2QGQA

Crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
296
structure length
272
Chain Sequence
EERPYAYVKISDGCGSLRSRSIEDITREVEDLLKEGKKEIILVAQDTTSYGIDLYRKQALPDLLRRLNSLNGEFWIRVMYLHPDHLTEEIISAMLELDKVVKYFDVPVQHGSDKILKLMGRTKSSEELKKMLSSIRERFPDAVLRTSIIVGFPGETEEDFEELKQFVEEIQFDKLGAFVYSDKVDPEMAKRRQEELLLLQAEISNSRLDRFVGKKLKFLVEGKEGKFLVGRTWTEAPEVDGVVFVRGKGKIGDFLEVVIKEHDEYDMWGSVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Post-translational Modification of Ribosomal Proteins: STRUCTURAL AND FUNCTIONAL CHARACTERIZATION OF RimO FROM THERMOTOGA MARITIMA, A RADICAL S-ADENOSYLMETHIONINE METHYLTHIOTRANSFERASE.
pubmed doi rcsb
source organism Thermotoga maritima msb8
molecule tags Structural genomics, unknown function
molecule keywords Protein TM_1862
total genus 92
structure length 272
sequence length 296
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.8.4.4: [Ribosomal protein S12] (aspartate(89)-C(3))-methylthiotransferase.
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04055 Radical_SAM Radical SAM superfamily
A PF18693 TRAM_2 TRAM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2qgqA02
3.80.30.20 Alpha Beta Alpha-Beta Horseshoe pyruvate-formate lyase- activating enzyme tm_1862 like domain 2qgqA01
2K14A 2BH8A 3UE0A 4HIOA 5JJLA 1YEZA 1JJ2A 5LMUL 3GTMH 1HNWQ 1QZHA 2MO0A 3M3YH 3M4QA 2ZM6Q 4UP9A 2VL6A 3S14H 3CF5A 4DKAC 4LF9Q 1N36L 1D8LA 2Z0SA 1K3RA 4BY1G 1OTCA 4LF6L 1KRTA 1VQKA 4GOPC 4BY1H 4A3BG 5K36G 4DV3Q 1N34L 3E0EA 2IHEA 2UUAQ 2KHIA 1Z9FA 2K5NA 2MNAA 3S1RH 2XGTA 1NY4A 1KQSA 1JT8A 3NELA 2JEBI 2I5LX 1Y14B 2R7DA 3CPFA 3H15A 4JI3Q 4DV0L 1K9MC 1HR0Q 4JI2Q 5C44G 4DR7L 1QUQA 1SN8A 2H5XA 4GOPA 4WJ4A 4C3IH 3AQQA 3K81C 5E7NA 2B3GA 2AWOA 2QEXA 1AE3A 4A3MH 1HNWL 5C3EH 4UP8A 4A3KG 4LF5Q 5HY6A 2UXCQ 4BY7G 4LF9L 2AMCB 3GTGH 4A3CG 2UUBQ 2OTLA 2VY3A 3UE1A 3A5UA 4GKKQ 4DR3Q 5IP9G 2OQ0A 2R92H 1WJJA 4K0KQ 1E3PA 3HKZG 5ELNA 1PH2A 4QGUA 3OTOL 3HOXG 2F4VQ 4JC0A 1YNXA 2JQOA 3I7FA 2UU9Q 2R93H 1UE7A 4DV4L 1Q1BA 1SMXA 3I2ZA 3L2PA 2R93G 4JI5Q 3S15H 1OXUA 3PUZA 4XTCS 1RIPA 1YHQA 2WB1G 4A3JG 1PVOA 5LMNL 2UXBL 4JI8Q 1KXLA 4LF4L 3PIPA 3EN2A 4GNXC 3S1QH 5C0XI 2HHHQ 4P72A 4DR1L 2PNHA 1E7ZA 3U4VA 5C4XG 4LFCQ 2K50A 4IO9A 1FGUA 2F52A 4LF5L 2VNUD 3AFPA 5C0XG 2YTXA 1NJIC 3F8TA 1PH6A 1GM5A 4IPDA 1YIJA 3GTLH 2YV5A 4B3RL 1XMOQ 1HZCA 3I4NG 1EQRA 1XNQQ 4A3LG 4GS3A 3ULLA 2KBNA 1HZAA 4IPGA 2RF4A 3STBD 1IXRA 4IJHA 4APVA 2CWPA 4GNXB 3W1BA 1NMFA 3RR5A 4A3EG 2BH2A 3PUWA 3FHWA 4NXML 1EIYB 3W5OA 2ATWA 3M4PA 4JI5L 5LMUQ 4OONA 1EFWA 2A1AA 3E9IA 2VQFL 1N9WA 3RN2A 2YU9H 2ZTEA 4LFAL 5IP7G 3S24A 4L5RC 2HQLA 4B3TQ 2NZOA 1B8AA 1GD7A 4PG3A 3EIVA 3I55A 3G71A 3CCMA 4A3FH 1QZGA 3NEMA 4LF6Q 1TWFH 2JEAI 3H0GG 2RCNA 4YCVA 3CC7A 1HNXL 4P75A 3DLLA 3KJOA 1VQLA 1HR0W 1NTGA 4JI7L 4R4TA 2UUCQ 2IY5B 1IBKQ 4QQBX 3G48A 3K7AH 3HKSA 3KDFA 3HKZE 4JI2L 3D31A 1VQAA 4X64L 4QIWE 1KIXA 3VDYA 3TREA 1JB7A 4YY3Q 1VQPA 2Q2IA 3MXNB 4C2MH 2JA5G 3E9HA 3HOYG 3I4OA 4A3DH 1DGSA 4A93G 3KYHC 2I5HA 2E2HH 1C9OA 4QL5A 3PSIA 1YITA 1AH9A 4P73A 3KFUA 2N78A 1EQQA 5GAHC 1N32Q 4B3SL 3PO3H 2NVXH 1WCMG 2WFWA 4LFAQ 1CSQA 3M4OH 4LF8L 4HJAA 3CCRA 2ZTCA 3AFQA 4KI0A 5C4XH 4IPCA 1H95A 1L1OC 2YTVA 1CKNA 1SFOH 4OWTB 1A63A 3OTOQ 1XMQL 1HJPA 1J6QA 1E1OA 4DV2L 4R4CA 1LM0A 1KAWA 1FL0A 1VQNA 1Q86C 4JI0L 1S3OA 3J80c 3GTQH 2PQAB 1BBWA 3KLWA 4POFA 3CCSA 4LNQA 1KHIA 2PI2E 3J81c 1I6HH 4WJ3M 4FDBA 4RMFA 4X62L 3T1HL 2R7ZG 3J80i 2Q2HA 4JV5L 1D7QA 3HOZG 1K83H 5GADC 3S2DH 3AYHB 3PGZA 1HZ9A 2Z6KA 4UP7A 2E8GA 1VQ8A 3F2DA 4DV6Q 1YHAA 4LWCA 3TS0A 4UY8C 5IY0A 2ZTDA 4DR5Q 1YBYA 5M3FG 2FXQA 3K7UC 2R6GA 3K80C 1C7YA 2ZM6L 1N32L 5C3EG 4DR2L 1J5EQ 4R4IA 1B7YB 2UXDL 2GVAA 3U50C 2Q2UA 3I56A 1VQMA 4B3RQ 1KL9A 2CQOA 2OCEA 2HT1A 3CXCA 4TVAB 4RG1A 3GDEA 2IT1A 4ALPA 1OXXK 5IYDH 4DPGA 4DR6L 2I0QA 1XNRL 2RHQB 1Q82C 1N33Q 4A76A 2D0OA 1I94L 1BBUA 3H3VH 2ZJPA 2ZJRA 5IWAL 3CCVA 4GKJL 1AE2A 4A4IA 4OO1I 1Q1EA 2YTYA 4JG2A 1YVCA 1K0RA 2MQHA 4B3MQ 3PO3G 1VS0A 4DR5L 3RLFA 3KF8B 3A0JA 4LUZA 5IYBH 3S1MH 3ERSX 1B70B 1L0WA 1JJCB 2UXDQ 1PA6A 4X6AH 1QVGA 4GKKL 4YWLA 4JI1L 4PZ8A 3TQYA 1SLJA 4DV5L 1EYGA 4DR4Q 1W2BA 3PF4A 1YHBA 1E1TA 4LF7Q 1MKHA 1KC8C 3KDFB 4A3LH 2KCMA 4X66Q 3J7A5 2CCZA 4JYAL 2BA1A 4YWMA 3B6YA 2NZHA 1Y1WG 4H02A 3LGJA 4BXXG 1XPRA 4GNXA 1LUZA 4NB3A 5FJ8H 1Q46A 4HIMA 2UXBQ 1VQOA 1VQFA 4AYBE 4LF4Q 2I5MX 5IT9c 4A3FG 4OX9L 3RLNA 4IFDJ 5IP7H 4DUZL 2HHHL 4A3CH 4DUYL 4L5SA 1VQ9A 3GTPH 1SROA 4QY7A 2UUAL 2GN5A 4J15A 2WAQE 3HOVG 1VCIA 2WAQG 4DK3C 3W1GA 4DNIA 3NBHB 3U4ZA 1XPOA 3PO2G 3HOWG 2JE6I 4JI1Q 4NXNQ 3HOXH 3FKIG 5J3BA 3HOWH 2B29A 1UE1A 4BBSH 4DR7Q 1FJGQ 3SGIA 1PV4A 3KJPA 3D0FA 5M3MH 2C35B 1CKOA 1NMGA 1X9NA 2BA0A 5HGQA 5FLXc 4DV6L 2ASBA 5LMNW 3HOYH 4DAYB 1OLTA 1Y1VH 5IYCG 1C0AA 1OXTA 1PYBA 2UXCL 1WI5A 5M5YH 4OX9Q 4JI4Q 4DUYQ 5IYBG 1L1OB 4KHZA 3CCUA 1IBML 2GVBA 3GTJH 1TWAH 3UDXA 2UU9L 2CFMA 2Y0SE 1S40A 3S16H 1IBLL 1XNRQ 4PZ7A 5GAGC 2UUCL 3ER0A 2QGQA 3J7ZC 4JBJA 1MJEA 1K8GA 3L7ZC 5GAEC 4Y7NH 2N8NA 2NVYH 1UE5A 5LMNQ 1JJGA 1WYDA 2K5VA 1CKNB 1WFQA 3M9BA 3NENA 2R7ZH 3BZCA 2JA6G 1Y1WH 1Q7YC 5JJIA 1I5FA 3CCJA 1CUKA 4R4QA 1A0IA 4DV1Q 4A3MG 1VQ5A 3F2BA 1X56A 3ULPA 1LYLA 1UE6A 3FP9A 4B3ML 1YJ9A 3PCOB 4GN5A 4LW1A 4NPSA 2JA8G 4A3GH 3K0XA 3TS2A 1N36Q 1HNZQ 1Z47A 3OYYA 1MJCA 4OO1G 3H0GH 4JBKA 3ICEA 1X55A 4P74A 1VQCA 3CAMA 1XMOL 1VQEA 2N3SA 3CMAA 1L2FA 4DV7L 4A3IG 1M1KC 4EQ5A 2JK8A 3RNUA 1P8LA 3CP0A 2EQSA 1PH1A 2D0PA 1Q8KA 2PQAA 5M5WH 1TWGH 4JYAQ 3FKIH 3AEVA 5M3MG 3CD6A 1SE8A 4UPAA 5IYDG 1UWVA 3CQZH 4MTNA 4AQYL 1PH8A 1X3FA 1CKMA 3Q8DA 3BZKA 4PZ6A 4X62Q 4HIDA 3T1HQ 4BBRH 4JBWA 1R9TH 1XJVA 