TRZA 3CC2A 1Q46A 3BZKA 4OONA 3AFPA 2R7ZH 1HZBA 1S40A 1MKHA 3GTLH 3G48A 1KRTA 1Y14B 2D0OA 2VQEQ 3J81c 1NE3A 4ME3A 2OWOA 4GN5A 1Q1BA 1IXRA 3OW2A 1I3QH 1WOCA 2JEAI 3WWVA 3HKZG 2RCNA 3S2DH 4DR4Q 4QQBX 4DR5L 1D8LA 1X54A 2ZTDA 1GKHA 4DR1Q 3CC4A 3S2HH 3STBD 2Q2HA 5M5XH 4P75A 2YV5A 2E2JH 4H02A 1BBUA 3GTQH 1XPUA 4GLAC 2PQAA 3UDXA 3FP9A 3PGZA 5ELOA 3GO5A 4DUZQ 4LF8Q 1M90C 3S1QH 1VQKA 1I50H 1XMOQ 2NVQH 3LGJA 5C0XI 2Z0SA 1Q12A 5M3FH 4LF8L 2JA5H 1XTDA 2JA8G 4DR7L 4Y52H 4GOPC 2MO1A 1PYSB 4AH6A 4DR3L 1K8GA 1YJNA 5GAHC 1K9MC 1EIYB 4UY8C 2NVTH 4IPGA 4A3GG 5IP9H 3PCOB 1N32L 3S1RH 1PH3A 1P16A 2JA9A 4Y7NH 4XIGS 1W2BA 4GN3B 1QZHA 3HOXH 5IYBH 3GTGH 4TQUS 4HJ9A 2F3IA 5GAEC 3T1YQ 1EQRA 2YU9H 4JI4L 1ASZA 4HIMA 2IX1A 1SR3A 2HT1A 3M4OH 2JE6I 3E9IA 1UE1A 3PUXA 3KF6B 2GN5A 4LFAQ 1LYLA 4DUYL 3ULPA 3GDEA 3T1YL 1KQSA 4A93G 1HZ9A 3D0FA 4A3JH 4HIKA 5C3EH 2GVAA 3UDGA 5C4XH 2N3SA 4LFAL 3M3YH 4JBMA 5C44H 3JAMc 1HR0Q 1TWAH 2PI2A 2R7DA 4IPDA 2JA7H 4DAYB 3I4MH 3EBEA 2F4VQ 2JJQA 2OTJA 4A3IH 3OTOL 1PH2A 1JJ2A 1HR0L 1JMCA 4NXMQ 2IY5B 1E7ZA 3OYYA 3IRBA 2CQOA 1TWFH 3B6YA 2HIXA 2F4VL 3CD6A 1VQBA 1XJVA 1M1KC 3PUZA 2C35B 3K0XA 1V1QA 3PUYA 1E1OA 4IPHA 4IFDJ 1E24A 2KBNA 1YHQA 3J7A5 1NMGA 4AYBE 4JI3Q 2JA6H 3NEMA 5M5YH 1BKBA 3H15A 1XMQQ 1Q82C 4LF4L 1ASYA 4R4QA 3CMEA 4DV1Q 2PI2E 1N34L 3ICEA 4IJLA 2JA5G 2PNHA 2WFWA 4DNIA 4DV5Q 1CUKA 2DUDA 3PO3H 5JJIA 1Y1WH 4DKAC 4KHPL 4DV6Q 1VQ6A 4PMWA 2QEXA 3CCVA 2KCMA 2NN6G 1EOVA 1TWHH 5IP9G 5AJ3Q 4DV5L 1Q8KA 1QVFA 3ULJA 4JOIC 5IYDG 2NZHA 2E2IH 3HOYG 1WI5A 4A3MG 1E22A 2UUAL 4AYBG 1EYGA 3HOXG 1PH7A 2UUCL 4LF9Q 3PUVA 3S1MH 3EIVA 4OO1I 2JEBI 5M3MH 1BBWA 3K81C 4GNXB 1EWIA 1L0WA 4LF9L 1JJGA 1JE5A 1CKNA 1VQAA 3W1GA 4YCVA 4LFCQ 3H3VI 3L0OA 4A3JG 5C3EG 2VZAA 5IY0A 4DV7Q 4GNXA 3CW2C 1HZAA 5C4XG 5C0XJ 4X64Q 3PF5A 1GVPA 1N36Q 2LSSA 3F2DA 1PH1A 1IBLQ 2Z6KC 2D0PA 4DV7L 1K8AC 2B63H 1IBML 2JA7G 3I4MG 4A3DG 1XNRL 4K0KL 2JA8H 4A3IG 2K5NA 3TEHB 2A19A 3KJPA 1A62A 2H5XA 2RHSB 3RLNA 5ELNA 1N36L 4JI0Q 1V43A 2L15A 4APVA 1YITA 1H95A 2A8VA 4B3MQ 3FKIH 4OWWB 2I5HA 4X62Q 4A3GH 1S3OA 1Y1VH 2N8NA 2WB1E 1L1OA 2EIFA 4HIOA 1VQPA 3I55A 4B3ML 4L5QA 1UWVA 2PQAB 3ZJYC 4X62L 4LF7L 2JA6G 1BVSA 4UP9A 1FJGQ 3S1NH 5LMUL 1A63A 2R6GA 4QL5A 1B8AA 2KHJA 4B3SQ 3PO3G 3A5ZB 1FJGL 2MQHA 3S14H 1G6PA 1YVCA 1CKOA 4GLVB 2K50A 4A93H 4J15A 4GKJQ 4B3SL 4BY1G 1J5EL 1PH5A 2WB1G 3CF5A 5IYCG 2CFMA 3K7UC 3J81i 4BBSH 1QUQB 4WJ4A 4GKJL 1NTGA 2A1AA 1KIXA 1X6OA 5JEAG 4DR5Q 1K0RA 2FXQA 1IYJB 1LTLA 1WYDA 5M3MG 3T1HL 4QIWE 3PSIA 3CCSA 1J6QA 4POFA 2DGYA 3KF8B 5HGQA 1W3SA 2JQOA 1WFQA 2AWNA 2QA4A 2UXBL 4MNOA 4BA1I 3CCMA 4O2DA 1B70B 2AHOB 4JV5L 3S17H 1PV4A 4DR7Q 1AE3A 1VQGA 1G51A 4LWCA 3DM3A 1S72A 5M5WH 1YJ9A 4YCWA 2B63G 2N78A 4YY3L 4DR3Q 1K83H 4DR6L 1V9PA 3A74A 2ASBA 1N32Q 2YTYA 1VQ8A 2BH8A 4JOIA 1Q86C 1GM5A 1CSQA 1Q1EA 4HIDA 1PH4A 3FKIG 1EQQA 1IBKL 1Y1VG 4IOAA 1VQEA 3K7AH 4BBRH 1TXYA 1SMXA 2IHEA 3M85A 1I5FA 2R93H 3CC7A 5IYDH 3RNUA 4JI4Q 2VUMG 4A3MH 2XTIA 4NXNL 3HOYH 3AQQA 1TWCH 3L7ZC 3K8AA 1K3RA 3DLLA 4L5TA 1VQOA 1NY4A 1AH9A 4DUYQ 4JYAL 1FL0A 1VQCA 2R7FA 1E1TA 4YWKA 3CMAA 3SGIA 1OXUA 1OXVA 1YEZA 3UDIA 3M7NA 2WP8J 4L5SA 4DPGA 2UXCQ 5FLXc 3CCEA 3BU2A 2LXKA 4A3CG 3FHWA 3JAMi 5JJLA 3K80C 2ZM6L 3OTOQ 1YHAA 4BBSG 1NJIC 2CCZA 2UXCL 3RLFA 4A3DH 2I5LX 4LUVA 2KENA 4R4TA 4JI8L 1HZCA 3KJOA 2I0QA 2ATWA 1CKNB 4JCVE 1VQ4A 1D7QA 2ALYB 2K75A 2D62A 5FJ8G 4LF4Q 5GQOA 3Q8DA 4DV3L 4GNXC 1N34Q 4GKKL 4JI1Q 3W1BA 2K4KA 3ER0A 2OQ0A 1KD1C 3S24A 4KI0A 3PV0A 4JI1L 1WJJA 4DV0L 4GN4B 4HJAA 2XGTA 2BH2A 3HOVH 3H0GH 4C3JH 5J3BA 3NBHB 4JBKA 1X55A 4BY1H 2UUAQ 4OX9Q 3GD7A 3A5UA 1SN8A 4BBRG 1EFWA 5IYCH 2UUCQ 2R93G 1L1OB 2KCTA 4BA2I 3L2PA 4OX9L 4R4OA 5C4JH 1O7IA 3AYHB 4B3RQ 1KXLA 1JJCB 1UE6A 2NN6I 1SFOH 3CCLA 4BY7H 3KOJA 4PG3A 2MO0A 5IWAL 1C7YA 1X3GA 3U4ZA 4PZ7A 4P73A 4B3RL 1R9TH 1I6HH 4X6AH 2E8GA 3CP0A 4A4IA 1OLTA 1Z9FA 4UP8A 1G291 1VS0A 4MZ9A 4JC0A 3M4QA 2ZTCA 1IBMQ 3M9BA 2EXDA 2ZJRA 2F52A 4K0KQ 3UDFA 3M4PA 3G4SA 4LFBQ 3VDYA 1XPRA 4GOPA 2HHHQ 5K36G 1X3FA 1N8RC 3PF4A 5IT9c 4LFBL 1K73C 1UE5A 3CCRA 4A3KH 2HHHL 4XTCS 3GTKH 1YBYA 4DR2Q 4LF7Q 2JK8A 2E2HH 1YIJA 1XNRQ 2I5MX 2VS1A 1HH2P 1SE8A 3D31A 4P74A 4YCUA 1VQIA 2VY3A 4YHHQ 5LMUQ 2R92H 3TS2A 4DR2L 4TVAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPF A;  2K52 A;  5GAD C;  2CWP A;  1KC8 C;  4YHH L;  5IE8 A;  2Q2T A;  4JBW A;  3CPW A;  4HJ5 A;  1J5E Q;  1HR0 W;  1YJW A;  1Q81 C;  2E5L L;  2IX0 A;  3HOV G;  3H0G G;  2UUB Q;  5HY6 A;  3CCU A;  4YWM A;  1Z47 A;  4A3C H;  4LF6 Q;  4IFD G;  2UUB L;  3I4O A;  3T1H Q;  2ZTE A;  4MTN A;  5H1S E;  3STB C;  4LF6 L;  2CWA A;  4LUZ A;  2BA0 A;  2VNU D;  1KRS A;  4BY7 G;  1SRO A;  3F1Z A;  4C2M H;  1VQD A;  3F2C A;  3F2B A;  4GLX A;  2UXB Q;  4RG1 A;  1HNZ L;  3NEN A;  3KDF A;  1KL9 A;  4JI6 Q;  4JV5 Q;  3RN2 A;  3RR5 A;  1GO3 E;  1QZG A;  4JI2 L;  3J80 c;  5FJ8 H;  2UXD L;  1A0I A;  4A3B H;  3S16 H;  2OQK A;  4YY3 Q;  1PH9 A;  4JI6 L;  4DR6 Q;  4A3F H;  2VQF L;  3UE0 A;  1KAW A;  3F8T A;  1I94 Q;  1CSP A;  1MJC A;  3AFQ A;  4IOC A;  3I4N H;  1MJE A;  3UE1 A;  2ZJP A;  2Q2I A;  1IBK Q;  1I94 L;  1C0A A;  4A3K G;  3MEF A;  1PFS A;  2VQE L;  2Y0S E;  4NXN Q;  2BA1 A;  2K14 A;  3NEL A;  1OXS C;  3GTP H;  1YNX A;  4JBJ A;  4DV2 Q;  1UEB A;  4EQ5 A;  5C0X G;  2R92 G;  3HOU H;  4JYA Q;  3TS0 A;  4DR4 L;  4LNQ A;  3MXN B;  4DV4 Q;  4DR1 L;  3U50 C;  1IL2 A;  4DV2 L;  3PO2 H;  3KLW A;  4L5R C;  2OTL A;  1N33 Q;  1WCM H;  1XNQ Q;  1TWG H;  4DV4 L;  2GVB A;  1VQM A;  1Q7Y C;  1JT8 A;  1YZ6 A;  2ZM6 Q;  4DUZ L;  1VCI A;  4HJ7 A;  2ZJQ A;  1N33 L;  3U58 A;  3W5O A;  1SRU A;  2Y0S G;  3E0E A;  4JG2 A;  2Z6K A;  1YI2 A;  1XMO L;  1XNQ L;  2K5H A;  3ULL A;  3CCJ A;  4C3I H;  4JI8 Q;  4OWX B;  1OTC A;  4LUO A;  2VW9 A;  1AE2 A;  1QUQ A;  1VQ5 A;  1OXX K;  1HNX Q;  4R4C A;  2B29 A;  4UP7 A;  3H3V H;  1VQL A;  5LMN W;  1L1O C;  1E3P A;  1FVI A;  1PYB A;  2HIV A;  1RIP A;  3CAM A;  4DV3 Q;  3HOW H;  5EAY A;  1HNX L;  1EIF A;  4GKK Q;  5E7N A;  5FLM H;  4B3T Q;  4YWL A;  3CQZ H;  3AEV A;  4LW1 A;  1VQN A;  4A3B G;  4ALP A;  