2OTJA 4A3JH 4HJ9A 2Z6KC 4X65L 4IFDG 4B3TL 3KF6A 1IYJB 2D62A 3H3VI 1Y1VG 3GO5A 4EX5A 2B63H 1JMCA 3HFZB 3S2HH 4XIGS 4A3BH 2VS1A 3I4MH 4IFDI 3PF5A 2VZAA 2MO1A 2UUBL 1VQIA 2R7FA 1HNZL 3PIOA 1M90C 1GVPA 1VQGA 2HIXA 2WP8J 3JC66 4NXNL 3J81j 1X3GA 1X65A 1I50H 2XTIA 2ES2A 3L0OA 4A3EH 1YI2A 1A62A 2MFIA 1V43A 4L5QA 5EAYA 2F4VL 4YY3L 5C44H 1QVFA 5AJ3Q 3I4NH 1G51A 1Q12A 1HZBA 3K8AA 2A8VA 2K4KA 1YJNA 4DR6Q 1V1QA 1EOVA 1PYSB 1X3EA 5JJKA 4A3GG 1N33L 4QJFA 1QVCA 3CPWA 1I94Q 2ALYB 4BXXH 2OWOA 4B3SQ 1X6OA 3ULJA 4JI8L 3GTOH 3HOUH 1RL2A 3UDFA 2DGYA 4X65Q 2ID0A 1KD1C 4LF8Q 2YYZA 3JAMc 2QA4A 2VQEQ 4GKJQ 4JI4L 2VUMG 4TQUS 4YCWA 1VQ4A 1EIFA 5M3FH 2KCTA 2WB1E 3KF6B 4DV3L 4LFCL 1N34Q 3HOVH 4DV2Q 3RZDH 2EXDA 1K73C 4GN4B 2JA9A 1HH2P 2N49A 2PI2A 3WWVA 2E2IH 1IBLQ 2R92G 4GN3B 2NN6G 4YHHL 4IJLA 4JI3L 1IZ6A 1JE5A 3CC2A 3CCQA 1P16A 2OQKA 1XNQL 1VQBA 2E5LL 4YCUA 3PUYA 3T1YQ 4BBRG 4POGA 1ASZA 2K75A 3DM3A 4NXMQ 2JA7H 1EUJA 3UDGA 1PH9A 4O2DA 4A75A 5GQOA 2VQFQ 2IHFA 1U5KA 2CWAA 1G291 3M85A 3EBEA 5C4JH 5JEAG 4DR2Q 5IYCH 1N8RC 1J5EL 3PUXA 4P71A 4JOIC 1TWHH 2CKZB 1FVIA 1S72A 2LXKA 2VQEL 1TWCH 4MNOA 2HIVA 4GOPB 2ZJQA 1QUQB 4K0KL 3UDIA 3I4MG 2IX1A 2VW9A 4HJ5A 4DV7Q 5C0XJ 1PH3A 4C3HH 5FLMG 4R1JA 3MEFA 3BJUA 4GLVB 4Y52H 2RHSB 4OWXB 1LTLA 4GLXA 4JI7Q 4OXPA 1IBKL 1E22A 2NVQH 1SRUA 1W3SA 4BA2I 2E2JH 1X54A 3PUVA 4AYBG 4X64Q 4GLAC 1PFSA 2JA6H 4JI6L 4KHPQ 1BKBA 3RLOA 1GKHA 3T1YL 3HOUG 1L1OA 4MZ9A 3OW2A 4LFBQ 3F1ZA 2JJQA 5FJ8G 4A3KH 3TRZA 4IPHA 2EIFA 2JA8H 3GTKH 1MIUA 2AKWB 1BVSA 4DK6C 4HIKA 1VQ6A 1K8AC 1GO3E 1I3QH 3KOJA 3J81i 1ASYA 4OWWB 1NBWA 1KRSA 3CW2C 5DLQE 4PMWA 4DV5Q 4DR4L 4A3IH 1G6PA 2LSSA 4LF7L 3G4SA 1IBMQ 1SR3A 4AH6A 2L15A 3PO2H 2PMZE 2NVTH 1TXYA 2JA5H 4L5TA 1VQ7A 1PH7A 2K5HA 3JAMi 2JA7G 4BBSG 4O0AA 1CSPA 2Q2TA 3G6EA 4DV0Q 1HR0L 4C3JH 1EWIA 4ME3A 4HJ7A 4JCVE 2KHJA 3A5ZB 4JV5Q 4KHPL 4A93H 4LUOA 1V9PA 4AIMA 1WCMH 4LFBL 2A19A 4KLKA 5GROA 4DUZQ 4DV1L 3GD7A 4LUVA 2K52A 2AWNA 1WOCA 3S17H 1PHJA 1HNXQ 1PH4A 2B63G 2Y0SG 1OXVA 5FLMH 4JBMA 1A8VA 1YJWA 1NE3A 4DR3L 1VQHA 4YHHQ 3IRBA 1VQDA 3ZJYC 1PH5A 2KENA 2E5LQ 5BR8Q 3TEHB 3HOZH 2F3IA 3A74A 4YWKA 4DV4Q 1Q81C 3CCLA 2V1CC 5ELOA 4DAMA 1IL2A 4AQYQ 2NN6I 2LXJA 5JEAJ 3S1NH 1E24A 3F2CA 1XPUA 5IWAQ 2AHOB 4HJ8A 2VUMH 1U0LA 3CC4A 3STBC 3CCEA 1O7IA 1UEBA 1YZ6A 4DR1Q 3M7NA 4JOIA 5M5XH 5IP9H 4BY7H 1XMQQ 3BU2A 3U58A 1FJGL 3RN5A 2DUDA 3RZOH 1T9HA 4JI0Q 2IX0A 5H1SE 4BA1I 1VQJA 3CMEA 1XTDA 4R4OA 4IOAA 4A3DG 4IOCA 1OXSC 5BR8L 4JI6Q 5AJ3L 4X66L 5IE8A 3PV0A
chains in the Genus database with same CATH superfamily
1CT1D 5JJLA 3GTMH 5LMUL 2R7ZB 5D14A 5A2QE 3DXJC 3MXGA 2EJFC 3V05A 1N36L 2G9HD 1K8MA 4BY1G 3RD4A 1OTCA 1KRTA 5K36G 4A3BG 4DV3Q 3KLSA 3E0EA 2UUAQ 3D4DA 2K5NA 3HG9A 1TVXA 2FFKB 2I5LX 3FRPB 3WDNA 2F0QA 1A3TA 2ICEC 5C4JB 2EPBA 2SNMA 2H5XA 2L11A 4R8NA 1XYIA 4C3IH 5IGBA 1HRJA 4B9WA 1JORA 5C3EH 4UP8A 5C4HA 4K8JA 3E6ZX 4BY7G 1D5ZC 4LF9L 4K2LA 4X3UA 4DR3Q 5CBEE 1ET6A 5IP9G 4HR7B 4A3IB 2XVSA 3HOXG 1IW7D 4F88A 3I2ZA 3L2PA 1ZYRC 2JA8B 4WORA 4JI5Q 3PUZA 5E4WC 1CA5A 2UXBL 3SK6A 4OEMB 4LF4L 3PIPA 1HA6A 3EN2A 3C1EA 1G2SA 5E1FA 2A74C 2ZXRA 3GTJB 4RH1A 4P72A 4DR1L 1SFOB 5C4XG 5FO9B 1FGUA 2A6ED 2F52A 2VNUD 1K28A 3SDZA 1GM5A 1LT5D 4C3JB 2YV5A 4RFBA 1WTXA 1GUWA 1EQRA 4KKTA 1HZAA 2BDOA 3W1BA 1NMFA 3VYUA 1X32A 4UDUC 2A1AA 1ET9A 2WACA 3RN2A 2F0IA 5IP7G 3GTPB 2NZOA 2QKIC 3EIVA 3PMFA 1TWFH 3BS1A 3KUPA 1F9PA 1F77A 2RCNA 3CC7A 5AFWA 2IWHA 2NBFA 2HDLA 3KJOA 2AUKA 2NN6H 1M8AA 4K8IA 3HKZE 4RH6A 3D31A 1O78A 4QIWE 1KIXA 4HMIA 3VDYA 3TREA 5EPKA 2Z4HA 2Q2IA 2OT2A 3FPPA 3E9HA 2NTSA 4KY7A 5J1ZA 2F0OA 2XRSD 4QL5A 2R3ZA 5A2QL 1KTKA 1SYDA 5DM73 3T16A 4Y7NB 3M4OH 2CVRA 1Q8IA 4HJAA 4LF8L 5JEAH 2YTVA 1A3UA 1WTWA 3GV3A 1A63A 2ZT9C 3C2PA 1XMQL 4G4KA 2K1BA 4DV2L 3SK4A 4IZ8A 2PQAB 1BBWA 3CCSA 1KHIA 2CH4W 2F0UA 5CYUA 4ZRZA 1BF4A 4JV5L 1D7QA 3HOZG 1NUCA 4UP7A 3ZYYX 4QB4A 1VQ8A 5IGDA 2NZ1D 1FD7D 1I4QA 2ZTDA 1SNDA 2ZM6L 5C3EG 1B7YB 4F8MA 2Q2UA 1JOQA 4B3RQ 1KL9A 2CQOA 4Q5VA 3K58A 3GDEA 1EZ8A 1OXXK 5C3XA 4DPGA 1BNZA 4DR6L 2IJ0A 2D0OA 1BBUA 1A6XA 1S4ZA 3S1NB 2ZJPA 1BCPB 2DJGC 2ZJRA 4GKJL 3HEJA 1HTPA 2XN9C 4HCSA 4CGYB 4B3MQ 1VS0A 2XNAC 3A0JA 1L0WA 3ND8A 3J80L 3Q23A 1QVGA 4GKKL 1PMRA 4JI1L 1SLJA 1QB5D 1W2BA 4FP5D 2QDBA 4TSSA 3I91A 2KCMA 3D4WA 1H9MA 5CR3A 3DUZA 4DXGA 1GXDC 4IQZA 3E3XA 4BXXG 2F0EA 2A69C 2CW0C 1LUZA 4DK1A 4GNXA 1Q46A 4HIMA 1LTRD 4U673 2K32A 2I5MX 5IT9c 3Q0AA 4KV6A 5IP7H 3K59A 1G8ZD 1SROA 3N6RA 2GN5A 3NXWA 5C6AA 2WAQE 3Q22A 4DK3C 4OO1H 3A54A 4DNIA 1XPOA 1DONA 5CBAE 3HOWH 3T53B 4FHCA 4BBSH 3R93A 5FLXE 4DR7Q 2FMCA 5M3MH 1I4PA 5FLXc 2RDFA 4ZLTF 4DV6L 5LMNW 2ASBA 1Y1VH 3FDTA 1D5XC 5JVH3 1SBBB 5TSSA 1IL8A 1KNEA 1ONLA 1WCMB 1I50B 2KQ3A 3MZ5A 3CCUA 2FINB 1FNVA 1JE4A 4HMJA 1S5FD 1PTOF 1DM0B 3S16H 2B2UA 1SNCA 4CJ2C 5GAGC 3NUCA 3DHQA 4JBJA 1K8GA 5CV8A 4FF2A 1O7LA 3NENA 3M9BA 4YIJA 1EY6A 1LYLA 2E76C 3TS2A 1F9QA 1Z47A 3HOUB 3OYYA 5F2DA 4OO1G 3ICEA 1SYFA 1X55A 3KK7A 4P74A 1XMOL 2N3SA 1EQTA 1JB3A 1DXMA 3QR8A 5M5WH 4KJOA 1TWGH 3AEVA 1ILQA 5M3MG 3LWEA 4N8X1 4A3KB 1X3FA 1CKMA 1QZHA 3C1FA 1LTBD 4JBWA 1R9TH 4X65L 4B3TL 3KF6A 1IYJB 2OXPA 4I7ZC 3H3VI 1HFGA 4XIGS 2HCIA 2VS1A 3I4MH 5DEHA 2UUBL 1ESRA 2L0CA 2R7FA 2F0NA 4NXNL 2EYLA 1X65A 1A62A 3NBIA 1V43A 2WB1B 4YY3L 5C44H 4RWSC 3I4NH 1G51A 2PYKA 3K8AA 2A8VA 1GUOA 2F0GA 4DF7A 1LABA 1N33L 3BDOA 3P1HA 4QJFA 1UUPA 5EJWA 4BXXH 2OWOA 3ULJA 4JI8L 2DGYA 2ID0A 4KY6A 1KLGD 4JI4L 4TQUS 4YCWA 5I2YA 3KF6B 1I4HA 4DV3L 1I6HB 2MUYA 3RZDH 2LMCB 1IBLQ 1WVLA 4IJLA 4AYBB 3CC2A 2L12A 1IHZA 1QWYA 2WIIB 1A15A 1WTVA 2EYPA 2E5LL 4POGA 2F0JA 4DN4M 2L55A 1LTTD 4TKOB 3UDGA 3M3YB 1U4RA 5GQOA 2VQFQ 