1B7Y B;  4HJ8 A;  4A3E G;  2R7Z G;  4DV0 Q;  1NMF A;  4B3T L;  3RZO H;  3ERS X;  1P8L A;  3I2Z A;  4DK6 C;  1LM0 A;  4A3F G;  2KHI A;  4R4I A;  3I4N G;  3PIO A;  4GOP B;  4QJF A;  3BJU A;  1U5K A;  3HFZ B;  1X65 A;  2OCE A;  3EN2 A;  4AIM A;  1FGU A;  3RLO A;  4AQY Q;  4A75 A;  3I56 A;  4OXP A;  4DK3 C;  3KFU A;  3GTM H;  2UXD Q;  4JI5 Q;  1L2F A;  3HOZ H;  4AQY L;  2ES2 A;  2LXJ A;  1DGS A;  2CKZ B;  3TRE A;  4JI5 L;  3CCQ A;  1X9N A;  3J81 j;  4NXM L;  3HOU G;  2AKW B;  5IWA Q;  2RHQ B;  2IHF A;  1IZ6 A;  2QGQ A;  3E9H A;  4IJH A;  1VQ9 A;  2K5V A;  1UE7 A;  3J7Z C;  3PO2 G;  3I7F A;  4NB3 A;  5JEA J;  1WCM G;  4DAM A;  2Q2U A;  4KHP Q;  3G71 A;  1NBW A;  4BXX H;  4QGU A;  3TQY A;  2VUM H;  1HNW Q;  5M3F G;  2YTX A;  4JI3 L;  5IP7 H;  4IO9 A;  4A3L H;  3KF6 A;  3RN5 A;  1XMQ L;  4PZ6 A;  2EQS A;  1HNW L;  1GD7 A;  4DV1 L;  2MFI A;  3BZC A;  3GTO H;  5BR8 Q;  3A0J A;  4EX5 A;  2AMC B;  1PH8 A;  4OO1 G;  1HJP A;  4DV6 L;  2AWO A;  2RF4 A;  1RL2 A;  3JC6 6;  5BR8 L;  1PA6 A;  3CXC A;  1T9H A;  5AJ3 L;  1VQJ A;  3HKS A;  1CKM A;  5IYB G;  5GAG C;  1X3E A;  3HOW G;  1MIU A;  2UU9 Q;  3KDF B;  5FLM G;  4R1J A;  3PUW A;  1A8V A;  1EUJ A;  4LF5 Q;  2ID0 A;  4IPC A;  2WAQ E;  5DLQ E;  2UU9 L;  2YTV A;  4KLK A;  1OXT A;  4JI7 Q;  3PIP A;  2NVX H;  4OWT B;  4LF5 L;  4O0A A;  1X56 A;  2E5L Q;  1YHB A;  3GTJ H;  2IT1 A;  5C44 G;  4LFC L;  1SLJ A;  4QY7 A;  4JI7 L;  3S15 H;  2MNA A;  1QVG A;  4X64 L;  1VQ7 A;  1VQH A;  1XPO A;  2B3G A;  4C3H H;  1VQF A;  1JB7 A;  1IBL L;  1KHI A;  1PHJ A;  4POG A;  3RZD H;  3HOZ G;  1N9W A;  4UPA A;  2VL6 A;  4P71 A;  1PH6 A;  2YYZ A;  3U4V A;  2WAQ G;  4JI0 L;  1LUZ A;  4WJ3 M;  4FDB A;  1HNZ Q;  2HQL A;  4PZ8 A;  5LMN Q;  4X66 Q;  2PMZ E;  2NVY H;  3G6E A;  4JI2 Q;  2N49 A;  1PVO A;  1C9O A;  5JJK A;  1QVC A;  4BXX G;  3HKZ E;  4IFD I;  2NZO A;  5LMN L;  4P72 A;  3KYH C;  4RMF A;  4X65 Q;  4GS3 A;  5GRO A;  4X66 L;  5IP7 G;  4A76 A;  2V1C C;  3J80 i;  4A3L G;  4KHZ A;  2VQF Q;  1Y1W G;  1U0L A;  4NPS A;  4X65 L;  4A3E H;  3TRZ A;  3CC2 A;  1Q46 A;  3BZK A;  4OON A;  3AFP A;  2R7Z H;  1HZB A;  1S40 A;  1MKH A;  3GTL H;  3G48 A;  1KRT A;  1Y14 B;  2D0O A;  2VQE Q;  3J81 c;  1NE3 A;  4ME3 A;  2OWO A;  4GN5 A;  1Q1B A;  1IXR A;  3OW2 A;  1I3Q H;  1WOC A;  2JEA I;  3WWV A;  3HKZ G;  2RCN A;  3S2D H;  4DR4 Q;  4QQB X;  4DR5 L;  1D8L A;  1X54 A;  2ZTD A;  1GKH A;  4DR1 Q;  3CC4 A;  3S2H H;  3STB D;  2Q2H A;  5M5X H;  4P75 A;  2YV5 A;  2E2J H;  4H02 A;  1BBU A;  3GTQ H;  1XPU A;  4GLA C;  2PQA A;  3UDX A;  3FP9 A;  3PGZ A;  5ELO A;  3GO5 A;  4DUZ Q;  4LF8 Q;  1M90 C;  3S1Q H;  1VQK A;  1I50 H;  1XMO Q;  2NVQ H;  3LGJ A;  5C0X I;  2Z0S A;  1Q12 A;  5M3F H;  4LF8 L;  2JA5 H;  1XTD A;  2JA8 G;  4DR7 L;  4Y52 H;  4GOP C;  2MO1 A;  1PYS B;  4AH6 A;  4DR3 L;  1K8G A;  1YJN A;  5GAH C;  1K9M C;  1EIY B;  4UY8 C;  2NVT H;  4IPG A;  4A3G G;  5IP9 H;  3PCO B;  1N32 L;  3S1R H;  1PH3 A;  1P16 A;  2JA9 A;  4Y7N H;  4XIG S;  1W2B A;  4GN3 B;  1QZH A;  3HOX H;  5IYB H;  3GTG H;  4TQU S;  4HJ9 A;  2F3I A;  5GAE C;  3T1Y Q;  1EQR A;  2YU9 H;  4JI4 L;  1ASZ A;  4HIM A;  2IX1 A;  1SR3 A;  2HT1 A;  3M4O H;  2JE6 I;  3E9I A;  1UE1 A;  3PUX A;  3KF6 B;  2GN5 A;  4LFA Q;  1LYL A;  4DUY L;  3ULP A;  3GDE A;  3T1Y L;  1KQS A;  4A93 G;  1HZ9 A;  3D0F A;  4A3J H;  4HIK A;  5C3E H;  2GVA A;  3UDG A;  5C4X H;  2N3S A;  4LFA L;  3M3Y H;  4JBM A;  5C44 H;  3JAM c;  1HR0 Q;  1TWA H;  2PI2 A;  2R7D A;  4IPD A;  2JA7 H;  4DAY B;  3I4M H;  3EBE A;  2F4V Q;  2JJQ A;  2OTJ A;  4A3I H;  3OTO L;  1PH2 A;  1JJ2 A;  1HR0 L;  1JMC A;  4NXM Q;  2IY5 B;  1E7Z A;  3OYY A;  3IRB A;  2CQO A;  1TWF H;  3B6Y A;  2HIX A;  2F4V L;  3CD6 A;  1VQB A;  1XJV A;  1M1K C;  3PUZ A;  2C35 B;  3K0X A;  1V1Q A;  3PUY A;  1E1O A;  4IPH A;  4IFD J;  1E24 A;  2KBN A;  1YHQ A;  3J7A 5;  1NMG A;  4AYB E;  4JI3 Q;  2JA6 H;  3NEM A;  5M5Y H;  1BKB A;  3H15 A;  1XMQ Q;  1Q82 C;  4LF4 L;  1ASY A;  4R4Q A;  3CME A;  4DV1 Q;  2PI2 E;  1N34 L;  3ICE A;  4IJL A;  2JA5 G;  2PNH A;  2WFW A;  4DNI A;  4DV5 Q;  1CUK A;  2DUD A;  3PO3 H;  5JJI A;  1Y1W H;  4DKA C;  4KHP L;  4DV6 Q;  1VQ6 A;  4PMW A;  2QEX A;  3CCV A;  2KCM A;  2NN6 G;  1EOV A;  1TWH H;  5IP9 G;  5AJ3 Q;  4DV5 L;  1Q8K A;  1QVF A;  3ULJ A;  4JOI C;  5IYD G;  2NZH A;  2E2I H;  3HOY G;  1WI5 A;  4A3M G;  1E22 A;  2UUA L;  4AYB G;  1EYG A;  3HOX G;  1PH7 A;  2UUC L;  4LF9 Q;  3PUV A;  3S1M H;  3EIV A;  4OO1 I;  2JEB I;  5M3M H;  1BBW A;  3K81 C;  4GNX B;  1EWI A;  1L0W A;  4LF9 L;  1JJG A;  1JE5 A;  1CKN A;  1VQA A;  3W1G A;  4YCV A;  4LFC Q;  3H3V I;  3L0O A;  4A3J G;  5C3E G;  2VZA A;  5IY0 A;  4DV7 Q;  4GNX A;  3CW2 C;  1HZA A;  5C4X G;  5C0X J;  4X64 Q;  3PF5 A;  1GVP A;  1N36 Q;  2LSS A;  3F2D A;  1PH1 A;  1IBL Q;  2Z6K C;  2D0P A;  4DV7 L;  1K8A C;  2B63 H;  1IBM L;  2JA7 G;  3I4M G;  4A3D G;  1XNR L;  4K0K L;  2JA8 H;  4A3I G;  2K5N A;  3TEH B;  2A19 A;  3KJP A;  1A62 A;  2H5X A;  2RHS B;  3RLN A;  5ELN A;  1N36 L;  4JI0 Q;  1V43 A;  2L15 A;  4APV A;  1YIT A;  1H95 A;  2A8V A;  4B3M Q;  3FKI H;  4OWW B;  2I5H A;  4X62 Q;  4A3G H;  1S3O A;  1Y1V H;  2N8N A;  2WB1 E;  1L1O A;  2EIF A;  4HIO A;  1VQP A;  3I55 A;  4B3M L;  4L5Q A;  1UWV A;  2PQA B;  3ZJY C;  4X62 L;  4LF7 L;  2JA6 G;  1BVS A;  4UP9 A;  1FJG Q;  3S1N H;  5LMU L;  1A63 A;  2R6G A;  4QL5 A;  1B8A A;  2KHJ A;  4B3S Q;  3PO3 G;  3A5Z B;  1FJG L;  2MQH A;  3S14 H;  1G6P A;  1YVC A;  1CKO A;  4GLV B;  2K50 A;  4A93 H;  4J15 A;  4GKJ Q;  4B3S L;  4BY1 G;  1J5E L;  1PH5 A;  2WB1 G;  3CF5 A;  5IYC G;  2CFM A;  3K7U C;  3J81 i;  4BBS H;  1QUQ B;  4WJ4 A;  4GKJ L;  1NTG A;  2A1A A;  1KIX A;  1X6O A;  5JEA G;  4DR5 Q;  1K0R A;  2FXQ A;  1IYJ B;  1LTL A;  1WYD A;  5M3M G;  3T1H L;  4QIW E;  3PSI A;  3CCS A;  1J6Q A;  4POF A;  2DGY A;  3KF8 B;  5HGQ A;  1W3S A;  2JQO A;  1WFQ A;  2AWN A;  2QA4 A;  2UXB L;  4MNO A;  4BA1 I;  3CCM A;  4O2D A;  1B70 B;  2AHO B;  4JV5 L;  3S17 H;  1PV4 A;  4DR7 Q;  1AE3 A;  1VQG A;  