1N8RC 1G291 3EBEA 5C4JH 5JEAG 4DR2Q 3PUXA 1TWHH 5IIFA 2VQEL 5M5WB 2VW9A 4DV7Q 5C0XJ 1PH3A 4C3HH 1GHJA 2SDFA 2NYZD 2MP1A 4OXPA 1IBKL 4BA2I 4DU9A 4AYBG 1NNXA 4G7OC 4X64Q 4U68A 4JI6L 1I4XA 4G57A 2B2YC 2JA8H 1BVSA 2F0FA 5KYIA 1K8AC 4QUCA 3CW2C 2K7VA 3I72A 1Z7TA 2L15A 2XWBB 1BDOA 2PMZE 2GA4B 2NVTH 2F0KA 1QE6A 1CZGA 2JA5H 4O0AA 1CSPA 3EA6A 3X3NA 4C3JH 3NTHA 2KHJA 1LTGD 4LUOA 3TN2A 4LUVA 4JW0A 4KN7C 5K36H 4H0LC 1STYA 1PHJA 2Y0SG 1OXVA 4C3HG 1A8VA 4DR3L 1VQHA 5FO7B 4YHHQ 1DOMA 5EBDA 3DEOA 3IRBA 4JVZA 1EYCA 2KENA 5FO8B 4S3SA 3HOWB 2F3IA 3A74A 2HUGA 2BE5D 1HPCA 2V1CC 1LV9A 1I4RA 4AQYQ 1C48A 2XSCA 5JEAJ 3S1NH 1U4PA 2KEDA 5D3IB 3STBC 2K28A 3VR3A 2EY1A 2X69A 2B2WA 3MVVA 5IP9H 1XMQQ 4IUUA 1Y1WB 2SEBD 5H1SE 5KNDA 5C4ZA 1UNSA 3PIP3 1BBXC 2RSOA 2KVMA 4A3DG 2O2LD 5K5PA 4X66L 5IGCA 5IE8A 3UE0A 1YEZA 3K5MA 1JJ2A 1BQQT 1H9SA 1V1OA 3L9AX 4UP9A 1F2ZA 3DWPA 3CF5A 4DKAC 1B44D 1LT3D 5EKIA 1WD0A 1D8LA 4BY1H 4GOPC 2I07B 2D2CC 2XGTA 1TR5A 4CBVA 2R7DA 4JI3Q 5FOBB 5JJZA 1K9MC 3CRLC 4KD3A 3LNNA 4KKSA 4ZCKA 1SNMA 3PO2B 3AB9A 3K81C 1KABA 2EXZA 2B3GA 2AWOA 1NR4A 1L0XB 1CZWA 1Y8OB 4A3MH 2UXCQ 5ELBA 2AMCB 3GTGH 1KDCA 2VUMB 2E2JB 3UE1A 4GKKQ 3GTQB 4CDFC 3Q6SA 4KD4A 1WJJA 2Q8RE 2R92H 5ELNA 2NTTA 3D6CA 2K01A 5LL6X 1EYDA 2MGSA 1TQOA 1GUNA 5BN5A 2R93H 2VB2X 1I6VC 4DV4L 4ZYSA 5ELFA 3G7LA 1OXUA 1J8IA 1STBA 1JWUD 3MXUA 1RD9D 3DM1A 1K3BC 3S1QH 1CQFA 3TZUA 1E7ZA 4LFCQ 1V1PA 2K50A 4L8JA 4OELB 1LTAD 1DJRD 1Q3LA 4RGTA 3NP8A 3MC0B 3HZXA 1CK1A 3F8TA 1V1PB 4B3RL 4FXDA 1SYGA 3I4NG 1SE3A 4APVA 4IJHA 3RR5A 2JSOA 4NXML 3K7AB 3LX0A 3S1QB 4JI5L 1A2UA 1RDPD 1UAPA 1N9WA 2YU9H 4LFAL 2KEEA 2H1EA 3TBIB 3S24A 2HQLA 1T5XD 1BR9A 4PG3A 1GD7A 4A3GG 3ONAB 4A3FH 4LF6Q 2J7ZA 2JEAI 3C3LA 4YCVA 3HS0C 4EQPA 1HNXL 4MTKA 4IUQA 1NTGA 4JI7L 4EQNA 1KDAA 3K7AH 3HKSA 1VQAA 3I4NB 1E2ZA 3SXHA 1B53A 3I4MB 3S2HB 4A3DH 3I4OA 3KFUA 4Z9CB 4QUFA 3SE0A 5GAHC 1WCMG 4LFAQ 4FF3A 3A8IE 2EYJA 2EE1A 3AFQA 3H09A 3QJYA 2N88A 4E6IA 1E1OA 4N9PA 2ENBA 1LM0A 1QNKA 1FL0A 4R4CA 4F87A 1Q86C 2L5TA 3RMHA 3KLWA 4LNQA 1SAPA 4WJ3M 2PI2E 1F9RA 1I6HH 1PTOB 3BZDB 4KTAA 5M3FB 1TIID 5GADC 1E2VA 2R61A 2E8GA 4FHGA 3O13A 4DV6Q 1YHAA 1JOOA 4LWCA 5M3FG 2FXQA 3K7UC 2R6GA 1C7YA 2K6AA 1J5EQ 2GVAA 4RH0A 2OCEA 4RG1A 2IT1A 5IYDH 2ICIA 3P75A 1BXTA 1Q82C 3AMUA 2IPKD 2TMPA 1XXGA 2E75C 3EQLC 4A76A 5ELEA 2KCNA 3S14B 1TS5A 5IWAL 1YNJD 2G9DA 4A4IA 4JG2A 4TRDA 1F2YA 3PO3B 3K6OA 5CGKA 4DR4Q 1V8QA 1JOKA 4A3DB 1QG7A 1E1TA 4LF7Q 1KC8C 3KDFB 2NVTB 3S9WA 3J7A5 2CCZA 1PDQA 4PQXA 4DAPA 4C1NK 3LGJA 5J39A 4NB3A 1SMYD 1VQOA 1VQFA 4AYBE 1DD2A 5CORA 3GV6A 1WD1A 2JA5B 4IFDJ 4DUZL 2IL8A 2HHHL 3IAYA 4DUYL 1EU4A 1VQ9A 1TWFB 4QY7A 3IKJA 5CV7A 2UUAL 5T1GA 3GTKB 3HOVG 3NBHB 3PO2G 1W6JA 4JI1Q 4NXNQ 5J3BA 3QG1A 3HOZB 4HEDA 2B29A 1FJGQ 3SGIA 1CHQD 2EY6A 3D0FA 4KN4C 2C35B 3OIPA 1C0AA 4FXKC 4RKBA 1PYBA 3MEHA 4IFDH 2Q8TA 2Z8LA 2J0TD 1H9SB 4JI4Q 2EOTA 4DUYQ 5IYBG 1GJXA 4RHSA 2PZUA 5DNFA 4NMZA 3BYTB 1FNWA 5ISRA 4H44C 1IBLL 1XNRQ 2V4DA 5A35A 3J7ZC 3L7ZC 1HA5A 3T4AC 5LMNQ 1WYDA 1CKNB 2Z9HA 3BZCA 1Y1WH 1Q7YC 1SYEA 1I5FA 1F2MA 2AUJD 4R4QA 1A0IA 4WJWA 4DV1Q 2F0WA 1R4QB 4A3MG 2P5ZX 3FP9A 1JICA 1YJ9A 4GN5A 4NPSA 4JK1C 1I3QB 3K0XA 1QOHA 5NUCA 1HNZQ 4RHRA 3H0GH 4JBKA 1VQCA 1CTMA 3CAMA 4DV7L 3S2DB 4A3IG 1J9OA 2EQSA 1SJHD 4NKLA 2F0SA 3CD6A 4UPAA 1G2TA 5IYDG 1UWVA 1BO0A 3BVMA 4PZ6A 4X62Q 3T1HQ 2OTJA 1LT4D 4A3JH 4CDDC 2J4XA 4IFDG 4CHTB 2MJ8A 3GO5A 2B63H 1JMCA 3HFZB 4R9WA 1EEFD 4A3BH 4MHEA 5IOCA 2PW7A 4X3KA 2VZAA 4FO2A 1HNZL 3J80E 3JC66 2HIXA 5G3LD 1X3GA 2B2VC 2HQEA 1Y8NB 1YI2A 1WTPA 2MFIA 1QVFA 3GTGB 1H9RA 5CC4A 2K4KA 1YJNA 1ZXTA 4MN3A 1V1QA 5BN4A 4KK7A 1X3EA 5G3LF 1QVCA 3BDLA 2ALYB 4X3SA 1I94Q 3EJIA 1GUTA 3HOUH 5M3MB 4X65Q 1SNOA 4LF8Q 3PIO3 1KD1C 3PQIA 2VUMG 1VF5C 2QDLA 1VQ4A 4FVMA 3KF8A 2JA9A 1HH2P 4NW2A 2VB3X 2R92G 2EYFA 2TSSA 2MHVA 4JI3L 1P16A 1DYQA 1VQBA 4YCUA 3T1YQ 3NE5B 1ASZA 3DM3A 1ZEQX 3ERQA 2IHFA 1U5KA 1B1ZA 1D1KA 2RCFA 5JAVA 2L9HA 2JA7B 4P71A 4JOIC 1FVIA 5M5YB 2RSNA 1TWCH 1T5EA 4CDCC 4GOPB 1KAAA 1RF2D 3UDIA 3BVGA 1Z6HA 4R1JA 2RHSB 2EYOA 3PUVA 4B08A 2L1BA 1PFSA 1O7YA 1BKBA 3NTKA 5LHY1 1LT6D 3T1YL 3HOUG 1L1OA 3OW2A 4UAIA 3F1ZA 4LFBQ 4NP5A 2N55A 5FJ8G 1IW7C 4A3KH 3TRZA 2EIFA 4K6DA 4PV1C 3H91A 4HIKA 4DK6C 1PFNA 3KOJA 3J81i 1ZYRD 3HP3A 1NBWA 4IURA 2QW7A 4BS9A 5DLQE 4DV5Q 2LSSA 5HURA 1IBMQ 1RTOA 2B39A 4QMGA 1TXYA 1PTOH 3N52A 2A6HC 3QWNA 3JAMi 5CV4A 2RKSA 3NSWA 4DA2A 4ZKCB 2Q2TA 2QEJC 1XTCD 3TSSA 4JCVE 4ZKBB 4AIMA 1STGA 4LFBL 3H94A 5C5LA 1WOCA 3NK9A 1HNXQ 1PH4A 2B63G 3J7AV 1SYCA 2RVLA 3OPOA 3OW7A 1NE3A 1JWSD 1VQDA 1EY8A 5BR8Q 1HFNA 3TEHB 3HOZH 4DV4Q 3CANA 5I6WA 4DAMA 1IL2A 1SNQA 1E24A 4M8AA 1U0LA 1B50A 3CCEA 3I73A 1UEBA 3NQTA 4DR1Q 5M5XH 1B3AA 2EJMA 5I6YA 3BU2A 2KJXA 2A68C 2DUDA 4KJNA 1B3QA 1ILPA 3GTOB 2OF1A 4NDXA 2C9OA 3L3OC 3CMEA 4R4OA 2I46A 1OXSC 3I90A 5AJ3L 1BCPF 3PV0A 2RA4A 1YNJC 1AZQA 3M4QA 2ZM6Q 2B2TC 3NHHA 5JVG3 1EWHA 3CQZB 2Z0SA 1K3RA 4LF6L 3CKIB 1VQKA 4K6LA 1N34L 1Y8PB 2D5DA 1Z9FA 2MNAA 1NY4A 1JT8A 2KHSA 3A56A 3KLSX 3NELA 1B9MA 1STNA 3H15A 4DV0L 2EYMA 5IODA 4DR7L 1QUQA 1SN8A 5KEEA 3AQQA 5E7NA 1TY2A 3IFDA 1JWMD 1AE3A 2MPMA 4A3KG 4LF5Q 1R4PB 4DNRB 2VY3A 3A5UA 3C46A 3R3OA 4XT3B 2OQ0A 1E3PA 3HKZG 4QGUA 2B8GA 5KIXA 2F4VQ 2JQOA 4ZUIA 2UU9Q 1UE7A 2NVYB 5E3FA 2R93G 1TU2B 1WTOA 3DEPA 3S15H 1WTRA 4RKLA 1RIPA 2WB1G 4A3JG 4FHFA 1DOLA 4RGOS 3SEBA 2BDNA 1KXLA 4KY5A 2SNSA 4GNXC 5C0XI 2PNHA 4HCEA 3U4VA 4QIWB 3S1MB 1QNUA 1Y1VB 3AFPA 2XWJB 5C0XG 5HGTA 3GTLH 2NB0A 1HZCA 4OHJA 4ABNA 3S15B 1XNQQ 5C4XB 2KBNA 3STBD 2RF4A 4A3EG 2DY7A 2BH2A 2CWPA 2ATWA 3M4PA 1EFWA 4A3JB 3NWSA 2ZTEA 2R92B 4L5RC 2F0LA 2JXMB 1QZGA 