1G51 A;  4LWC A;  3DM3 A;  1S72 A;  5M5W H;  1YJ9 A;  4YCW A;  2B63 G;  2N78 A;  4YY3 L;  4DR3 Q;  1K83 H;  4DR6 L;  1V9P A;  3A74 A;  2ASB A;  1N32 Q;  2YTY A;  1VQ8 A;  2BH8 A;  4JOI A;  1Q86 C;  1GM5 A;  1CSQ A;  1Q1E A;  4HID A;  1PH4 A;  3FKI G;  1EQQ A;  1IBK L;  1Y1V G;  4IOA A;  1VQE A;  3K7A H;  4BBR H;  1TXY A;  1SMX A;  2IHE A;  3M85 A;  1I5F A;  2R93 H;  3CC7 A;  5IYD H;  3RNU A;  4JI4 Q;  2VUM G;  4A3M H;  2XTI A;  4NXN L;  3HOY H;  3AQQ A;  1TWC H;  3L7Z C;  3K8A A;  1K3R A;  3DLL A;  4L5T A;  1VQO A;  1NY4 A;  1AH9 A;  4DUY Q;  4JYA L;  1FL0 A;  1VQC A;  2R7F A;  1E1T A;  4YWK A;  3CMA A;  3SGI A;  1OXU A;  1OXV A;  1YEZ A;  3UDI A;  3M7N A;  2WP8 J;  4L5S A;  4DPG A;  2UXC Q;  5FLX c;  3CCE A;  3BU2 A;  2LXK A;  4A3C G;  3FHW A;  3JAM i;  5JJL A;  3K80 C;  2ZM6 L;  3OTO Q;  1YHA A;  4BBS G;  1NJI C;  2CCZ A;  2UXC L;  3RLF A;  4A3D H;  2I5L X;  4LUV A;  2KEN A;  4R4T A;  4JI8 L;  1HZC A;  3KJO A;  2I0Q A;  2ATW A;  1CKN B;  4JCV E;  1VQ4 A;  1D7Q A;  2ALY B;  2K75 A;  2D62 A;  5FJ8 G;  4LF4 Q;  5GQO A;  3Q8D A;  4DV3 L;  4GNX C;  1N34 Q;  4GKK L;  4JI1 Q;  3W1B A;  2K4K A;  3ER0 A;  2OQ0 A;  1KD1 C;  3S24 A;  4KI0 A;  3PV0 A;  4JI1 L;  1WJJ A;  4DV0 L;  4GN4 B;  4HJA A;  2XGT A;  2BH2 A;  3HOV H;  3H0G H;  4C3J H;  5J3B A;  3NBH B;  4JBK A;  1X55 A;  4BY1 H;  2UUA Q;  4OX9 Q;  3GD7 A;  3A5U A;  1SN8 A;  4BBR G;  1EFW A;  5IYC H;  2UUC Q;  2R93 G;  1L1O B;  2KCT A;  4BA2 I;  3L2P A;  4OX9 L;  4R4O A;  5C4J H;  1O7I A;  3AYH B;  4B3R Q;  1KXL A;  1JJC B;  1UE6 A;  2NN6 I;  1SFO H;  3CCL A;  4BY7 H;  3KOJ A;  4PG3 A;  2MO0 A;  5IWA L;  1C7Y A;  1X3G A;  3U4Z A;  4PZ7 A;  4P73 A;  4B3R L;  1R9T H;  1I6H H;  4X6A H;  2E8G A;  3CP0 A;  4A4I A;  1OLT A;  1Z9F A;  4UP8 A;  1G29 1;  1VS0 A;  4MZ9 A;  4JC0 A;  3M4Q A;  2ZTC A;  1IBM Q;  3M9B A;  2EXD A;  2ZJR A;  2F52 A;  4K0K Q;  3UDF A;  3M4P A;  3G4S A;  4LFB Q;  3VDY A;  1XPR A;  4GOP A;  2HHH Q;  5K36 G;  1X3F A;  1N8R C;  3PF4 A;  5IT9 c;  4LFB L;  1K73 C;  1UE5 A;  3CCR A;  4A3K H;  2HHH L;  4XTC S;  3GTK H;  1YBY A;  4DR2 Q;  4LF7 Q;  2JK8 A;  2E2H H;  1YIJ A;  1XNR Q;  2I5M X;  2VS1 A;  1HH2 P;  1SE8 A;  3D31 A;  4P74 A;  4YCU A;  1VQI A;  2VY3 A;  4YHH Q;  5LMU Q;  2R92 H;  3TS2 A;  4DR2 L;  4TVA B; 
#chains in the Genus database with same CATH topology
 1Q8I A;  4C2M B;  3J81 E;  5IE8 A;  4KD4 A;  4HJ5 A;  1HR0 W;  5D14 A;  4CDD C;  1Q81 C;  2E5L L;  1EIG A;  2IX0 A;  2UUB Q;  4K5V A;  1M4V A;  5KRU A;  5G3L F;  2X69 A;  3U9S A;  4IFD G;  2AUK A;  4OHJ A;  1C4Q A;  3T1H Q;  2ZTE A;  2CH4 A;  2VNU D;  3D4R A;  5CV8 A;  2UXB Q;  3F1Z A;  1BCP D;  4I7A A;  1ZYR D;  3KDF A;  2PCF B;  3CHB D;  1BBX C;  1U4M A;  1EWC A;  3S16 H;  4YY3 Q;  1PH9 A;  4A3F H;  2VQF L;  4EQN A;  3A54 A;  1TWG B;  2MPM A;  2ZJP A;  1IBK Q;  2VQE L;  5T1I A;  4IUQ A;  4XYQ A;  4DV2 Q;  4IN3 A;  5FLX E;  3TS0 A;  4LNQ A;  1PLF A;  1NNX A;  2PQE A;  3KLW A;  4L5R C;  4R8I A;  3CQZ B;  4H0L C;  1B3A A;  3W5O A;  3E0E A;  3U58 A;  1XNQ L;  2K5H A;  3CCJ A;  3MVV A;  3A56 A;  4JI8 Q;  4OWX B;  1AE2 A;  4CJ0 B;  1HNX Q;  3H0G B;  1V8Q A;  4LAA A;  1RIP A;  5EAY A;  3HS0 C;  1EIF A;  1H9S A;  4GKK Q;  1JE4 A;  1QNK A;  4LW1 A;  4ALP A;  1B7Y B;  1ILP A;  2F0L A;  4DV0 Q;  3RZO H;  3FPP A;  2F0U A;  2KHI A;  3I4N G;  2I07 B;  3BJU A;  3SR1 A;  4I65 A;  3J7A F;  2EY1 A;  3EN2 A;  5CBA E;  1FGU A;  2G5D A;  3RLO A;  2WAC A;  2UXD Q;  1KDB A;  3C46 A;  2K5W A;  3MZ5 A;  2LXJ A;  1DGS A;  2CKZ B;  4IFD H;  1WTR A;  3VR5 A;  1IZ6 A;  2QGQ A;  3E9H A;  2K5V A;  3J7Z C;  2E2D C;  3I7F A;  4NB3 A;  2AQ1 B;  4DAM A;  2Q2U A;  5IGB A;  3QG1 A;  4QGU A;  3TQY A;  2VUM H;  2EY6 A;  1HNW Q;  2K04 A;  4IO9 A;  2L0C A;  1KAA A;  2A68 D;  3KF6 A;  4DV1 L;  5JPM C;  1DYQ A;  3A0J A;  4PNY A;  1H9K A;  2RF4 A;  3Q0A A;  4RGT A;  1T9H A;  4ULL A;  4DF7 A;  2Y0S B;  4ZK9 B;  5GAG C;  3HOW G;  3KDF B;  1EUJ A;  1PZK D;  2OXP A;  4L8J A;  2ZT9 C;  2NVX H;  4LF5 L;  1GUT A;  2E5L Q;  1YHB A;  4ZAI A;  4OL7 A;  4JI7 L;  1R4Q B;  2F0K A;  3S15 H;  2QF7 A;  1X3Q A;  1A6X A;  3S16 B;  3IFT A;  1HFG A;  2A74 C;  1HA5 A;  3FMC A;  4A3F B;  1QB5 D;  1VMC A;  4DGZ A;  1LT6 D;  2RVL A;  4IUT A;  4RHR A;  4PZ8 A;  3TN2 A;  1LTR D;  2NVY H;  3G6E A;  2N49 A;  4MTK A;  3CKI B;  3U9O A;  5JJK A;  4BXX G;  4GNX A;  4RMF A;  3KYH C;  3I72 A;  4GS3 A;  5GRO A;  4A3L G;  1F2M A;  5M5X B;  2VQF Q;  1Y1W G;  1U0L A;  2BDO A;  4X65 L;  3TRZ A;  3CC2 A;  4OON A;  1Y14 B;  3V96 A;  2I46 A;  3OWE B;  2VQE Q;  4ME3 A;  5M3F B;  2OWO A;  4GN5 A;  3OW2 A;  2JEA I;  5I9O A;  2RCN A;  1LTS D;  1H9S B;  2QCP X;  3EVQ A;  1D8L A;  2ZTD A;  1GKH A;  4P75 A;  2F0P A;  1GUS A;  2NWG A;  1JOR A;  2BE5 C;  3GO5 A;  3S1Q H;  1M90 C;  2YU9 B;  2JYO A;  5D3D A;  1RHP A;  5NUC A;  1RTO A;  2JA5 H;  4A3J B;  3RZO B;  1PYS B;  4AH6 A;  4L6T B;  4DR3 L;  1DOL A;  1YJN A;  1K9M C;  1DXM A;  4IPG A;  1XWE A;  5IP9 H;  3S1R H;  1P16 A;  2JA9 A;  4XIG S;  3ITP A;  1SNO A;  5GAE C;  3T1Y Q;  5ELC A;  1TII D;  3KF8 A;  3M4O H;  3E9I A;  3ULP A;  3KF6 B;  2GN5 A;  5J22 A;  1KQS A;  2SEB D;  1BUV T;  1HZ9 A;  1TR5 A;  2JA6 B;  3I90 A;  1I4H A;  2N3S A;  3JAM c;  1CI3 M;  2VUM B;  2R7D A;  4IPD A;  3C3L A;  1I4R A;  1PH2 A;  1JMC A;  2IY5 B;  2CHB D;  4RA8 A;  3M7G A;  3IRB A;  1PZJ D;  2KUM A;  1EY6 A;  1M1K C;  2C35 B;  4MHE A;  5CYU A;  1CHP D;  1SYE A;  1E1O A;  2EVB A;  5IIF A;  1E24 A;  1YHQ A;  4IFD J;  1X3P A;  4AYB E;  2CW0 D;  3NEM A;  5M5Y H;  3P75 A;  4KHP Q;  2DN8 A;  3CME A;  4DV1 Q;  2PNH A;  3GP7 A;  4DV5 Q;  5JJI A;  3BVM A;  1Y1W H;  2NVX B;  3E0J A;  1SNQ A;  1WTO A;  1S5E D;  3CCV A;  4X3S A;  3WOF A;  1TWH H;  1Q8K A;  3ULJ A;  3S15 B;  2HDM A;  2SOB A;  4IUU A;  1YNN D;  1D6E C;  4AYB G;  4B9X A;  5JEA H;  2UUC L;  1V1O A;  1TKW B;  1X32 A;  5KEE A;  4GNX B;  1EWI A;  2Z9H A;  1CKN A;  4IUN A;  3H3V I;  4K5X A;  1I4X A;  2NVY B;  1Z6H A;  2ZXR A;  1XTC D;  3PF5 A;  2L55 A;  1N36 Q;  2F3W A;  