3G71A 2QF7A 1LTID 1X3PA 4P75A 3DLLA 1PYWD 1VQLA 2PZTA 3G48A 3KDFA 3W3AA 4JI2L 4X64L 4YY3Q 2EY5A 2K5QA 4C2MH 3HOYG 1PLFA 4IUPA 3KYHC 2E2HH 1C9OA 4P73A 3VR4A 1SXTA 1EQQA 1B9NA 2K03A 4B3SL 1N32Q 5I9PA 2ZTCA 1TY0A 4KI0A 1SNPA 4IPCA 5C0XH 1L1OC 3ND9A 1H95A 3MFYA 1SFOH 4OWTB 3OTOQ 1LTSD 3A7AB 4OGQC 2CH4A 2JP1A 4JI0L 1S3OA 4PMBA 3GTQH 3F2UA 3D3RA 4ZK9B 1K8OA 4FDBA 4LJZC 4RMFA 2PO4A 4IUTA 4O42A 3S2DH 3AYHB 3PGZA 4PMCA 1GHKA 4BY7B 4UY8C 5IY0A 3OHXC 3DWQA 1YBYA 3VA7A 4DR5Q 3K80C 1N32L 2WINB 1EQVA 5J22A 4M1UB 4A3GB 2UXDL 2Z1CA 3AU7A 3I56A 4HTHA 3K57A 4CJ0B 3CXCA 4TVAB 3A7LA 1X3QA 2B2YA 5FLXL 1U4LA 1XNRL 1TWCB 2RHQB 3D8GA 1AZPA 1N33Q 3OWFA 1I94L 3SK8A 1E0BA 1IKMA 5ELDA 5EQ0A 3TMEA 1MHWC 5JPMC 3CCVA 1G6ZA 2KA7A 4OO1I 2YTYA 1YVCA 1K0RA 3PO3G 5IYBH 3KF8B 1QILA 1B70B 3BG3A 1JJCB 3P7JA 1JR0D 2UXDQ 4X6AH 2Y0SB 4YWLA 2K04A 4ZUJA 1YHBA 1IKLA 1IYUA 3KBGA 2F0TA 1RKNA 2BA1A 1Y1WG 2NZHA 4H02A 3WOFA 5L37A 2A73B 5DAUA 3UI2A 1ENAA 4A3FG 3SK5A 1D6EC 3SR1A 4A3CH 3MA2B 1U4MA 3GTPH 3VR5A 3TP6A 3JAML 2RBMA 3GQBA 1ML0D 1GOZA 1VCIA 2WAQG 2EDGA 3S1RB 1MI2A 3U4ZA 2WV6D 3HOXH 1DZ1A 2D9UA 4I7AA 3M4YA 1PV4A 2F1MA 4C3HB 3HOYH 4DAYB 1OLTA 1G91A 1SDFA 5EBCA 1VMPA 5BN3A 3OSOA 1WI5A 1L1OB 1NR2A 3HOXB 1IBML 4ZAIA 3GTJH 1TWAH 2IX3A 1FR3A 4PZ7A 2UUCL 3HOVB 3M4OB 1AFPA 5M5XB 2O5IC 2NVXB 2NVYH 1WFQA 2JA6G 4WFN3 3CCJA 1CUKA 1S5CD 4FXGC 1VQ5A 2BCOA 3ULPA 4R8IA 2DNCA 1N36Q 3OOCA 1PRTB 5CV9A 1VQEA 4CDEC 3CMAA 1L2FA 3J7AF 3RNUA 3CP0A 4CKEA 1PH1A 4P2CB 2D0PA 4JYAQ 3FKIH 2PNRC 1YNNC 4MTNA 4AQYL 4A3EB 1LACA 3BZKA 1XJVA 4BBRH 4Q0FA 5KNBA 3NTIA 2D62A 3VYRA 4EX5A 4XYQA 2ZXOA 3MXPA 1VDZA 5DM63 4IFDI 3PF5A 2MO1A 1NSNS 3PIOA 1M90C 1GVPA 1VQGA 2XTIA 1I50H 4A3EH 1FYCA 4L5QA 5EAYA 5AJ3Q 2PZWA 4DR6Q 2HD3A 5JJKA 1KNAA 4OIJA 4RGMA 5CV5A 3FMCA 2E2HB 2BOSA 2F3WA 1M4VA 1RL2A 3UDFA 4FF1A 3JAMc 2RQXA 2KCTA 2WB1E 1PRTC 2BE5C 2PPBC 1L0YB 3HOVH 4DV2Q 3VR6A 4GN4B 2N49A 2E2IH 1B4OA 2PI2A 1XWEA 4KKUA 4DK0A 4YHHL 1IZ6A 3K0YA 2OQKA 4BBRG 4G7HC 3EROA 4J6HA 2JA7H 2F0DA 1EUJA 1ICWA 1QJOA 2K05A 1TS4A 4A75A 4XXEA 1PFBA 1LLRD 1R9TB 2KUMA 3M85A 1J5EL 3E0JA 2LXKA 2HIVA 5FLMG 2G5DA 1CI3M 2FJ2A 3MEFA 3BJUA 4GLVB 4G7ZC 4BBRB 4JI7Q 1K0SA 1E22A 2NVQH 1SRUA 1W3SA 2E2JH 4V0BA 4GLAC 3A55A 4KHPQ 3FEWX 1SMYC 4MZ9A 5D65A 2JJQA 5KRUA 4IPHA 2B2TA 1I3QH 1RODA 3OWEB 4XQQA 1GUGA 1S5DD 1PRTD 1TS3A 2YU9B 2KECA 2B8FA 2A68D 1A3VA 4A3IH 3G4SA 4AH6A 4CKCA 4RCNA 1VQ7A 2Z6BA 1PH7A 2JA7G 4BBSG 1AEXA 2F3VA 3G6EA 4DV0Q 1XX8A 4OL7A 2HCCA 4ME3A 4HJ7A 4JV5Q 2DY8A 4KHPL 3FVQA 4J1MA 3I70A 1V9PA 4FHDA 1WCMH 4DUZQ 4IUVA 3GD7A 3HRZC 3OMGA 2B63B 2AWNA 3I4LA 3H3VC 4EVOA 3S17H 2PMZB 4A3BB 3S16B 3QOJA 5FLMH 4UHVA 4JBMA 1YJWA 1EFID 1STAA 2NUCA 4EQOA 4X3TA 1PH5A 1DOKA 3QO2A 4HSVA 4FYDA 4YWKA 4DXFA 2LXJA 4N9TA 1EZ6A 1XPUA 1NAPA 5FK9C 5IWAQ 2VUMH 3K5OA 1SJED 3W2DA 4ME5A 1IYVA 4ULLA 1O7IA 4K5VA 3M7NA 2K5WA 4JOIA 4L63B 4LAAA 3V96A 3X3MA 4XQJA 3DWAA 3U58A 3RN5A 2RDGA 1H9KA 2XIWA 4PNYA 3RZOH 3FPUB 5M9OA 1CA6A 2E2DC 3U9SA 2F0PA 3R2IA 3MFGA 2ZXPA 4IOCA 5BR8L 3S17B 4RCOA 2A6HD 2C5CA 1EY7A 1QCBD 2K14A 3V2TA 2BH8A 4HIOA 1HNWQ 4XYOA 2MO0A 3A8KE 3M3YH 4DAVA 2VL6A 3S14H 4LF9Q 2A6EC 2F0HA 1TWHB 5IGFA 4IUNA 4L6TB 2IHEA 2KHIA 3S1RH 1KQSA 2JEBI 1Y14B 3CPFA 1EU3A 3IL8A 1HR0Q 4JI2Q 5C44G 1AN8A 3FKIB 4DFAA 4GOPA 1EY4A 1ZKOA 4WJ4A 5JPNC 3HOYB 3IFTA 2AQ2B 1EIGA 2QEXA 1HNWL 3RZDB 4HAEA 1BOSA 5HY6A 2FMMA 1STHA 2UUBQ 2OTLA 4A3CG 1F2LA 5KNCA 3MHBA 3E5SA 4K9RA 1O7ZA 4K0KQ 1PH2A 5COYA 3OTOL 1TWAB 4JC0A 1YNXA 2PQEA 3I7FA 4JPBW 1Q1BA 1SMXA 3T13A 1SE4A 4XTCS 1PVOA 1YHQA 2EVBA 5LMNL 4JI8Q 1PTOD 2X6GA 2VXWA 4ILWA 2KOLA 2HHHQ 2M9VA 3SHLA 3K5LA 4IO9A 4HSPA 1KDBA 4LF5L 1HUNA 2B2WC 3OMCA 1JQYD 2YTXA 1NJIC 4HN7A 1PH6A 3I3CA 4IPDA 1YIJA 1C8CA 1B2TA 1XMOQ 2RDHA 1A2TA 4GS3A 3ULLA 4A3LG 1FJGL 4IPGA 4GNXB 2HT1A 1IXRA 4DAYA 3QB3A 3PUWA 3FHWA 2Q8IB 5KYLA 1EIYB 3W5OA 1VMCA 2O5JC 2K5DA 5IT9L 5LMUQ 4OONA 2VQFL 3E9IA 3H0GB 4C3IG 3WOEA 3NPPA 4B3TQ 4CKBA 1B8AA 3I55A 5EPLA 3CCMA 3NEMA 3KBXA 1JC7A 3H0GG 4J8QA 1HR0W 5EPJA 4R4TA 5IGGA 2UUCQ 1IBKQ 2IY5B 4QQBX 1GUSA 1SE2A 1RCVD 5FKAC 5JOBA 3J81L 1JB7A 1VQPA 2AQ3B 4ODGA 3MXNB 2JA5G 1DGSA 1SEBD 1TS2A 4H7BA 2I5HA 4A93G 3OIQA 3PSIA 1YITA 1AH9A 2N78A 1K83B 2SOBA 3PO3H 1RJTA 2F03A 2NVXH 2WFWA 1CSQA 2O4XA 4GZYC 3CCRA 5CV6A 5C4XH 1CKNA 5ELCA 1HJPA 1J6QA 2EY2A 1VQNA 1KAWA 4A93B 1S5BD 3J80c 1D1IA 4POFA 4O1NA 3J81c 2F0MA 3CHBD 3D4RA 4X62L 3T1HL 2R7ZG 3J80i 2Q2HA 3TDQA 1K83H 2LY7A 1HZ9A 2E2IB 2Z6KA 3F2DA 3TS0A 2EZVA 1H9JA 4K2KA 4DR2L 1UEAB 4R4IA 3U9OA 3U50C 5EGTA 1VQMA 2EJGC 5E4XA 4EGVA 4BWGB 4CJ1B 4ALPA 2NVQB 2JA6B 2I0QA 5C3EB 5T1IA 4K5XA 3R8BA 2NWGA 3H3VH 1C4QA 1I4GA 4BY1B 1EY5A 1AE2A 1Q1EA 2MQHA 5KGUA 4DR5L 3RLFA 4LUZA 3S1MH 1PZJD 1CM9A 1YNND 2LS01 3ERSX 1PA6A 1EYGA 4PZ8A 3TQYA 4DV5L 3PF4A 2JN4A 2F4IA 2M2LA 1MKHA 4A3LH 4X66Q 4JYAL 4YWMA 1SSOA 3B6YA 1XPRA 1LO5D 5FJ8H 2UXBQ 4LF4Q 4C2MB 4OX9L 3RLNA 1HTLD 1CQVA 2QILA 4L5SA 5IGEA 3P20A 4J15A 2K33A 5C3WA 5EKLA 3URYA 1ENFA 3W1GA 3BYYB 3QOLA 3NWTA 1RTNA 2JE6I 3HOWG 5I9OA 3FKIG 3VYSA 3J81E 3BVZA 1UE1A 1Q90A 4IN3A 3KJPA 1RHPA 1MSGA 3CRKC 3G6JB 1CKOA 1NMGA 1X9NA 2BA0A 4KHVA 1PZID 5HGQA 1PTOC 4C3IB 1WTQA 3NQIA 5CMDA 3NBHA 5IYCG 1OXTA 2UXCL 5M5YH 1VF7A 4OX9Q 1BCPD 4KHZA 4LK1C 2GVBA 3QIAA 5EKKA 3RZOB 3UDXA 2UU9L 2CFMA 2Y0SE 1S40A 2WKDA 1ENCA 2B2UC 3VA5A 4ZQ3A 2LKVA 4MIUA 3ER0A 2QGQA 4KMUC 1MJEA 5GAEC 4Y7NH 2N8NA 1UE5A 1JJGA 2K5VA 2R7ZH 3GTMB 5JJIA 2CW0D 3MTSA 2A69D 1JCKB 1EEID 3F2BA 1X56A 3VYTA 1PXUA 3EVQA 4B3ML 1UE6A 1HHVA 3PCOB 4LMQD 4LW1A 5D3DA 2JA8G 4A3GH 2AQ1B 4RAUC 4XT1B 4QCLA 1MJCA 1M1KC 4EQ5A 2JK8A 1P8LA 4I65A 2PQAA 1Q8KA 4H13C 1SE8A 