3F2D A;  2Z6K C;  2DNC A;  3K6O A;  3I4M G;  4Q5V A;  4K0K L;  4A3I G;  2F0O A;  2RHS B;  4A93 B;  1V43 A;  2L15 A;  3NBH A;  4B3M Q;  4OEM B;  4OWW B;  4ABN A;  4ZUI A;  2N8N A;  2KED A;  2F0J A;  1EQV A;  3I55 A;  1UWV A;  4LF7 L;  4UP9 A;  3S1N H;  2Z4H A;  1Y8N B;  4IAL A;  5LMU L;  2KEC A;  4B3S Q;  3A5Z B;  3S14 H;  1RKN A;  1YVC A;  1NR2 A;  4XYO A;  4J15 A;  4BBS H;  1ML0 D;  3FVQ A;  2C5C A;  2FXQ A;  1QG7 A;  5J1Z A;  4KJN A;  2F0F A;  1J6Q A;  1E0B A;  2IW3 A;  4QMG A;  1SYC A;  1PTO H;  2DGY A;  3KF8 B;  2RDG A;  5DM7 3;  1WFQ A;  3HOY B;  3CCM A;  1UUP A;  1MSH A;  1B70 B;  4JV5 L;  5A2Q E;  1EYA A;  1S5B D;  2O5I C;  3A8K E;  1AEX A;  2B63 G;  5M5W H;  4YCW A;  2C9O A;  4BS9 A;  2N78 A;  5E4X A;  4DR3 Q;  3NTI A;  4G7Z C;  5EBC A;  1VQ8 A;  2BH8 A;  1GM5 A;  1CSQ A;  1PH4 A;  5D3I B;  3K7A H;  2R93 H;  4NXN L;  3AQQ A;  3L7Z C;  4U68 A;  1EWH A;  1K3R A;  3HG9 A;  3DLL A;  4G7H C;  2XWB B;  2R7F A;  4YWK A;  4EVO A;  5DEH A;  1G8Z D;  3D4D A;  3SGI A;  1F2Y A;  2KVM A;  3M7N A;  2WP8 J;  4QUC A;  4L5S A;  3NSW A;  5M5Y B;  1LLR D;  3W2D A;  2E74 C;  2XNA C;  1IKM A;  4LMQ D;  2I5L X;  5FO8 B;  2J4X A;  2D9U A;  4ZQ3 A;  4R4T A;  2ZXP A;  5COR A;  1TWH B;  2NTT A;  3KJO A;  1SMY C;  2I0Q A;  2ATW A;  1TVX A;  1CKN B;  2A6H C;  1SND A;  2D62 A;  3MXU A;  5GQO A;  2AUJ D;  2K4K A;  4BY7 B;  2HCI A;  1R9T B;  4KI0 A;  1WJJ A;  4JVZ A;  2XGT A;  1GHJ A;  2BH2 A;  3HOV H;  2OF1 A;  1B50 A;  3NBH B;  1X55 A;  5T1G A;  3GD7 A;  2UUC Q;  3HRZ C;  1D1I A;  1UEA B;  3L2P A;  4OX9 L;  1J8I A;  4R4O A;  4B3R Q;  1KXL A;  1JJC B;  4QIW B;  5BN3 A;  3CCL A;  4PG3 A;  3VA5 A;  3U4Z A;  3OIP A;  3UI2 A;  1OLT A;  4NW2 A;  1VS0 A;  2ZTC A;  1PMR A;  2L11 A;  2EXD A;  2WIN B;  3M9B A;  2F52 A;  2ZJR A;  4K0K Q;  3M4P A;  1X3F A;  5IT9 c;  4KHV A;  3K5M A;  1K73 C;  3CCR A;  2EJG C;  1PXU A;  3TP5 A;  3FEW X;  1YBY A;  1EL0 A;  4LF7 Q;  4BBS B;  2E2H H;  2A69 C;  2I5M X;  5I2X A;  3D31 A;  4YCU A;  4P74 A;  1VQI A;  5LMU Q;  3K58 A;  5CGK A;  1XNR L;  4YHH L;  2QEJ C;  1WTH A;  2K6A A;  1HHV A;  1F9S A;  3SK5 A;  2PZT A;  1WVL A;  3H0G G;  1D2B A;  1HUN A;  5ELB A;  1Z47 A;  1U9R A;  1AFP A;  5M5W B;  2UUB L;  5BN4 A;  3ERO A;  1VF5 C;  1ET9 A;  4I7Z C;  2Z4I A;  4UAI A;  3BDO A;  1VQD A;  4C2M H;  3F2B A;  3K7A B;  1HNZ L;  4JV5 Q;  3NEN A;  4JI6 Q;  2R93 B;  1EQT A;  3HOU B;  1GO3 E;  3J80 c;  2J7Z A;  2EYL A;  1A0I A;  5CV6 A;  4A3B H;  3P7J A;  2OQK A;  3Q22 A;  3NUC A;  3LWE A;  3AFQ A;  3IAY A;  1HXY D;  4MN3 A;  5EKL A;  2Q2I A;  5EPL A;  4A3K G;  3T4A C;  3MEF A;  1PFS A;  2Y0S E;  4NXN Q;  3NEL A;  1OXS C;  1LTI D;  3GTP H;  1JB3 A;  1EEF D;  1YNX A;  1HQM C;  3OHX C;  1UEB A;  4DR4 L;  3MWY W;  3DM1 A;  4DR1 L;  1IL2 A;  4DV2 L;  3PO2 H;  3SDZ A;  1N33 Q;  4WOR A;  1TWG H;  1YZ6 A;  3QO2 A;  1IKL A;  4HR7 B;  2ZJQ A;  2Y0S G;  4JG2 A;  2Z6K A;  2B8G A;  4NMZ A;  5E3F A;  2CH4 W;  1WTV A;  2B2T C;  3ULL A;  3N52 A;  1PRT F;  4DA2 A;  4OO1 H;  4NDX A;  2WII B;  1TS4 A;  4LUO A;  2VW9 A;  1QUQ A;  1VQ5 A;  4RH1 A;  1OXX K;  3OSO A;  1NR4 A;  2B29 A;  5EPK A;  3HOV B;  1VQL A;  1PYB A;  2Z6B A;  3CAM A;  1HNX L;  5FKA C;  4B3T Q;  4QCL A;  1CK1 A;  3CQZ H;  1VQN A;  4CKE A;  3H94 A;  4G4K A;  2IX3 A;  3I2Z A;  4A3F G;  1LM0 A;  1IW7 D;  2JN4 A;  1B3Q A;  1U5K A;  1QNU A;  1DOM A;  1X65 A;  5KNC A;  4AQY Q;  1SYG A;  4JI5 Q;  1K8M A;  1TY0 A;  3HOZ H;  3TRE A;  2UXD L;  3CCQ A;  2AKW B;  1SBB B;  4IJH A;  1VQ9 A;  4ZCK A;  4DXF A;  3V2T A;  3G71 A;  1TS5 A;  5M3F G;  2YTX A;  1O7Y A;  3J81 L;  4X3K A;  1XMQ L;  2WKC A;  3GTO H;  1HNW L;  2MFI A;  5BR8 Q;  3MAQ A;  2AWO A;  4DAY A;  3JC6 6;  3Q23 A;  3CXC A;  2F0Q A;  1VQJ A;  2EPB A;  1EIH A;  2H4O A;  1X3E A;  3RZD B;  3GV6 A;  2UU9 Q;  4RHS A;  4R1J A;  3BDL A;  1SXT A;  2WAQ E;  2YTV A;  1OXT A;  3LWU A;  3PIP A;  3QR8 A;  2IT1 A;  3MEH A;  5HUR A;  1QIL A;  2A6E D;  4QY7 A;  2L4N A;  5FO7 B;  2MNA A;  1HFN A;  4A3B B;  1PTO D;  1VQH A;  2B3G A;  3KLS X;  1JWS D;  2R7Z B;  1IBL L;  1KHI A;  4POG A;  4UPA A;  1MHW C;  2YYZ A;  3U4V A;  3K5L A;  2K1B A;  2WAQ G;  2K5Q A;  2Z8L A;  5IGG A;  1I4Q A;  1HNZ Q;  2KQ3 A;  4X66 Q;  4FHG A;  2PMZ E;  5KND A;  1LV9 A;  4KN7 C;  5FLX L;  1PVO A;  2CVR A;  4IFD I;  3GTP B;  2NZO A;  4P72 A;  2VUM G;  4KHZ A;  4NPS A;  1Q46 A;  3BZK A;  4DXG A;  3PO2 B;  3GTL H;  5DM6 3;  1S40 A;  1I50 B;  2XRS D;  5C4Z A;  2D0O A;  3J81 c;  4FXK C;  1I3Q H;  3RMH A;  3PMF A;  2PZW A;  5DAU A;  4DR4 Q;  1B2T A;  3I3C A;  4DR1 Q;  3CC4 A;  1DD2 A;  4ILW A;  3STB D;  5M5X H;  2BCO A;  1BBU A;  4V19 0;  2PQA A;  3FP9 A;  4LF8 Q;  5ELO A;  4H44 C;  5C5L A;  2L1B A;  3R2T A;  4FXD A;  1I4G A;  1Q12 A;  5M3F H;  2K05 A;  1XTD A;  4GZY C;  4Y52 H;  1JC7 A;  1K8G A;  2NBF A;  1LT5 D;  2A73 B;  3T51 B;  1PH3 A;  3PQI A;  2F0V A;  2XN9 C;  1QZH A;  1O80 A;  1M8A A;  2F3I A;  3HOZ B;  2YU9 H;  1KAB A;  4HTH A;  3CAN A;  3DWQ A;  1UE1 A;  3T1Y L;  1LYL A;  3GDE A;  4A93 G;  4A3J H;  4HIK A;  3UDG A;  1GJX A;  3WDN A;  1HR0 Q;  2PI2 A;  1LTT D;  1WTQ A;  4DAY B;  1JJ2 A;  3GTO B;  1FYC A;  1TWF H;  5CV5 A;  3T53 B;  2HIX A;  1JCK B;  5JJZ A;  3PUZ A;  2IWH A;  5EKK A;  1RD9 D;  1JOQ A;  4CJ2 C;  2JA6 H;  2TMP A;  4HAE A;  3H15 A;  1XMQ Q;  2AQ3 B;  1LT4 D;  1ASY A;  4R4Q A;  1DCZ A;  5COY A;  2JA5 G;  4DKA C;  4KHP L;  3FPU B;  1CTM A;  3D6W A;  2QEX A;  2NN6 G;  3T16 A;  4DV5 L;  5IP9 G;  3PIP 3;  5CV4 A;  4FXG C;  2NZH A;  2E2I H;  3HOY G;  2UUA L;  5I6Y A;  4LF9 Q;  2XIW A;  1PH7 A;  2XRQ D;  2JEB I;  5M3M H;  1BBW A;  3K81 C;  4A3G B;  4F88 A;  1IL8 A;  1NAP A;  4J1M A;  1VQA A;  1AZP A;  3L0O A;  2SDF A;  1GOZ A;  3K5O A;  1GVP A;  3IKJ A;  1IBL Q;  1K8A C;  1IBM L;  1FNU A;  2B2T A;  2A19 A;  1N36 L;  1GUG A;  3DWA A;  3GTL B;  1YIT A;  2DJF C;  2L9H A;  5IGF A;  3MC0 B;  4X62 Q;  1Y1V H;  1ZYR C;  4B3M L;  1I3Q B;  4CJ1 B;  2PQA B;  2N88 A;  1FJG Q;  1A63 A;  3H3V C;  2KHJ A;  1E2W A;  1GHK A;  1G6P A;  5ELD A;  3KK7 A;  1CKO A;  2MUY A;  4GLV B;  4A93 H;  4B3S L;  1GXD C;  1J5E L;  1PH5 A;  5IYC G;  3K7U C;  2J0T D;  1CQV A;  4HSP A;  1STH A;  2EOT A;  5I2Y A;  1X6O A;  5JEA G;  1D5M C;  1C48 A;  4QIW E;  1PRT B;  4POF A;  3EA6 A;  2AWN A;  4MNO A;  4XT1 B;  1G2T A;  1AE3 A;  1G51 A;  4LWC A;  3VA7 A;  2DNE A;  4F7X A;  1K83 H;  4DR6 L;  1IYU A;  3TZU A;  1TT2 A;  2YTY A;  1BNZ A;  4JOI A;  1Q86 C;  2NN6 H;  1VQE A;  4BBR H;  1SMX A;  2IHE A;  4TRD A;  3M85 A;  2H1E A;  4A3D B;  5IGC A;  3HOY H;  2XTI A;  3EJI A;  3QJY A;  3DMU A;  1NCV A;  3NP8 A;  4XQQ A;  4R8N A;  1NY4 A;  4K2K A;  1TWF B;  1AH9 A;  1NSN S;  2KHS A;  1FL0 A;  1U4R A;  1E1T A;  5CC4 A;  3CMA A;  3UDI A;  3E6Z X;  2UXC Q;  3CCE A;  1BCP F;  3AMU A;  3CU7 A;  3BYT B;  3JAM i;  3K80 C;  2ZM6 L;  4BBS G;  1YHA A;  2F0N A;  1F2Z A;  3NQT A;  3RLF A;  2Q8R E;  2FJ2 A;  4LUV A;  2KEN A;  2OEO A;  1XYI A;  4BY1 B;  2XSC A;  1JR0 D;  4KMU C;  2LMC B;  4C1N K;  1L0X B;  2E2I B;  1LTG D;  1VQ4 A;  2K75 A;  5FJ8 G;  4JI1 Q;  1SFO B;  2A68 C;  3MXN A;  5M3M B;  2OQ0 A;  3S24 A;  4DK1 A;  1Q3L A;  4GN4 B;  1STG A;  1NUC A;  4C3J H;  5J3B A;  1RCV D;  2UUA Q;  1ESR A;  1EFW A;  2R93 G;  5IYC H;  1MGS A;  1SYB A;  1O7I A;  1ESF A;  3AYH B;  2N55 A;  5FOB B;  1UE6 A;  2DJG C;  4BWG B;  1STN A;  4BY7 H;  3LX0 A;  4ZKB B;  4KK7 A;  1C7Y A;  1Y1V B;  4P73 A;  4PZ7 A;  1R9T H;  4B3R L;  1I6H H;  1FR3 A;  3G7L A;  2E8G A;  2JSO A;  2HUG A;  4J8Q A;  1Z9F A;  5C5M A;  4UP8 A;  5IGD A;  2VB2 X;  1G29 1;  4JC0 A;  1K3B C;  1IBM Q;  3UDF A;  4LFB Q;  3VDY A;  5I6W A;  3HZX A;  2DY7 A;  1BR9 A;  1N8R C;  1BOS A;  3NTK A;  1UE5 A;  4N9P A;  1EU3 A;  3GTK H;  4DR2 Q;  2QIL A;  4IQZ A;  1HH2 P;  1SE8 A;  3KBG A;  1FNV A;  4PMB A;  3MHB A;  2R92 H;  3TS2 A;  4E6I A;  3CPF A;  2K52 A;  1RF2 D;  5GAD C;  2D5D A;  2Q2T A;  3NXW A;  3BG3 A;  1J5E Q;  5A2Q L;  4XQN A;  1YJW A;  3BYY B;  2F1M A;  5I4D A;  3HOV G;  2F0T A;  3CCU A;  1SJH D;  2F0D A;  4YWM A;  4TSS A;  3TBI B;  1LTA D;  4LF6 Q;  4OIK A;  3I4O A;  1K83 B;  3AB9 A;  5H1S E;  4LUZ A;  3R8B A;  4DAV A;  3F2C A;  5JAV A;  3NQI A;  4KKT A;  4BBR B;  3RN2 A;  4ME5 A;  4N8X 1;  1QZG A;  2FIN B;  5FJ8 H;  3I91 A;  1Y69 U;  4FF4 A;  4JI6 L;  4DR6 Q;  4NP5 A;  2VB3 X;  1KAW A;  3UE0 A;  1I94 Q;  4IOC A;  1MJE A;  2PW5 A;  1STE A;  4ZUJ A;  1BDO A;  2EDG A;  4MIU A;  3R3O A;  1F9R A;  1EYD A;  4RAU C;  4FYD A;  1STB A;  4FHF A;  4FHD A;  5C0X G;  3HOU H;  3MXN B;  3OW7 A;  4DV4 Q;  2F0G A;  5CMD A;  1EY5 A;  1WCM H;  4HED A;  1JIC A;  1VQM A;  1Q7Y C;  1JT8 A;  4H7B A;  1A15 A;  4P2C B;  1VCI A;  1RDP D;  2ZM6 Q;  4DUZ L;  1N33 L;  3IL8 A;  1XMO L;  1AZQ A;  1LT3 D;  4C3I H;  3TDQ A;  1OTC A;  3H3V H;  4C3J B;  5LMN W;  1L1O C;  3Q24 A;  1FVI A;  5FLM H;  4RH6 A;  2DY8 A;  3AEV A;  4HCE A;  4RFB A;  1HQR D;  4OIJ A;  4A3B G;  2R7Z G;  4B3T L;  3ERS X;  4DK6 C;  3I70 A;  4R4I A;  2O2L D;  3PIO A;  1I6H B;  3HFZ B;  2NUC A;  4HSV A;  2RBM A;  4AIM A;  4OXP A;  5ELE A;  2F0H A;  1YNN C;  1ONL A;  3QWN A;  4K9R A;  1QE6 A;  1L2F A;  4AQY L;  5FO9 B;  4JI5 L;  1ZKO A;  4NXM L;  4PV1 C;  1PFN A;  2IHF A;  2F0I A;  3TZD A;  4FNF A;  3PO2 G;  1UE7 A;  3GTK B;  3WOE A;  5JEA J;  1SAP A;  5IT9 E;  1NBW A;  3HEJ A;  5IP7 H;  5CV7 A;  1CA6 A;  2R92 B;  5BN5 A;  3RN5 A;  1AW7 A;  1YNJ D;  4PZ6 A;  2EQS A;  3BZC A;  1PH8 A;  1ET6 A;  4OO1 G;  1LO5 D;  4KD3 A;  4ZLT F;  1O78 A;  4DV6 L;  5KYL A;  5BR8 L;  1PA6 A;  5AJ3 L;  2R61 A;  4WRD A;  1CKM A;  1WD1 A;  1MIU A;  1JOK A;  4Z9C B;  1A8V A;  2ID0 A;  5C0X H;  5DLQ E;  2UU9 L;  1PRT C;  2E76 C;  2F3V A;  3C1F A;  5IGE A;  1ICF B;  3OOC A;  3GTJ H;  3H6M A;  5EKI A;  1SLJ A;  4QF4 A;  1STY A;  1QVG A;  3O13 A;  2B2V C;  1XPO A;  4C3H H;  4A3E B;  1PHJ A;  1CA5 A;  3RZD H;  3HOZ G;  1N9W A;  1HUM A;  2VL6 A;  4P71 A;  1BXT A;  1PH6 A;  4FO2 A;  3J80 E;  1LUZ A;  1ZEQ X;  3EFX D;  1TS2 A;  2HQL A;  5LMN Q;  1PYW D;  3L3O C;  1VDZ A;  1CHQ D;  1C9O A;  1QVC A;  4A76 A;  3S2H B;  4OEL B;  4X66 L;  3J80 i;  2R7Z H;  1JWU D;  1WCM B;  3G48 A;  2NVQ B;  1B53 A;  1Q1B A;  1IXR A;  1S5F D;  1WOC A;  3BZD B;  3WWV A;  3S2D H;  4C3I B;  1X54 A;  4KKS A;  3ERQ A;  2E2J H;  4UHV A;  5JVH 3;  3GTG B;  1WTX A;  4DUZ Q;  2RSO A;  1VQK A;  1I50 H;  1ILQ A;  1XMO Q;  3LGJ A;  3NPP A;  2Z0S A;  5C6A A;  4LF8 L;  5I9P A;  2F03 A;  3RD4 A;  4ZYS A;  2RDH A;  4GOP C;  5EPJ A;  1EIY B;  3BDC A;  4UY8 C;  2NVT H;  5C44 B;  4A3G G;  2KJX A;  1TWA B;  3PCO B;  3PIO 3;  3NE5 B;  4KTA A;  1QJO A;  1W2B A;  4GN3 B;  4FF1 A;  1B44 D;  3HOX H;  4TQU S;  1BO0 A;  2QKI C;  3QOL A;  3T56 B;  2JE6 I;  4LFA Q;  3PUX A;  4CDC C;  3D0F A;  1EY9 A;  5C3E H;  5F2D A;  5C4X H;  1RJT A;  5FK9 C;  1EEI D;  3P20 A;  4JBM A;  2HQE A;  1A2T A;  2JA7 H;  1KNA A;  2LKV A;  2XWJ B;  3EBE A;  2F4V Q;  4HMJ A;  3BVG A;  4RKL A;  4O42 A;  4YIJ A;  3OTO L;  1HR0 L;  3ND8 A;  4NXM Q;  2V4D A;  2CQO A;  3MA2 B;  1EY0 A;  1IHZ A;  1F9P A;  1QOH A;  2KCN A;  1XJV A;  3FDT A;  1S5C D;  4JPB W;  1ICW A;  3K0X A;  1II3 A;  1V1Q A;  3PUY A;  4IPH A;  1FNW A;  4CKB A;  3HKZ B;  3TP8 A;  4FF3 A;  1O7Z A;  3VYS A;  2Q8T A;  3ICE A;  1H9M A;  2PI2 E;  4IJL A;  4CHT B;  2WFW A;  4DNI A;  3PO3 H;  1KLU D;  4DV6 Q;  1VQ6 A;  3H91 A;  4PMW A;  3GTJ B;  1EOV A;  5AJ3 Q;  2B2W A;  1QVF A;  4JOI C;  1WTW A;  1WI5 A;  1EY7 A;  3VR2 A;  1E22 A;  2X6L A;  2JA8 B;  4C3H B;  5C3W A;  1CFM A;  3M4Y A;  2FHT A;  1BF4 A;  3OIQ A;  3LNN A;  5E4W C;  3S1M H;  1Q90 A;  3E5S A;  3E3X A;  1VF7 A;  1L0W A;  4LF9 L;  1JJG A;  1GUO A;  1JOO A;  4XT3 B;  5EBD A;  4A3J G;  1BQQ T;  4RGN A;  4DV7 Q;  3CW2 C;  1HZA A;  1SSO A;  5C0X J;  4TKO B;  3P1H A;  1PH1 A;  4A3D G;  2D0P A;  3MFY A;  2PNR C;  2K5N A;  2RCF A;  1A62 A;  2H5X A;  4FVM A;  2O4X A;  4HCS A;  4APV A;  1XXG A;  2A8V A;  2B2Y C;  3FKI H;  2EXZ A;  2I5H A;  3X3N A;  4A3G H;  2O5J C;  2RKS A;  1EYC A;  1L1O A;  2EIF A;  4HIO A;  1VQP A;  1KTK A;  1HCZ A;  4L5Q A;  4DAP A;  2JA6 