3CQZH 1PH8A 4HIDA 3Q8DA 1EYAA 4HJ9A 2Z6KC 4C3JG 4XQNA 4OIKA 2KCCA 4RGNA 2FHTA 1Y1VG 2WKCA 3S2HH 1BCPC 1MD2D 2F0VA 2Z4IA 3VR2A 1VQIA 1EL0A 1II3A 3J81j 2WP8J 3MXNA 2ES2A 3L0OA 2F4VL 3HGBA 1Q12A 1HZBA 1TT2A 3BDCA 1CFMA 1TKWB 1EOVA 1PYSB 3K5NA 3TP5A 3CPWA 4B3SQ 3GTOH 1F9SA 1X6OA 3HKZB 4V190 3EFXD 1KLUD 1WTHA 1EIHA 4GKJQ 2YYZA 2QA4A 2VQEQ 2H4OA 3T56B 1EIFA 5M3FH 2DN8A 1AW7A 4LFCL 1N34Q 3D6WA 1S5ED 1EWCA 1PZKD 3M7GA 2EXDA 1K73C 3SVMA 3WWVA 4GN3B 1FGBD 2NN6G 1JE5A 2IW3A 3CCQA 3GP7A 2OEOA 1XNQL 1SYBA 4WRDA 3PUYA 2E74C 3CU7A 3T51B 2K75A 4NXMQ 1NCVA 1PRTF 4C1NI 1PH9A 4RA8A 4K5WA 4O2DA 4K14A 2PW5A 3TZDA 2CWAA 1HUMA 5IYCH 2CKZB 1S72A 3TP7A 4MNOA 1OO9B 1EOTA 2ZJQA 1QUQB 4K0KL 3I4MG 2IX1A 1DCZA 4HJ5A 3I8ZA 2EYHA 4Y52H 4OWXB 4C56C 1LTLA 4GLXA 1Y69U 4DNTB 2XRQD 1X54A 3A8JE 2JA6H 1U9RA 1ICFB 4F7XA 4FHEA 3RLOA 1EY9A 1GKHA 3ITPA 1MGSA 1STEA 3GTKH 2PCFB 1MIUA 2AKWB 1E2WA 1VQ6A 1GO3E 3LWUA 1ASYA 4OWWB 2DNEA 1CHPD 1KRSA 4PMWA 4DR4L 3JAME 3J7YW 1G6PA 4LF7L 2A5HA 2CHBD 1SR3A 1MSHA 2L4NA 2CQAA 1PFMA 3PO2H 4L5TA 3Q24A 2K5HA 1ESFA 1HR0L 1EWIA 3A5ZB 3R2TA 5LL6S 1HQRD 2DJFC 4A93H 1W6KA 2A19A 3DMUA 4KLKA 1FNUA 1HCZA 5GROA 4DV1L 2K52A 1EY0A 2HDMA 1TWGB 2R93B 3GTLB 1HQMC 3MAQA 5I4DA 1MBYA 3ZJYC 4ID6A 4XDXA 2E5LQ 4BBSB 1D5MC 4FF4A 5IT9E 3CCLA 1O80A 1Q81C 2WAQB 5ELOA 3MWYW 2X6LA 2NN6I 4N8FA 5C5MA 2LFNA 3H6MA 3F2CA 4FNFA 1D2BA 2AHOB 4HJ8A 3CC4A 4A3FB 1YZ6A 4QF4A 1AP0A 5C44B 3RUZA 4BY7H 1BUVT 3KLRA 4A3MB 2B2VA 4IALA 2QCPX 1T9HA 4JI0Q 2IX0A 4DGZA 1HXYD 4BA1I 2M00A 1VQJA 1XTDA 2JYOA 5I2XA 4IOAA 4JI6Q 4B9XA 3TP8A
chains in the Genus database with same CATH topology
2K14A 2BH8A 3UE0A 4HIOA 5JJLA 1YEZA 1JJ2A 5LMUL 3GTMH 1HNWQ 1QZHA 2MO0A 3M3YH 3M4QA 2ZM6Q 4UP9A 2VL6A 3S14H 3CF5A 4DKAC 4LF9Q 1N36L 1D8LA 2Z0SA 1K3RA 4BY1G 1OTCA 4LF6L 1KRTA 1VQKA 4GOPC 4BY1H 4A3BG 5K36G 4DV3Q 1N34L 3E0EA 2IHEA 2UUAQ 2KHIA 1Z9FA 2K5NA 2MNAA 3S1RH 2XGTA 1NY4A 1KQSA 1JT8A 3NELA 2JEBI 2I5LX 1Y14B 2R7DA 3CPFA 3H15A 4JI3Q 4DV0L 1K9MC 1HR0Q 4JI2Q 5C44G 4DR7L 1QUQA 1SN8A 2H5XA 4GOPA 4WJ4A 4C3IH 3AQQA 3K81C 5E7NA 2B3GA 2AWOA 2QEXA 1AE3A 4A3MH 1HNWL 5C3EH 4UP8A 4A3KG 4LF5Q 5HY6A 2UXCQ 4BY7G 4LF9L 2AMCB 3GTGH 4A3CG 2UUBQ 2OTLA 2VY3A 3UE1A 3A5UA 4GKKQ 4DR3Q 5IP9G 2OQ0A 2R92H 1WJJA 4K0KQ 1E3PA 3HKZG 5ELNA 1PH2A 4QGUA 3OTOL 3HOXG 2F4VQ 4JC0A 1YNXA 2JQOA 3I7FA 2UU9Q 2R93H 1UE7A 4DV4L 1Q1BA 1SMXA 3I2ZA 3L2PA 2R93G 4JI5Q 3S15H 1OXUA 3PUZA 4XTCS 1RIPA 1YHQA 2WB1G 4A3JG 1PVOA 5LMNL 2UXBL 4JI8Q 1KXLA 4LF4L 3PIPA 3EN2A 4GNXC 3S1QH 5C0XI 2HHHQ 4P72A 4DR1L 2PNHA 1E7ZA 3U4VA 5C4XG 4LFCQ 2K50A 4IO9A 1FGUA 2F52A 4LF5L 2VNUD 3AFPA 5C0XG 2YTXA 1NJIC 3F8TA 1PH6A 1GM5A 4IPDA 1YIJA 3GTLH 2YV5A 4B3RL 1XMOQ 1HZCA 3I4NG 1EQRA 1XNQQ 4A3LG 4GS3A 3ULLA 2KBNA 1HZAA 4IPGA 2RF4A 3STBD 1IXRA 4IJHA 4APVA 2CWPA 4GNXB 3W1BA 1NMFA 3RR5A 4A3EG 2BH2A 3PUWA 3FHWA 4NXML 1EIYB 3W5OA 2ATWA 3M4PA 4JI5L 5LMUQ 4OONA 1EFWA 2A1AA 3E9IA 2VQFL 1N9WA 3RN2A 2YU9H 2ZTEA 4LFAL 5IP7G 3S24A 4L5RC 2HQLA 4B3TQ 2NZOA 1B8AA 1GD7A 4PG3A 3EIVA 3I55A 3G71A 3CCMA 4A3FH 1QZGA 3NEMA 4LF6Q 1TWFH 2JEAI 3H0GG 2RCNA 4YCVA 3CC7A 1HNXL 4P75A 3DLLA 3KJOA 1VQLA 1HR0W 1NTGA 4JI7L 4R4TA 2UUCQ 2IY5B 1IBKQ 4QQBX 3G48A 3K7AH 3HKSA 3KDFA 3HKZE 4JI2L 3D31A 1VQAA 4X64L 4QIWE 1KIXA 3VDYA 3TREA 1JB7A 4YY3Q 1VQPA 2Q2IA 3MXNB 4C2MH 2JA5G 3E9HA 3HOYG 3I4OA 4A3DH 1DGSA 4A93G 3KYHC 2I5HA 2E2HH 1C9OA 4QL5A 3PSIA 1YITA 1AH9A 4P73A 3KFUA 2N78A 1EQQA 5GAHC 1N32Q 4B3SL 3PO3H 2NVXH 1WCMG 2WFWA 4LFAQ 1CSQA 3M4OH 4LF8L 4HJAA 3CCRA 2ZTCA 3AFQA 4KI0A 5C4XH 4IPCA 1H95A 1L1OC 2YTVA 1CKNA 1SFOH 4OWTB 1A63A 3OTOQ 1XMQL 1HJPA 1J6QA 1E1OA 4DV2L 4R4CA 1LM0A 1KAWA 1FL0A 1VQNA 1Q86C 4JI0L 1S3OA 3J80c 3GTQH 2PQAB 1BBWA 3KLWA 4POFA 3CCSA 4LNQA 1KHIA 2PI2E 3J81c 1I6HH 4WJ3M 4FDBA 4RMFA 4X62L 3T1HL 2R7ZG 3J80i 2Q2HA 4JV5L 1D7QA 3HOZG 1K83H 5GADC 3S2DH 3AYHB 3PGZA 1HZ9A 2Z6KA 4UP7A 2E8GA 1VQ8A 3F2DA 4DV6Q 1YHAA 4LWCA 3TS0A 4UY8C 5IY0A 2ZTDA 4DR5Q 1YBYA 5M3FG 2FXQA 3K7UC 2R6GA 3K80C 1C7YA 2ZM6L 1N32L 5C3EG 4DR2L 1J5EQ 4R4IA 1B7YB 2UXDL 2GVAA 3U50C 2Q2UA 3I56A 1VQMA 4B3RQ 1KL9A 2CQOA 2OCEA 2HT1A 3CXCA 4TVAB 4RG1A 3GDEA 2IT1A 4ALPA 1OXXK 5IYDH 4DPGA 4DR6L 2I0QA 1XNRL 2RHQB 1Q82C 1N33Q 4A76A 2D0OA 1I94L 1BBUA 3H3VH 2ZJPA 2ZJRA 5IWAL 3CCVA 4GKJL 1AE2A 4A4IA 4OO1I 1Q1EA 2YTYA 4JG2A 1YVCA 1K0RA 2MQHA 4B3MQ 3PO3G 1VS0A 4DR5L 3RLFA 3KF8B 3A0JA 4LUZA 5IYBH 3S1MH 3ERSX 1B70B 1L0WA 1JJCB 2UXDQ 1PA6A 4X6AH 1QVGA 4GKKL 4YWLA 4JI1L 4PZ8A 3TQYA 1SLJA 4DV5L 1EYGA 4DR4Q 1W2BA 3PF4A 1YHBA 1E1TA 4LF7Q 1MKHA 1KC8C 3KDFB 4A3LH 2KCMA 4X66Q 3J7A5 2CCZA 4JYAL 2BA1A 4YWMA 3B6YA 2NZHA 1Y1WG 4H02A 3LGJA 4BXXG 1XPRA 4GNXA 1LUZA 4NB3A 5FJ8H 1Q46A 4HIMA 2UXBQ 1VQOA 1VQFA 4AYBE 4LF4Q 2I5MX 5IT9c 4A3FG 4OX9L 3RLNA 4IFDJ 5IP7H 4DUZL 2HHHL 4A3CH 4DUYL 4L5SA 1VQ9A 3GTPH 1SROA 4QY7A 2UUAL 2GN5A 4J15A 2WAQE 3HOVG 1VCIA 2WAQG 4DK3C 3W1GA 4DNIA 3NBHB 3U4ZA 1XPOA 3PO2G 3HOWG 2JE6I 4JI1Q 4NXNQ 3HOXH 3FKIG 5J3BA 3HOWH 2B29A 1UE1A 4BBSH 4DR7Q 1FJGQ 3SGIA 1PV4A 3KJPA 3D0FA 5M3MH 2C35B 1CKOA 1NMGA 1X9NA 2BA0A 5HGQA 5FLXc 4DV6L 2ASBA 5LMNW 3HOYH 4DAYB 1OLTA 1Y1VH 5IYCG 1C0AA 1OXTA 1PYBA 2UXCL 1WI5A 5M5YH 4OX9Q 4JI4Q 4DUYQ 5IYBG 1L1OB 4KHZA 3CCUA 1IBML 2GVBA 3GTJH 1TWAH 3UDXA 2UU9L 2CFMA 2Y0SE 1S40A 3S16H 1IBLL 1XNRQ 4PZ7A 5GAGC 2UUCL 3ER0A 2QGQA 3J7ZC 4JBJA 1MJEA 1K8GA 3L7ZC 5GAEC 4Y7NH 2N8NA 2NVYH 1UE5A 5LMNQ 1JJGA 1WYDA 2K5VA 1CKNB 1WFQA 3M9BA 3NENA 2R7ZH 3BZCA 2JA6G 1Y1WH 1Q7YC 5JJIA 1I5FA 3CCJA 1CUKA 4R4QA 1A0IA 4DV1Q 4A3MG 1VQ5A 3F2BA 1X56A 3ULPA 1LYLA 1UE6A 3FP9A 4B3ML 1YJ9A 3PCOB 4GN5A 4LW1A 4NPSA 2JA8G 4A3GH 3K0XA 3TS2A 1N36Q 1HNZQ 1Z47A 3OYYA 