G;  4X62 L;  3KBX A;  1BVS A;  3S2D B;  1HPC A;  3DEO A;  4IUV A;  1PFM A;  2KOL A;  2SNM A;  2E2J B;  3MXP A;  3G6J B;  1FJG L;  3DEP A;  3S17 B;  1MSG A;  4GKJ Q;  4K14 A;  4BY1 G;  3CF5 A;  2CFM A;  4N8F A;  3J81 i;  5KNB A;  1QUQ B;  5EGT A;  4PQX A;  1NTG A;  1A3T A;  1SNC A;  1K0R A;  1IYJ B;  1ENA A;  3SXH A;  4XDX A;  5M3M G;  2NVT B;  3CCS A;  2A5H A;  4ODG A;  1SYD A;  1W3S A;  2JQO A;  5ELF A;  4A3M B;  3TP6 A;  3HOX B;  1VQG A;  3CRL C;  2K01 A;  3MXG A;  1V9P A;  1F77 A;  5AFW A;  2EZV A;  5C3E B;  3T13 A;  5C4X B;  1SYF A;  3GV3 A;  3ZYY X;  1TQO A;  1Y1V G;  4IOA A;  1TXY A;  2JA7 B;  1GUN A;  1I5F A;  2P5Z X;  3CC7 A;  3RUZ A;  1CM9 A;  1TWC H;  3K8A A;  3AU7 A;  1VQO A;  1RTN A;  2WKD A;  5KYI A;  4JYA L;  1Y8O B;  1VQC A;  1IW7 C;  2M00 A;  2F0E A;  2MGS A;  1OXV A;  4LK1 C;  1EOT A;  4C1N I;  4CDF C;  3D3R A;  1B1Z A;  3VYT A;  2K33 A;  4DPG A;  2BE5 D;  2JXM B;  5FLX c;  2LXK A;  4A3C G;  2B2V A;  3OTO Q;  2UXC L;  2CCZ A;  4A3D H;  5K36 H;  3PO3 B;  4FF2 A;  3NWT A;  2AQ2 B;  2WB1 B;  2PO4 A;  2PW7 A;  4JCV E;  4KJO A;  5C4J B;  4DV3 L;  3Q8D A;  4FHC A;  3S1M B;  1E2V A;  3W1B A;  1KD1 C;  3ER0 A;  4JI1 L;  4HJA A;  1MI2 A;  1S5D D;  3V05 A;  3J7Y W;  3H09 A;  1G91 A;  4JBK A;  4BY1 H;  3A5U A;  1SN8 A;  4BBR G;  1L1O B;  1FGB D;  3ONA B;  5LL6 X;  2EYJ A;  4A3K B;  2NN6 I;  4B9W A;  1SFO H;  4CKC A;  2MO0 A;  5IWA L;  3FKI B;  1X3G A;  4HN7 A;  3TSS A;  1F9Q A;  3R93 A;  2QDL A;  2A6E C;  4F87 A;  4MZ9 A;  3DWP A;  3M4Q A;  3TME A;  1PTO C;  3KLS A;  4DNT B;  5CV9 A;  4GOP A;  2HHH Q;  1CQF A;  3VYU A;  1TU2 B;  4LFB L;  4LJZ C;  5CBE E;  2KEE A;  2ICI A;  1B9N A;  4XTC S;  2JK8 A;  1YIJ A;  1BCP C;  1DON A;  1JWM D;  2VY3 A;  4DR2 L;  3MFG A;  5IOD A;  1EZ6 A;  2CWP A;  4PMC A;  1KC8 C;  4JBW A;  3CPW A;  2MP1 A;  4RCO A;  4ZRZ A;  3SK6 A;  1H9J A;  4C3J G;  5HY6 A;  1SNP A;  2F0M A;  2X6G A;  1D1K A;  4A3C H;  1QWY A;  4IZ8 A;  4MTN A;  2EYP A;  3STB C;  1XX8 A;  2CWA A;  2RDF A;  4LF6 L;  2BA0 A;  3A8I E;  5KGU A;  1KRS A;  4BY7 G;  1SRO A;  4GLX A;  4KN4 C;  4RG1 A;  1KL9 A;  1SEB D;  2EYH A;  4K6D A;  2FFK B;  3RR5 A;  3JAM L;  4JI2 L;  1TWC B;  3OPO A;  4KY7 A;  1E2Z A;  4HMI A;  2FMC A;  3R2I A;  1A3V A;  1H9R A;  2CQA A;  3F8T A;  5CR3 A;  1CSP A;  1MJC A;  3I4N H;  2LFN A;  3UE1 A;  1SE4 A;  1I94 L;  1C0A A;  5TSS A;  1SDF A;  2BA1 A;  2K14 A;  4IUR A;  4JBJ A;  1PTO F;  4EQ5 A;  2R92 G;  4JYA Q;  2MHV A;  2EYM A;  1B9M A;  3JAM E;  3J7A V;  3U50 C;  2OTL A;  2B2U C;  3EQL C;  1XNQ Q;  4DV4 L;  2GVB A;  1CZG A;  4HJ7 A;  4N9T A;  1SRU A;  1YI2 A;  2IJ0 A;  2D2C C;  4B08 A;  2B8F A;  3VR4 A;  3QIA A;  2B2Y A;  2QDB A;  4R4C A;  4UP7 A;  1EU4 A;  4KY5 A;  4DK0 A;  1E3P A;  2HIV A;  4Q0F A;  3HOW H;  1TY2 A;  4JK1 C;  2NZ1 D;  4DV3 Q;  3BS1 A;  1LAB A;  5E7N A;  4YWL A;  2WAQ B;  2XVS A;  4RGO S;  4DFA A;  4HJ8 A;  2F0W A;  4A3E G;  1NMF A;  1P8L A;  1G2S A;  4GOP B;  4DNR B;  2BOS A;  4QJF A;  3A7L A;  3OMC A;  4CDE C;  2OCE A;  5JPN C;  1K0S A;  4A75 A;  3I56 A;  4DK3 C;  3KFU A;  3GTM H;  4DN4 M;  1GUW A;  4RKB A;  5IOC A;  5DNF A;  1KDC A;  3HP3 A;  2ES2 A;  1X9N A;  3HOU G;  3J81 j;  4WJW A;  5IWA Q;  3QB3 A;  5K5P A;  1PZI D;  1MBY A;  2RHQ B;  2PMZ B;  1SMY D;  4V0B A;  1DZ1 A;  3OMG A;  1WCM G;  2A6H D;  4BXX H;  4XXE A;  1OO9 B;  3NK9 A;  4JI3 L;  4A3L H;  1DM0 B;  4O1N A;  1HRJ A;  1GD7 A;  1O7L A;  2AMC B;  4C3I G;  4EX5 A;  4FHE A;  1HJP A;  1WD0 A;  1RL2 A;  4K5W A;  2K7V A;  2VXW A;  3HKS A;  1KNE A;  5IYB G;  2RSN A;  4CGY B;  2EY2 A;  5FLM G;  3PUW A;  4LF5 Q;  2E75 C;  4IPC A;  4KLK A;  4JI7 Q;  4OWT B;  3SK4 A;  4O0A A;  1X56 A;  5C44 G;  4LFC L;  2WV6 D;  4K8I A;  3SE0 A;  2FMM A;  4X64 L;  1VQ7 A;  1R4P B;  1VQF A;  1JB7 A;  2L5T A;  2ZXO A;  4FP5 D;  3TP7 A;  2K28 A;  3ND9 A;  3I4N B;  2G9D A;  4WJ3 M;  4JI0 L;  4ID6 A;  3NBI A;  2HD3 A;  4FDB A;  1G6Z A;  4JI2 Q;  2ENB A;  2A69 D;  3HKZ E;  5EJW A;  5LMN L;  4X65 Q;  5IP7 G;  2K03 A;  2RA4 A;  3D8G A;  1PRT D;  2V1C C;  5LL6 S;  4J6H A;  3D6C A;  3Q6S A;  1DOK A;  4A3E H;  1KLG D;  3AFP A;  1HZB A;  1QCB D;  1MKH A;  3S1Q B;  1KRT A;  3KLR A;  1NE3 A;  4X3U A;  2LS0 1;  2JA5 B;  2B2W C;  3HKZ G;  1B4O A;  1V1P A;  2EY5 A;  4QQB X;  4DR5 L;  3S2H H;  1TS3 A;  3I8Z A;  4JW0 A;  3S1R B;  2Q2H A;  4OGQ C;  2YV5 A;  1A2U A;  1S4Z A;  4H02 A;  4L63 B;  3GTQ H;  1XPU A;  4GLA C;  4M8A A;  3UDX A;  3PGZ A;  3GQB A;  3HOW B;  2NVQ H;  5C0X I;  3M4O B;  2JA8 G;  4DR7 L;  3X3M A;  4C3H G;  4UDU C;  2GA4 B;  2MO1 A;  1VMP A;  4RGM A;  5GAH C;  3KUP A;  1N32 L;  2IPK D;  2PPB C;  4Y7N H;  1SNM A;  4KKU A;  2EYF A;  3GTM B;  1W6J A;  5C3X A;  5IYB H;  1ZXT A;  3GTG H;  4HJ9 A;  4JI4 L;  1EQR A;  2CW0 C;  1ASZ A;  4HIM A;  2IX1 A;  1SR3 A;  2B39 A;  5J39 A;  2HT1 A;  2OT2 A;  4DUY L;  1HTL D;  1LTB D;  5IT9 L;  3MTS A;  1UAP A;  2GVA A;  4S3S A;  4LFA L;  3M3Y H;  4EQO A;  5C44 H;  1TWA H;  2KCC A;  3I4M H;  4RH0 A;  3W3A A;  2JJQ A;  1FD7 D;  1Y1W B;  2QW7 A;  2OTJ A;  4A3I H;  1E7Z A;  3OYY A;  1EY8 A;  3B6Y A;  2F4V L;  3CD6 A;  1VQB A;  1IYV A;  5A35 A;  2LY7 A;  2MJ8 A;  2F4I A;  1D5Z C;  2KBN A;  2BDN A;  1Z7T A;  3J7A 5;  1NMG A;  4JI3 Q;  3SEB A;  1BKB A;  4K6L A;  5G3L D;  1Q82 C;  2ICE C;  2K32 A;  4LF4 L;  4KY6 A;  1N34 L;  2TSS A;  4CBV A;  1CUK A;  2DUD A;  3QOJ A;  1K8O A;  2JP1 A;  4DU9 A;  2EYO A;  2KCM A;  3I73 A;  3C1E A;  2M9V A;  1C8C A;  2F0S A;  5IYD G;  1ROD A;  4A3M G;  1WTP A;  5LHY 1;  1EYG A;  3K5N A;  3HOX G;  3J80 L;  1JQY D;  3PUV A;  1W6K A;  3EIV A;  2EE1 A;  4OO1 I;  3K59 A;  5L37 A;  1F2L A;  1SE3 A;  4XQJ A;  3NTH A;  4K2L A;  1JE5 A;  4QUF A;  3W1G A;  4YCV A;  4LFC Q;  4U67 3;  5C3E G;  2VZA A;  2B2U A;  5IY0 A;  5C4X G;  2R3Z A;  4RWS C;  3VR3 A;  4X64 Q;  3S1N B;  2LSS A;  2JA7 G;  2B63 H;  4DV7 L;  1EFI D;  1AP0 A;  3S14 B;  2JA8 H;  4H13 C;  3VR6 A;  3TEH B;  2PYK A;  3URY A;  4EQP A;  3KJP A;  4JI0 Q;  1UNS A;  5ELN A;  3RLN A;  1V1P B;  1T5X D;  3D4W A;  1H95 A;  5ISR A;  2WB1 E;  1S3O A;  2HCC A;  1SE2 A;  4F8M A;  4G7O C;  3ZJY C;  1A3U A;  1PTO B;  2R6G A;  4QL5 A;  1B8A A;  5KIX A;  3PO3 G;  1PDQ A;  2MQH A;  3GTQ B;  1L0Y B;  2K50 A;  5E1F A;  5JOB A;  5HGT A;  2WB1 G;  3DUZ A;  1J9O A;  4WJ4 A;  4R9W A;  3NWS A;  4G57 A;  2A1A A;  4GKJ L;  3IFD A;  1KIX A;  4DR5 Q;  1BCP B;  4NKL A;  1LTL A;  1WYD A;  3T1H L;  4WFN 3;  3PSI A;  4ZKC B;  2Z1C A;  5C4H A;  2NTS A;  5HGQ A;  4Y7N B;  2RQX A;  2QA4 A;  2UXB L;  4BA1 I;  4O2D A;  2AHO B;  4AYB B;  3S17 H;  1PV4 A;  4DR7 Q;  1U4P A;  3DM3 A;  1S72 A;  1YJ9 A;  3K0Y A;  4YY3 L;  3BVZ A;  3A74 A;  2G9H D;  2ASB A;  5EQ0 A;  3A8J E;  4QB4 A;  1N32 Q;  1CZW A;  1Q1E A;  4HID A;  3M3Y B;  3FKI G;  1EQQ A;  1IBK L;  1PFB A;  3I4M B;  5IYD H;  3RNU A;  4JI4 Q;  4A3M H;  1DJR D;  4A3I B;  4L5T A;  4IUP A;  1SJE D;  4DUY Q;  3OWF A;  3A7A B;  1LAC A;  1OXU A;  1YEZ A;  1AN8 A;  2L12 A;  2SNS A;  3BU2 A;  3DXJ C;  3FHW A;  5JJL A;  1KDA A;  3A55 A;  1NJI C;  1Y8P B;  2EJF C;  1ENC A;  3L9A X;  4C56 C;  2HDL A;  3S9W A;  3VYR A;  4RCN A;  1EZ8 A;  4JI8 L;  3SK8 A;  1MD2 D;  1HZC A;  3I4L A;  1D7Q A;  2ALY B;  3N6R A;  1I6V C;  1STA A;  3C2P A;  4LF4 Q;  4GNX C;  4KV6 A;  1N34 Q;  4GKK L;  1YNJ C;  3SVM A;  1ENF A;  1EY4 A;  3PV0 A;  4DV0 L;  3H0G H;  2KA7 A;  3HGB A;  4OX9 Q;  1D5X C;  1HA6 A;  2NB0 A;  1CT1 D;  3SHL A;  2B63 B;  1HTP A;  1I4P A;  2KCT A;  3CRK C;  3K57 A;  4BA2 I;  5M9O A;  5C4J H;  5D65 A;  3KOJ A;  2E2H B;  4X3T A;  3DHQ A;  4M1U B;  4X6A H;  2K5D A;  3CP0 A;  4A4I A;  2M2L A;  2Q8I B;  5JVG 3;  3G4S A;  1XPR A;  2EJM A;  5K36 G;  3PF4 A;  3FRP B;  2NYZ D;  1U4L A;  3NHH A;  4A3K H;  2HHH L;  3F2U A;  1K28 A;  4K8J A;  2PZU A;  1XNR Q;  2VS1 A;  1T5E A;  4YHH Q;  4EGV A;  2IL8 A;  4TVA B; 
#chains in the Genus database with same CATH homology
 3CPF A;  2K52 A;  5GAD C;  2CWP A;  1KC8 C;  4YHH L;  5IE8 A;  2Q2T A;  4JBW A;  3CPW A;  4HJ5 A;  1J5E Q;  1HR0 W;  1YJW A;  1Q81 C;  2E5L L;  2IX0 A;  3HOV G;  3H0G G;  2UUB Q;  5HY6 A;  3CCU A;  4YWM A;  1Z47 A;  4A3C H;  4LF6 Q;  4IFD G;  2UUB L;  3I4O A;  3T1H Q;  2ZTE A;  4MTN A;  5H1S E;  3STB C;  4LF6 L;  2CWA A;  4LUZ A;  2BA0 A;  2VNU D;  1KRS A;  4BY7 G;  1SRO A;  3F1Z A;  4C2M H;  1VQD A;  3F2C A;  3F2B A;  4GLX A;  2UXB Q;  4RG1 A;  1HNZ L;  3NEN A;  3KDF A;  1KL9 A;  4JI6 Q;  4JV5 Q;  3RN2 A;  3RR5 A;  1GO3 E;  1QZG A;  4JI2 L;  3J80 c;  5FJ8 H;  2UXD L;  1A0I A;  4A3B H;  3S16 H;  2OQK A;  4YY3 Q;  1PH9 A;  4JI6 L;  4DR6 Q;  4A3F H;  2VQF L;  3UE0 A;  1KAW A;  3F8T A;  1I94 Q;  1CSP A;  1MJC A;  3AFQ A;  4IOC A;  3I4N H;  1MJE A;  3UE1 A;  2ZJP A;  2Q2I A;  1IBK Q;  1I94 L;  1C0A A;  4A3K G;  3MEF A;  1PFS A;  2VQE L;  2Y0S E;  4NXN Q;  2BA1 A;  2K14 A;  3NEL A;  1OXS C;  3GTP H;  1YNX A;  4JBJ A;  4DV2 Q;  1UEB A;  4EQ5 A;  5C0X G;  2R92 G;  3HOU H;  4JYA Q;  3TS0 A;  4DR4 L;  4LNQ A;  3MXN B;  4DV4 Q;  4DR1 L;  3U50 C;  1IL2 A;  4DV2 L;  3PO2 H;  3KLW A;  4L5R C;  2OTL A;  1N33 Q;  1WCM H;  1XNQ Q;  1TWG H;  4DV4 L;  2GVB A;  1VQM A;  1Q7Y C;  1JT8 A;  1YZ6 A;  2ZM6 Q;  4DUZ L;  1VCI A;  4HJ7 A;  2ZJQ A;  1N33 L;  3U58 A;  3W5O A;  1SRU A;  2Y0S G;  3E0E A;  4JG2 A;  2Z6K A;  1YI2 A;  1XMO L;  1XNQ L;  2K5H A;  3ULL A;  3CCJ A;  4C3I H;  4JI8 Q;  4OWX B;  1OTC A;  4LUO A;  2VW9 A;  1AE2 A;  1QUQ A;  1VQ5 A;  1OXX K;  1HNX Q;  4R4C A;  2B29 A;  4UP7 A;  3H3V H;  1VQL A;  5LMN W;  1L1O C;  1E3P A;  1FVI A;  1PYB A;  2HIV A;  1RIP A;  3CAM A;  4DV3 Q;  3HOW H;  5EAY A;  1HNX L;  1EIF A;  4GKK Q;  5E7N A;  5FLM H;  4B3T Q;  4YWL A;  3CQZ H;  3AEV A;  4LW1 A;  1VQN A;  4A3B G;  4ALP A;  1B7Y B;  4HJ8 A;  4A3E G;  2R7Z G;  4DV0 Q;  1NMF A;  4B3T L;  3RZO H;  3ERS X;  1P8L A;  3I2Z A;  4DK6 C;  1LM0 A;  4A3F G;  2KHI A;  4R4I A;  3I4N G;  3PIO A;  4GOP B;  4QJF A;  3BJU A;  1U5K A;  3HFZ B;  1X65 A;  2OCE A;  3EN2 A;  4AIM A;  1FGU A;  3RLO A;  4AQY Q;  4A75 A;  3I56 A;  4OXP A;  4DK3 C;  3KFU A;  3GTM H;  2UXD Q;  4JI5 Q;  1L2F A;  3HOZ H;  4AQY L;  2ES2 A;  2LXJ A;  1DGS A;  2CKZ B;  3TRE A;  4JI5 L;  3CCQ A;  1X9N A;  3J81 j;  4NXM L;  3HOU G;  2AKW B;  5IWA Q;  2RHQ B;  2IHF A;  1IZ6 A;  2QGQ A;  3E9H A;  4IJH A;  1VQ9 A;  2K5V A;  1UE7 A;  3J7Z C;  3PO2 G;  3I7F A;  4NB3 A;  5JEA J;  1WCM G;  4DAM A;  2Q2U A;  4KHP Q;  3G71 A;  1NBW A;  4BXX H;  4QGU A;  3TQY A;  2VUM H;  1HNW Q;  5M3F G;  2YTX A;  4JI3 L;  5IP7 H;  4IO9 A;  4A3L H;  3KF6 A;  3RN5 A;  1XMQ L;  4PZ6 A;  2EQS A;  1HNW L;  1GD7 A;  4DV1 L;  2MFI A;  3BZC A;  3GTO H;  5BR8 Q;  3A0J A;  4EX5 A;  2AMC B;  1PH8 A;  4OO1 G;  1HJP A;  4DV6 L;  2AWO A;  2RF4 A;  1RL2 A;  3JC6 6;  5BR8 L;  1PA6 A;  3CXC A;  1T9H A;  5AJ3 L;  1VQJ A;  3HKS A;  1CKM A;  5IYB G;  5GAG C;  1X3E A;  3HOW G;  1MIU A;  2UU9 Q;  3KDF B;  5FLM G;  4R1J A;  3PUW A;  1A8V A;  1EUJ A;  4LF5 Q;  2ID0 A;  4IPC A;  2WAQ E;  5DLQ E;  2UU9 L;  2YTV A;  4KLK A;  1OXT A;  4JI7 Q;  3PIP A;  2NVX H;  4OWT B;  4LF5 L;  4O0A A;  1X56 A;  2E5L Q;  1YHB A;  3GTJ H;  2IT1 A;  5C44 G;  4LFC L;  1SLJ A;  4QY7 A;  4JI7 L;  3S15 H;  2MNA A;  1QVG A;  4X64 L;  1VQ7 A;  1VQH A;  1XPO A;  2B3G A;  4C3H H;  1VQF A;  1JB7 A;  1IBL L;  1KHI A;  1PHJ A;  4POG A;  3RZD H;  3HOZ G;  1N9W A;  4UPA A;  2VL6 A;  4P71 A;  1PH6 A;  2YYZ A;  3U4V A;  2WAQ G;  4JI0 L;  1LUZ A;  4WJ3 M;  4FDB A;  1HNZ Q;  2HQL A;  4PZ8 A;  5LMN Q;  4X66 Q;  2PMZ E;  2NVY H;  3G6E A;  4JI2 Q;  2N49 A;  1PVO A;  1C9O A;  5JJK A;  1QVC A;  4BXX G;  3HKZ E;  4IFD I;  2NZO A;  5LMN L;  4P72 A;  3KYH C;  4RMF A;  4X65 Q;  4GS3 A;  5GRO A;  4X66 L;  5IP7 G;  4A76 A;  2V1C C;  3J80 i;  4A3L G;  4KHZ A;  2VQF Q;  1Y1W G;  1U0L A;  4NPS A;  4X65 L;  4A3E H;  3TRZ A;  3CC2 A;  1Q46 A;  3BZK A;  4OON A;  3AFP A;  2R7Z H;  1HZB A;  1S40 A;  1MKH A;  3GTL H;  3G48 A;  1KRT A;  1Y14 B;  2D0O A;  2VQE Q;  3J81 c;  1NE3 A;  4ME3 A;  2OWO A;  4GN5 A;  1Q1B A;  1IXR A;  3OW2 A;  1I3Q H;  1WOC A;  2JEA I;  3WWV A;  3HKZ G;  2RCN A;  3S2D