1MJCA 4OO1G 3H0GH 4JBKA 3ICEA 1X55A 4P74A 1VQCA 3CAMA 1XMOL 1VQEA 2N3SA 3CMAA 1L2FA 4DV7L 4A3IG 1M1KC 4EQ5A 2JK8A 3RNUA 1P8LA 3CP0A 2EQSA 1PH1A 2D0PA 1Q8KA 2PQAA 5M5WH 1TWGH 4JYAQ 3FKIH 3AEVA 5M3MG 3CD6A 1SE8A 4UPAA 5IYDG 1UWVA 3CQZH 4MTNA 4AQYL 1PH8A 1X3FA 1CKMA 3Q8DA 3BZKA 4PZ6A 4X62Q 4HIDA 3T1HQ 4BBRH 4JBWA 1R9TH 1XJVA 2OTJA 4A3JH 4HJ9A 2Z6KC 4X65L 4IFDG 4B3TL 3KF6A 1IYJB 2D62A 3H3VI 1Y1VG 3GO5A 4EX5A 2B63H 1JMCA 3HFZB 3S2HH 4XIGS 4A3BH 2VS1A 3I4MH 4IFDI 3PF5A 2VZAA 2MO1A 2UUBL 1VQIA 2R7FA 1HNZL 3PIOA 1M90C 1GVPA 1VQGA 2HIXA 2WP8J 3JC66 4NXNL 3J81j 1X3GA 1X65A 1I50H 2XTIA 2ES2A 3L0OA 4A3EH 1YI2A 1A62A 2MFIA 1V43A 4L5QA 5EAYA 2F4VL 4YY3L 5C44H 1QVFA 5AJ3Q 3I4NH 1G51A 1Q12A 1HZBA 3K8AA 2A8VA 2K4KA 1YJNA 4DR6Q 1V1QA 1EOVA 1PYSB 1X3EA 5JJKA 4A3GG 1N33L 4QJFA 1QVCA 3CPWA 1I94Q 2ALYB 4BXXH 2OWOA 4B3SQ 1X6OA 3ULJA 4JI8L 3GTOH 3HOUH 1RL2A 3UDFA 2DGYA 4X65Q 2ID0A 1KD1C 4LF8Q 2YYZA 3JAMc 2QA4A 2VQEQ 4GKJQ 4JI4L 2VUMG 4TQUS 4YCWA 1VQ4A 1EIFA 5M3FH 2KCTA 2WB1E 3KF6B 4DV3L 4LFCL 1N34Q 3HOVH 4DV2Q 3RZDH 2EXDA 1K73C 4GN4B 2JA9A 1HH2P 2N49A 2PI2A 3WWVA 2E2IH 1IBLQ 2R92G 4GN3B 2NN6G 4YHHL 4IJLA 4JI3L 1IZ6A 1JE5A 3CC2A 3CCQA 1P16A 2OQKA 1XNQL 1VQBA 2E5LL 4YCUA 3PUYA 3T1YQ 4BBRG 4POGA 1ASZA 2K75A 3DM3A 4NXMQ 2JA7H 1EUJA 3UDGA 1PH9A 4O2DA 4A75A 5GQOA 2VQFQ 2IHFA 1U5KA 2CWAA 1G291 3M85A 3EBEA 5C4JH 5JEAG 4DR2Q 5IYCH 1N8RC 1J5EL 3PUXA 4P71A 4JOIC 1TWHH 2CKZB 1FVIA 1S72A 2LXKA 2VQEL 1TWCH 4MNOA 2HIVA 4GOPB 2ZJQA 1QUQB 4K0KL 3UDIA 3I4MG 2IX1A 2VW9A 4HJ5A 4DV7Q 5C0XJ 1PH3A 4C3HH 5FLMG 4R1JA 3MEFA 3BJUA 4GLVB 4Y52H 2RHSB 4OWXB 1LTLA 4GLXA 4JI7Q 4OXPA 1IBKL 1E22A 2NVQH 1SRUA 1W3SA 4BA2I 2E2JH 1X54A 3PUVA 4AYBG 4X64Q 4GLAC 1PFSA 2JA6H 4JI6L 4KHPQ 1BKBA 3RLOA 1GKHA 3T1YL 3HOUG 1L1OA 4MZ9A 3OW2A 4LFBQ 3F1ZA 2JJQA 5FJ8G 4A3KH 3TRZA 4IPHA 2EIFA 2JA8H 3GTKH 1MIUA 2AKWB 1BVSA 4DK6C 4HIKA 1VQ6A 1K8AC 1GO3E 1I3QH 3KOJA 3J81i 1ASYA 4OWWB 1NBWA 1KRSA 3CW2C 5DLQE 4PMWA 4DV5Q 4DR4L 4A3IH 1G6PA 2LSSA 4LF7L 3G4SA 1IBMQ 1SR3A 4AH6A 2L15A 3PO2H 2PMZE 2NVTH 1TXYA 2JA5H 4L5TA 1VQ7A 1PH7A 2K5HA 3JAMi 2JA7G 4BBSG 4O0AA 1CSPA 2Q2TA 3G6EA 4DV0Q 1HR0L 4C3JH 1EWIA 4ME3A 4HJ7A 4JCVE 2KHJA 3A5ZB 4JV5Q 4KHPL 4A93H 4LUOA 1V9PA 4AIMA 1WCMH 4LFBL 2A19A 4KLKA 5GROA 4DUZQ 4DV1L 3GD7A 4LUVA 2K52A 2AWNA 1WOCA 3S17H 1PHJA 1HNXQ 1PH4A 2B63G 2Y0SG 1OXVA 5FLMH 4JBMA 1A8VA 1YJWA 1NE3A 4DR3L 1VQHA 4YHHQ 3IRBA 1VQDA 3ZJYC 1PH5A 2KENA 2E5LQ 5BR8Q 3TEHB 3HOZH 2F3IA 3A74A 4YWKA 4DV4Q 1Q81C 3CCLA 2V1CC 5ELOA 4DAMA 1IL2A 4AQYQ 2NN6I 2LXJA 5JEAJ 3S1NH 1E24A 3F2CA 1XPUA 5IWAQ 2AHOB 4HJ8A 2VUMH 1U0LA 3CC4A 3STBC 3CCEA 1O7IA 1UEBA 1YZ6A 4DR1Q 3M7NA 4JOIA 5M5XH 5IP9H 4BY7H 1XMQQ 3BU2A 3U58A 1FJGL 3RN5A 2DUDA 3RZOH 1T9HA 4JI0Q 2IX0A 5H1SE 4BA1I 1VQJA 3CMEA 1XTDA 4R4OA 4IOAA 4A3DG 4IOCA 1OXSC 5BR8L 4JI6Q 5AJ3L 4X66L 5IE8A 3PV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K14 A;  2BH8 A;  3UE0 A;  4HIO A;  5JJL A;  1YEZ A;  1JJ2 A;  5LMU L;  3GTM H;  1HNW Q;  1QZH A;  2MO0 A;  3M3Y H;  3M4Q A;  2ZM6 Q;  4UP9 A;  2VL6 A;  3S14 H;  3CF5 A;  4DKA C;  4LF9 Q;  1N36 L;  1D8L A;  2Z0S A;  1K3R A;  4BY1 G;  1OTC A;  4LF6 L;  1KRT A;  1VQK A;  4GOP C;  4BY1 H;  4A3B G;  5K36 G;  4DV3 Q;  1N34 L;  3E0E A;  2IHE A;  2UUA Q;  2KHI A;  1Z9F A;  2K5N A;  2MNA A;  3S1R H;  2XGT A;  1NY4 A;  1KQS A;  1JT8 A;  3NEL A;  2JEB I;  2I5L X;  1Y14 B;  2R7D A;  3CPF A;  3H15 A;  4JI3 Q;  4DV0 L;  1K9M C;  1HR0 Q;  4JI2 Q;  5C44 G;  4DR7 L;  1QUQ A;  1SN8 A;  2H5X A;  4GOP A;  4WJ4 A;  4C3I H;  3AQQ A;  3K81 C;  5E7N A;  2B3G A;  2AWO A;  2QEX A;  1AE3 A;  4A3M H;  1HNW L;  5C3E H;  4UP8 A;  4A3K G;  4LF5 Q;  5HY6 A;  2UXC Q;  4BY7 G;  4LF9 L;  2AMC B;  3GTG H;  4A3C G;  2UUB Q;  2OTL A;  2VY3 A;  3UE1 A;  3A5U A;  4GKK Q;  4DR3 Q;  5IP9 G;  2OQ0 A;  2R92 H;  1WJJ A;  4K0K Q;  1E3P A;  3HKZ G;  5ELN A;  1PH2 A;  4QGU A;  3OTO L;  3HOX G;  2F4V Q;  4JC0 A;  1YNX A;  2JQO A;  3I7F A;  2UU9 Q;  2R93 H;  1UE7 A;  4DV4 L;  1Q1B A;  1SMX A;  3I2Z A;  3L2P A;  2R93 G;  4JI5 Q;  3S15 H;  1OXU A;  3PUZ A;  4XTC S;  1RIP A;  1YHQ A;  2WB1 G;  4A3J G;  1PVO A;  5LMN L;  2UXB L;  4JI8 Q;  1KXL A;  4LF4 L;  3PIP A;  3EN2 A;  4GNX C;  3S1Q H;  5C0X I;  2HHH Q;  4P72 A;  4DR1 L;  2PNH A;  1E7Z A;  3U4V A;  5C4X G;  4LFC Q;  2K50 A;  4IO9 A;  1FGU A;  2F52 A;  4LF5 L;  2VNU D;  3AFP A;  5C0X G;  2YTX A;  1NJI C;  3F8T A;  1PH6 A;  1GM5 A;  4IPD A;  1YIJ A;  3GTL H;  2YV5 A;  4B3R L;  1XMO Q;  1HZC A;  3I4N G;  1EQR A;  1XNQ Q;  4A3L G;  4GS3 A;  3ULL A;  2KBN A;  1HZA A;  4IPG A;  2RF4 A;  3STB D;  1IXR A;  4IJH A;  4APV A;  2CWP A;  4GNX B;  3W1B A;  1NMF A;  3RR5 A;  4A3E G;  2BH2 A;  3PUW A;  3FHW A;  4NXM L;  1EIY B;  3W5O A;  2ATW A;  3M4P A;  4JI5 L;  5LMU Q;  4OON A;  1EFW A;  2A1A A;  3E9I A;  2VQF L;  1N9W A;  3RN2 A;  2YU9 H;  2ZTE A;  4LFA L;  5IP7 G;  3S24 A;  4L5R C;  2HQL A;  4B3T Q;  2NZO A;  1B8A A;  1GD7 A;  4PG3 A;  3EIV A;  3I55 A;  3G71 A;  3CCM A;  4A3F H;  1QZG A;  3NEM A;  4LF6 Q;  1TWF H;  2JEA I;  3H0G G;  2RCN A;  4YCV A;  3CC7 A;  1HNX L;  4P75 A;  3DLL A;  3KJO A;  1VQL A;  1HR0 W;  1NTG A;  4JI7 L;  4R4T A;  2UUC Q;  2IY5 B;  1IBK Q;  4QQB X;  3G48 A;  3K7A H;  3HKS A;  3KDF A;  3HKZ E;  4JI2 L;  3D31 A;  1VQA A;  4X64 L;  4QIW E;  1KIX A;  3VDY A;  3TRE A;  1JB7 A;  4YY3 Q;  1VQP A;  2Q2I A;  3MXN B;  4C2M H;  2JA5 G;  3E9H A;  3HOY G;  3I4O A;  4A3D H;  1DGS A;  4A93 G;  3KYH C;  2I5H A;  2E2H H;  1C9O A;  4QL5 A;  3PSI A;  1YIT A;  1AH9 A;  4P73 A;  3KFU A;  2N78 A;  1EQQ A;  5GAH C;  1N32 Q;  4B3S L;  3PO3 H;  