H;  4DR4 Q;  4QQB X;  4DR5 L;  1D8L A;  1X54 A;  2ZTD A;  1GKH A;  4DR1 Q;  3CC4 A;  3S2H H;  3STB D;  2Q2H A;  5M5X H;  4P75 A;  2YV5 A;  2E2J H;  4H02 A;  1BBU A;  3GTQ H;  1XPU A;  4GLA C;  2PQA A;  3UDX A;  3FP9 A;  3PGZ A;  5ELO A;  3GO5 A;  4DUZ Q;  4LF8 Q;  1M90 C;  3S1Q H;  1VQK A;  1I50 H;  1XMO Q;  2NVQ H;  3LGJ A;  5C0X I;  2Z0S A;  1Q12 A;  5M3F H;  4LF8 L;  2JA5 H;  1XTD A;  2JA8 G;  4DR7 L;  4Y52 H;  4GOP C;  2MO1 A;  1PYS B;  4AH6 A;  4DR3 L;  1K8G A;  1YJN A;  5GAH C;  1K9M C;  1EIY B;  4UY8 C;  2NVT H;  4IPG A;  4A3G G;  5IP9 H;  3PCO B;  1N32 L;  3S1R H;  1PH3 A;  1P16 A;  2JA9 A;  4Y7N H;  4XIG S;  1W2B A;  4GN3 B;  1QZH A;  3HOX H;  5IYB H;  3GTG H;  4TQU S;  4HJ9 A;  2F3I A;  5GAE C;  3T1Y Q;  1EQR A;  2YU9 H;  4JI4 L;  1ASZ A;  4HIM A;  2IX1 A;  1SR3 A;  2HT1 A;  3M4O H;  2JE6 I;  3E9I A;  1UE1 A;  3PUX A;  3KF6 B;  2GN5 A;  4LFA Q;  1LYL A;  4DUY L;  3ULP A;  3GDE A;  3T1Y L;  1KQS A;  4A93 G;  1HZ9 A;  3D0F A;  4A3J H;  4HIK A;  5C3E H;  2GVA A;  3UDG A;  5C4X H;  2N3S A;  4LFA L;  3M3Y H;  4JBM A;  5C44 H;  3JAM c;  1HR0 Q;  1TWA H;  2PI2 A;  2R7D A;  4IPD A;  2JA7 H;  4DAY B;  3I4M H;  3EBE A;  2F4V Q;  2JJQ A;  2OTJ A;  4A3I H;  3OTO L;  1PH2 A;  1JJ2 A;  1HR0 L;  1JMC A;  4NXM Q;  2IY5 B;  1E7Z A;  3OYY A;  3IRB A;  2CQO A;  1TWF H;  3B6Y A;  2HIX A;  2F4V L;  3CD6 A;  1VQB A;  1XJV A;  1M1K C;  3PUZ A;  2C35 B;  3K0X A;  1V1Q A;  3PUY A;  1E1O A;  4IPH A;  4IFD J;  1E24 A;  2KBN A;  1YHQ A;  3J7A 5;  1NMG A;  4AYB E;  4JI3 Q;  2JA6 H;  3NEM A;  5M5Y H;  1BKB A;  3H15 A;  1XMQ Q;  1Q82 C;  4LF4 L;  1ASY A;  4R4Q A;  3CME A;  4DV1 Q;  2PI2 E;  1N34 L;  3ICE A;  4IJL A;  2JA5 G;  2PNH A;  2WFW A;  4DNI A;  4DV5 Q;  1CUK A;  2DUD A;  3PO3 H;  5JJI A;  1Y1W H;  4DKA C;  4KHP L;  4DV6 Q;  1VQ6 A;  4PMW A;  2QEX A;  3CCV A;  2KCM A;  2NN6 G;  1EOV A;  1TWH H;  5IP9 G;  5AJ3 Q;  4DV5 L;  1Q8K A;  1QVF A;  3ULJ A;  4JOI C;  5IYD G;  2NZH A;  2E2I H;  3HOY G;  1WI5 A;  4A3M G;  1E22 A;  2UUA L;  4AYB G;  1EYG A;  3HOX G;  1PH7 A;  2UUC L;  4LF9 Q;  3PUV A;  3S1M H;  3EIV A;  4OO1 I;  2JEB I;  5M3M H;  1BBW A;  3K81 C;  4GNX B;  1EWI A;  1L0W A;  4LF9 L;  1JJG A;  1JE5 A;  1CKN A;  1VQA A;  3W1G A;  4YCV A;  4LFC Q;  3H3V I;  3L0O A;  4A3J G;  5C3E G;  2VZA A;  5IY0 A;  4DV7 Q;  4GNX A;  3CW2 C;  1HZA A;  5C4X G;  5C0X J;  4X64 Q;  3PF5 A;  1GVP A;  1N36 Q;  2LSS A;  3F2D A;  1PH1 A;  1IBL Q;  2Z6K C;  2D0P A;  4DV7 L;  1K8A C;  2B63 H;  1IBM L;  2JA7 G;  3I4M G;  4A3D G;  1XNR L;  4K0K L;  2JA8 H;  4A3I G;  2K5N A;  3TEH B;  2A19 A;  3KJP A;  1A62 A;  2H5X A;  2RHS B;  3RLN A;  5ELN A;  1N36 L;  4JI0 Q;  1V43 A;  2L15 A;  4APV A;  1YIT A;  1H95 A;  2A8V A;  4B3M Q;  3FKI H;  4OWW B;  2I5H A;  4X62 Q;  4A3G H;  1S3O A;  1Y1V H;  2N8N A;  2WB1 E;  1L1O A;  2EIF A;  4HIO A;  1VQP A;  3I55 A;  4B3M L;  4L5Q A;  1UWV A;  2PQA B;  3ZJY C;  4X62 L;  4LF7 L;  2JA6 G;  1BVS A;  4UP9 A;  1FJG Q;  3S1N H;  5LMU L;  1A63 A;  2R6G A;  4QL5 A;  1B8A A;  2KHJ A;  4B3S Q;  3PO3 G;  3A5Z B;  1FJG L;  2MQH A;  3S14 H;  1G6P A;  1YVC A;  1CKO A;  4GLV B;  2K50 A;  4A93 H;  4J15 A;  4GKJ Q;  4B3S L;  4BY1 G;  1J5E L;  1PH5 A;  2WB1 G;  3CF5 A;  5IYC G;  2CFM A;  3K7U C;  3J81 i;  4BBS H;  1QUQ B;  4WJ4 A;  4GKJ L;  1NTG A;  2A1A A;  1KIX A;  1X6O A;  5JEA G;  4DR5 Q;  1K0R A;  2FXQ A;  1IYJ B;  1LTL A;  1WYD A;  5M3M G;  3T1H L;  4QIW E;  3PSI A;  3CCS A;  1J6Q A;  4POF A;  2DGY A;  3KF8 B;  5HGQ A;  1W3S A;  2JQO A;  1WFQ A;  2AWN A;  2QA4 A;  2UXB L;  4MNO A;  4BA1 I;  3CCM A;  4O2D A;  1B70 B;  2AHO B;  4JV5 L;  3S17 H;  1PV4 A;  4DR7 Q;  1AE3 A;  1VQG A;  1G51 A;  4LWC A;  3DM3 A;  1S72 A;  5M5W H;  1YJ9 A;  4YCW A;  2B63 G;  2N78 A;  4YY3 L;  4DR3 Q;  1K83 H;  4DR6 L;  1V9P A;  3A74 A;  2ASB A;  1N32 Q;  2YTY A;  1VQ8 A;  2BH8 A;  4JOI A;  1Q86 C;  1GM5 A;  1CSQ A;  1Q1E A;  4HID A;  1PH4 A;  3FKI G;  1EQQ A;  1IBK L;  1Y1V G;  4IOA A;  1VQE A;  3K7A H;  4BBR H;  1TXY A;  1SMX A;  2IHE A;  3M85 A;  1I5F A;  2R93 H;  3CC7 A;  5IYD H;  3RNU A;  4JI4 Q;  2VUM G;  4A3M H;  2XTI A;  4NXN L;  3HOY H;  3AQQ A;  1TWC H;  3L7Z C;  3K8A A;  1K3R A;  3DLL A;  4L5T A;  1VQO A;  1NY4 A;  1AH9 A;  4DUY Q;  4JYA L;  1FL0 A;  1VQC A;  2R7F A;  1E1T A;  4YWK A;  3CMA A;  3SGI A;  1OXU A;  1OXV A;  1YEZ A;  3UDI A;  3M7N A;  2WP8 J;  4L5S A;  4DPG A;  2UXC Q;  5FLX c;  3CCE A;  3BU2 A;  2LXK A;  4A3C G;  3FHW A;  3JAM i;  5JJL A;  3K80 C;  2ZM6 L;  3OTO Q;  1YHA A;  4BBS G;  1NJI C;  2CCZ A;  2UXC L;  3RLF A;  4A3D H;  2I5L X;  4LUV A;  2KEN A;  4R4T A;  4JI8 L;  1HZC A;  3KJO A;  2I0Q A;  2ATW A;  1CKN B;  4JCV E;  1VQ4 A;  1D7Q A;  2ALY B;  2K75 A;  2D62 A;  5FJ8 G;  4LF4 Q;  5GQO A;  3Q8D A;  4DV3 L;  4GNX C;  1N34 Q;  4GKK L;  4JI1 Q;  3W1B A;  2K4K A;  3ER0 A;  2OQ0 A;  1KD1 C;  3S24 A;  4KI0 A;  3PV0 A;  4JI1 L;  1WJJ A;  4DV0 L;  4GN4 B;  4HJA A;  2XGT A;  2BH2 A;  3HOV H;  3H0G H;  4C3J H;  5J3B A;  3NBH B;  4JBK A;  1X55 A;  4BY1 H;  2UUA Q;  4OX9 Q;  3GD7 A;  3A5U A;  1SN8 A;  4BBR G;  1EFW A;  5IYC H;  2UUC Q;  2R93 G;  1L1O B;  2KCT A;  4BA2 I;  3L2P A;  4OX9 L;  4R4O A;  5C4J H;  1O7I A;  3AYH B;  4B3R Q;  1KXL A;  1JJC B;  1UE6 A;  2NN6 I;  1SFO H;  3CCL A;  4BY7 H;  3KOJ A;  4PG3 A;  2MO0 A;  5IWA L;  1C7Y A;  1X3G A;  3U4Z A;  4PZ7 A;  4P73 A;  4B3R L;  1R9T H;  1I6H H;  4X6A H;  2E8G A;  3CP0 A;  4A4I A;  1OLT A;  1Z9F A;  4UP8 A;  1G29 1;  1VS0 A;  4MZ9 A;  4JC0 A;  3M4Q A;  2ZTC A;  1IBM Q;  3M9B A;  2EXD A;  2ZJR A;  2F52 A;  4K0K Q;  3UDF A;  3M4P A;  3G4S A;  4LFB Q;  3VDY A;  1XPR A;  4GOP A;  2HHH Q;  5K36 G;  1X3F A;  1N8R C;  3PF4 A;  5IT9 c;  4LFB L;  1K73 C;  1UE5 A;  3CCR A;  4A3K H;  2HHH L;  4XTC S;  3GTK H;  1YBY A;  4DR2 Q;  4LF7 Q;  2JK8 A;  2E2H H;  1YIJ A;  1XNR Q;  2I5M X;  2VS1 A;  1HH2 P;  1SE8 A;  3D31 A;  4P74 A;  4YCU A;  1VQI A;  2VY3 A;  4YHH Q;  5LMU Q;  2R92 H;  3TS2 A;  4DR2 L;  4TVA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...