2NVX H;  1WCM G;  2WFW A;  4LFA Q;  1CSQ A;  3M4O H;  4LF8 L;  4HJA A;  3CCR A;  2ZTC A;  3AFQ A;  4KI0 A;  5C4X H;  4IPC A;  1H95 A;  1L1O C;  2YTV A;  1CKN A;  1SFO H;  4OWT B;  1A63 A;  3OTO Q;  1XMQ L;  1HJP A;  1J6Q A;  1E1O A;  4DV2 L;  4R4C A;  1LM0 A;  1KAW A;  1FL0 A;  1VQN A;  1Q86 C;  4JI0 L;  1S3O A;  3J80 c;  3GTQ H;  2PQA B;  1BBW A;  3KLW A;  4POF A;  3CCS A;  4LNQ A;  1KHI A;  2PI2 E;  3J81 c;  1I6H H;  4WJ3 M;  4FDB A;  4RMF A;  4X62 L;  3T1H L;  2R7Z G;  3J80 i;  2Q2H A;  4JV5 L;  1D7Q A;  3HOZ G;  1K83 H;  5GAD C;  3S2D H;  3AYH B;  3PGZ A;  1HZ9 A;  2Z6K A;  4UP7 A;  2E8G A;  1VQ8 A;  3F2D A;  4DV6 Q;  1YHA A;  4LWC A;  3TS0 A;  4UY8 C;  5IY0 A;  2ZTD A;  4DR5 Q;  1YBY A;  5M3F G;  2FXQ A;  3K7U C;  2R6G A;  3K80 C;  1C7Y A;  2ZM6 L;  1N32 L;  5C3E G;  4DR2 L;  1J5E Q;  4R4I A;  1B7Y B;  2UXD L;  2GVA A;  3U50 C;  2Q2U A;  3I56 A;  1VQM A;  4B3R Q;  1KL9 A;  2CQO A;  2OCE A;  2HT1 A;  3CXC A;  4TVA B;  4RG1 A;  3GDE A;  2IT1 A;  4ALP A;  1OXX K;  5IYD H;  4DPG A;  4DR6 L;  2I0Q A;  1XNR L;  2RHQ B;  1Q82 C;  1N33 Q;  4A76 A;  2D0O A;  1I94 L;  1BBU A;  3H3V H;  2ZJP A;  2ZJR A;  5IWA L;  3CCV A;  4GKJ L;  1AE2 A;  4A4I A;  4OO1 I;  1Q1E A;  2YTY A;  4JG2 A;  1YVC A;  1K0R A;  2MQH A;  4B3M Q;  3PO3 G;  1VS0 A;  4DR5 L;  3RLF A;  3KF8 B;  3A0J A;  4LUZ A;  5IYB H;  3S1M H;  3ERS X;  1B70 B;  1L0W A;  1JJC B;  2UXD Q;  1PA6 A;  4X6A H;  1QVG A;  4GKK L;  4YWL A;  4JI1 L;  4PZ8 A;  3TQY A;  1SLJ A;  4DV5 L;  1EYG A;  4DR4 Q;  1W2B A;  3PF4 A;  1YHB A;  1E1T A;  4LF7 Q;  1MKH A;  1KC8 C;  3KDF B;  4A3L H;  2KCM A;  4X66 Q;  3J7A 5;  2CCZ A;  4JYA L;  2BA1 A;  4YWM A;  3B6Y A;  2NZH A;  1Y1W G;  4H02 A;  3LGJ A;  4BXX G;  1XPR A;  4GNX A;  1LUZ A;  4NB3 A;  5FJ8 H;  1Q46 A;  4HIM A;  2UXB Q;  1VQO A;  1VQF A;  4AYB E;  4LF4 Q;  2I5M X;  5IT9 c;  4A3F G;  4OX9 L;  3RLN A;  4IFD J;  5IP7 H;  4DUZ L;  2HHH L;  4A3C H;  4DUY L;  4L5S A;  1VQ9 A;  3GTP H;  1SRO A;  4QY7 A;  2UUA L;  2GN5 A;  4J15 A;  2WAQ E;  3HOV G;  1VCI A;  2WAQ G;  4DK3 C;  3W1G A;  4DNI A;  3NBH B;  3U4Z A;  1XPO A;  3PO2 G;  3HOW G;  2JE6 I;  4JI1 Q;  4NXN Q;  3HOX H;  3FKI G;  5J3B A;  3HOW H;  2B29 A;  1UE1 A;  4BBS H;  4DR7 Q;  1FJG Q;  3SGI A;  1PV4 A;  3KJP A;  3D0F A;  5M3M H;  2C35 B;  1CKO A;  1NMG A;  1X9N A;  2BA0 A;  5HGQ A;  5FLX c;  4DV6 L;  2ASB A;  5LMN W;  3HOY H;  4DAY B;  1OLT A;  1Y1V H;  5IYC G;  1C0A A;  1OXT A;  1PYB A;  2UXC L;  1WI5 A;  5M5Y H;  4OX9 Q;  4JI4 Q;  4DUY Q;  5IYB G;  1L1O B;  4KHZ A;  3CCU A;  1IBM L;  2GVB A;  3GTJ H;  1TWA H;  3UDX A;  2UU9 L;  2CFM A;  2Y0S E;  1S40 A;  3S16 H;  1IBL L;  1XNR Q;  4PZ7 A;  5GAG C;  2UUC L;  3ER0 A;  2QGQ A;  3J7Z C;  4JBJ A;  1MJE A;  1K8G A;  3L7Z C;  5GAE C;  4Y7N H;  2N8N A;  2NVY H;  1UE5 A;  5LMN Q;  1JJG A;  1WYD A;  2K5V A;  1CKN B;  1WFQ A;  3M9B A;  3NEN A;  2R7Z H;  3BZC A;  2JA6 G;  1Y1W H;  1Q7Y C;  5JJI A;  1I5F A;  3CCJ A;  1CUK A;  4R4Q A;  1A0I A;  4DV1 Q;  4A3M G;  1VQ5 A;  3F2B A;  1X56 A;  3ULP A;  1LYL A;  1UE6 A;  3FP9 A;  4B3M L;  1YJ9 A;  3PCO B;  4GN5 A;  4LW1 A;  4NPS A;  2JA8 G;  4A3G H;  3K0X A;  3TS2 A;  1N36 Q;  1HNZ Q;  1Z47 A;  3OYY A;  1MJC A;  4OO1 G;  3H0G H;  4JBK A;  3ICE A;  1X55 A;  4P74 A;  1VQC A;  3CAM A;  1XMO L;  1VQE A;  2N3S A;  3CMA A;  1L2F A;  4DV7 L;  4A3I G;  1M1K C;  4EQ5 A;  2JK8 A;  3RNU A;  1P8L A;  3CP0 A;  2EQS A;  1PH1 A;  2D0P A;  1Q8K A;  2PQA A;  5M5W H;  1TWG H;  4JYA Q;  3FKI H;  3AEV A;  5M3M G;  3CD6 A;  1SE8 A;  4UPA A;  5IYD G;  1UWV A;  3CQZ H;  4MTN A;  4AQY L;  1PH8 A;  1X3F A;  1CKM A;  3Q8D A;  3BZK A;  4PZ6 A;  4X62 Q;  4HID A;  3T1H Q;  4BBR H;  4JBW A;  1R9T H;  1XJV A;  2OTJ A;  4A3J H;  4HJ9 A;  2Z6K C;  4X65 L;  4IFD G;  4B3T L;  3KF6 A;  1IYJ B;  2D62 A;  3H3V I;  1Y1V G;  3GO5 A;  4EX5 A;  2B63 H;  1JMC A;  3HFZ B;  3S2H H;  4XIG S;  4A3B H;  2VS1 A;  3I4M H;  4IFD I;  3PF5 A;  2VZA A;  2MO1 A;  2UUB L;  1VQI A;  2R7F A;  1HNZ L;  3PIO A;  1M90 C;  1GVP A;  1VQG A;  2HIX A;  2WP8 J;  3JC6 6;  4NXN L;  3J81 j;  1X3G A;  1X65 A;  1I50 H;  2XTI A;  2ES2 A;  3L0O A;  4A3E H;  1YI2 A;  1A62 A;  2MFI A;  1V43 A;  4L5Q A;  5EAY A;  2F4V L;  4YY3 L;  5C44 H;  1QVF A;  5AJ3 Q;  3I4N H;  1G51 A;  1Q12 A;  1HZB A;  3K8A A;  2A8V A;  2K4K A;  1YJN A;  4DR6 Q;  1V1Q A;  1EOV A;  1PYS B;  1X3E A;  5JJK A;  4A3G G;  1N33 L;  4QJF A;  1QVC A;  3CPW A;  1I94 Q;  2ALY B;  4BXX H;  2OWO A;  4B3S Q;  1X6O A;  3ULJ A;  4JI8 L;  3GTO H;  3HOU H;  1RL2 A;  3UDF A;  2DGY A;  4X65 Q;  2ID0 A;  1KD1 C;  4LF8 Q;  2YYZ A;  3JAM c;  2QA4 A;  2VQE Q;  4GKJ Q;  4JI4 L;  2VUM G;  4TQU S;  4YCW A;  1VQ4 A;  1EIF A;  5M3F H;  2KCT A;  2WB1 E;  3KF6 B;  4DV3 L;  4LFC L;  1N34 Q;  3HOV H;  4DV2 Q;  3RZD H;  2EXD A;  1K73 C;  4GN4 B;  2JA9 A;  1HH2 P;  2N49 A;  2PI2 A;  3WWV A;  2E2I H;  1IBL Q;  2R92 G;  4GN3 B;  2NN6 G;  4YHH L;  4IJL A;  4JI3 L;  1IZ6 A;  1JE5 A;  3CC2 A;  3CCQ A;  1P16 A;  2OQK A;  1XNQ L;  1VQB A;  2E5L L;  4YCU A;  3PUY A;  3T1Y Q;  4BBR G;  4POG A;  1ASZ A;  2K75 A;  3DM3 A;  4NXM Q;  2JA7 H;  1EUJ A;  3UDG A;  1PH9 A;  4O2D A;  4A75 A;  5GQO A;  2VQF Q;  2IHF A;  1U5K A;  2CWA A;  1G29 1;  3M85 A;  3EBE A;  5C4J H;  5JEA G;  4DR2 Q;  5IYC H;  1N8R C;  1J5E L;  3PUX A;  4P71 A;  4JOI C;  1TWH H;  2CKZ B;  1FVI A;  1S72 A;  2LXK A;  2VQE L;  1TWC H;  4MNO A;  2HIV A;  4GOP B;  2ZJQ A;  1QUQ B;  4K0K L;  3UDI A;  3I4M G;  2IX1 A;  2VW9 A;  4HJ5 A;  4DV7 Q;  5C0X J;  1PH3 A;  4C3H H;  5FLM G;  4R1J A;  3MEF A;  3BJU A;  4GLV B;  4Y52 H;  2RHS B;  4OWX B;  1LTL A;  4GLX A;  4JI7 Q;  4OXP A;  1IBK L;  1E22 A;  2NVQ H;  1SRU A;  1W3S A;  4BA2 I;  2E2J H;  1X54 A;  3PUV A;  4AYB G;  4X64 Q;  4GLA C;  1PFS A;  2JA6 H;  4JI6 L;  4KHP Q;  1BKB A;  3RLO A;  1GKH A;  3T1Y L;  3HOU G;  1L1O A;  4MZ9 A;  3OW2 A;  4LFB Q;  3F1Z A;  2JJQ A;  5FJ8 G;  4A3K H;  3TRZ A;  4IPH A;  2EIF A;  2JA8 H;  3GTK H;  1MIU A;  2AKW B;  1BVS A;  4DK6 C;  4HIK A;  1VQ6 A;  1K8A C;  1GO3 E;  1I3Q H;  3KOJ A;  3J81 i;  1ASY A;  4OWW B;  1NBW A;  1KRS A;  3CW2 C;  5DLQ E;  4PMW A;  4DV5 Q;  4DR4 L;  4A3I H;  1G6P A;  2LSS A;  4LF7 L;  3G4S A;  1IBM Q;  1SR3 A;  4AH6 A;  2L15 A;  3PO2 H;  2PMZ E;  2NVT H;  1TXY A;  2JA5 H;  4L5T A;  1VQ7 A;  1PH7 A;  2K5H A;  3JAM i;  2JA7 G;  4BBS G;  4O0A A;  1CSP A;  2Q2T A;  3G6E A;  4DV0 Q;  1HR0 L;  4C3J H;  1EWI A;  4ME3 A;  4HJ7 A;  4JCV E;  2KHJ A;  3A5Z B;  4JV5 Q;  4KHP L;  4A93 H;  4LUO A;  1V9P A;  4AIM A;  1WCM H;  4LFB L;  2A19 A;  4KLK A;  5GRO A;  4DUZ Q;  4DV1 L;  3GD7 A;  4LUV A;  2K52 A;  2AWN A;  1WOC A;  3S17 H;  1PHJ A;  1HNX Q;  1PH4 A;  2B63 G;  2Y0S G;  1OXV A;  5FLM H;  4JBM A;  1A8V A;  1YJW A;  1NE3 A;  4DR3 L;  1VQH A;  4YHH Q;  3IRB A;  1VQD A;  3ZJY C;  1PH5 A;  2KEN A;  2E5L Q;  5BR8 Q;  3TEH B;  3HOZ H;  2F3I A;  3A74 A;  4YWK A;  4DV4 Q;  1Q81 C;  3CCL A;  2V1C C;  5ELO A;  4DAM A;  1IL2 A;  4AQY Q;  2NN6 I;  2LXJ A;  5JEA J;  3S1N H;  1E24 A;  3F2C A;  1XPU A;  5IWA Q;  2AHO B;  4HJ8 A;  2VUM H;  1U0L A;  3CC4 A;  3STB C;  3CCE A;  1O7I A;  1UEB A;  1YZ6 A;  4DR1 Q;  3M7N A;  4JOI A;  5M5X H;  5IP9 H;  4BY7 H;  1XMQ Q;  3BU2 A;  3U58 A;  1FJG L;  3RN5 A;  2DUD A;  3RZO H;  1T9H A;  4JI0 Q;  2IX0 A;  5H1S E;  4BA1 I;  1VQJ A;  3CME A;  1XTD A;  4R4O A;  4IOA A;  4A3D G;  4IOC A;  1OXS C;  5BR8 L;  4JI6 Q;  5AJ3 L;  4X66 L;  5IE8 A;  3PV0 A; 
#chains in the Genus database with same CATH topology
 1CT1 D;  5JJL A;  3GTM H;  5LMU L;  2R7Z B;  5D14 A;  5A2Q E;  3DXJ C;  3MXG A;  2EJF C;  3V05 A;  1N36 L;  2G9H D;  1K8M A;  4BY1 G;  3RD4 A;  1OTC A;  1KRT A;  5K36 G;  4A3B G;  4DV3 Q;  3KLS A;  3E0E A;  2UUA Q;  3D4D A;  2K5N A;  3HG9 A;  1TVX A;  2FFK B;  2I5L X;  3FRP B;  3WDN A;  2F0Q A;  1A3T A;  2ICE C;  5C4J B;  2EPB A;  2SNM A;  2H5X A;  2L11 A;  4R8N A;  1XYI A;  4C3I H;  5IGB A;  1HRJ A;  4B9W A;  1JOR A;  5C3E H;  4UP8 A;  5C4H A;  4K8J A;  3E6Z X;  4BY7 G;  1D5Z C;  4LF9 L;  4K2L A;  4X3U A;  4DR3 Q;  5CBE E;  1ET6 A;  5IP9 G;  4HR7 B;  4A3I B;  2XVS A;  3HOX G;  1IW7 D;  4F88 A;  3I2Z A;  3L2P A;  1ZYR C;  2JA8 B;  4WOR A;  4JI5 Q;  3PUZ A;  5E4W C;  1CA5 A;  2UXB L;  3SK6 A;  4OEM B;  4LF4 L;  3PIP A;  1HA6 A;  3EN2 A;  3C1E A;  1G2S A;  5E1F A;  2A74 C;  2ZXR A;  3GTJ B;  4RH1 A;  4P72 A;  4DR1 L;  1SFO B;  5C4X G;  5FO9 B;  1FGU A;  2A6E D;  2F52 A;  2VNU D;  1K28 A;  3SDZ A;  1GM5 A;  1LT5 D;  4C3J B;  2YV5 A;  4RFB A;  1WTX A;  1GUW A;  1EQR A;  4KKT A;  1HZA A;  2BDO A;  3W1B A;  1NMF A;  3VYU A;  1X32 A;  4UDU C;  2A1A A;  1ET9 A;  2WAC A;  3RN2 A;  2F0I A;  5IP7 G;  3GTP B;  2NZO A;  2QKI C;  3EIV A;  3PMF A;  1TWF H;  3BS1 A;  3KUP A;  1F9P A;  1F77 A;  2RCN A;  3CC7 A;  5AFW A;  2IWH A;  2NBF A;  2HDL A;  3KJO A;  2AUK A;  2NN6 H;  1M8A A;  4K8I A;  3HKZ E;  4RH6 A;  3D31 A;  1O78 A;  4QIW E;  1KIX A;  4HMI A;  3VDY A;  3TRE A;  5EPK A;  2Z4H A;  2Q2I A;  2OT2 A;  3FPP A;  3E9H A;  2NTS A;  4KY7 A;  5J1Z A;  2F0O A;  2XRS D;  4QL5 A;  2R3Z A;  5A2Q L;  1KTK A;  1SYD A;  5DM7 3;  3T16 A;  4Y7N B;  3M4O H;  2CVR A;  1Q8I A;  4HJA A;  4LF8 L;  5JEA H;  2YTV A;  1A3U A;  1WTW A;  3GV3 A;  1A63 A;  2ZT9 C;  3C2P A;  1XMQ L;  4G4K A;  2K1B A;  4DV2 L;  3SK4 A;  4IZ8 A;  2PQA B;  1BBW A;  3CCS A;  1KHI A;  2CH4 W;  2F0U A;  5CYU A;  4ZRZ A;  1BF4 A;  4JV5 L;  1D7Q A;  3HOZ G;  1NUC A;  4UP7 A;  3ZYY X;  4QB4 A;  1VQ8 A;  5IGD A;  2NZ1 D;  1FD7 D;  1I4Q A;  2ZTD A;  1SND A;  2ZM6 L;  5C3E G;  1B7Y B;  4F8M A;  2Q2U A;  1JOQ A;  4B3R Q;  1KL9 A;  2CQO A;  4Q5V A;  3K58 A;  3GDE A;  1EZ8 A;  1OXX K;  5C3X A;  4DPG A;  1BNZ A;  4DR6 L;  2IJ0 A;  2D0O A;  1BBU A;  1A6X A;  1S4Z A;  3S1N B;  2ZJP A;  1BCP B;  2DJG C;  2ZJR A;  4GKJ L;  3HEJ A;  1HTP A;  2XN9 C;  4HCS A;  4CGY B;  4B3M Q;  1VS0 A;  2XNA C;  3A0J A;  1L0W A;  3ND8 A;  3J80 L;  3Q23 A;  1QVG A;  4GKK L;  1PMR A;  4JI1 L;  1SLJ A;  1QB5 D;  1W2B A;  4FP5 D;  2QDB A;  4TSS A;  3I91 A;  2KCM A;  3D4W A;  1H9M A;  5CR3 A;  3DUZ A;  4DXG A;  1GXD C;  4IQZ A;  3E3X A;  4BXX G;  2F0E A;  2A69 C;  2CW0 C;  1LUZ A;  4DK1 A;  4GNX A;  1Q46 A;  4HIM A;  1LTR D;  4U67 3;  2K32 A;  2I5M X;  5IT9 c;  3Q0A A;  4KV6 A;  5IP7 H;  3K59 A;  1G8Z D;  1SRO A;  3N6R A;  2GN5 A;  3NXW A;  5C6A A;  2WAQ E;  3Q22 A;  4DK3 C;  4OO1 H;  3A54 A;  4DNI A;  1XPO A;  1DON A;  5CBA E;  3HOW H;  3T53 B;  4FHC A;  4BBS H;  3R93 A;  5FLX E;  4DR7 Q;  2FMC A;  5M3M H;  1I4P A;  5FLX c;  2RDF A;  4ZLT F;  4DV6 L;  5LMN W;  2ASB A;  1Y1V H;  3FDT A;  1D5X C;  5JVH 3;  1SBB B;  5TSS A;  1IL8 A;  1KNE A;  1ONL A;  1WCM B;  1I50 B;  2KQ3 A;  3MZ5 A;  3CCU A;  2FIN B;  1FNV A;  1JE4 A;  4HMJ A;  1S5F D;  1PTO F;  1DM0 B;  3S16 H;  2B2U A;  1SNC A;  4CJ2 C;  5GAG C;  3NUC A;  3DHQ A;  4JBJ A;  1K8G A;  5CV8 A;  4FF2 A;  1O7L A;  3NEN A;  3M9B A;  4YIJ A;  1EY6 A;  1LYL A;  2E76 C;  3TS2 A;  1F9Q A;  1Z47 A;  3HOU B;  3OYY A;  5F2D A;  4OO1 G;  3ICE A;  1SYF A;  1X55 A;  3KK7 A;  4P74 A;  1XMO L;  2N3S A;  1EQT A;  1JB3 A;  1DXM A;  3QR8 A;  5M5W H;  4KJO A;  1TWG H;  3AEV A;  1ILQ A;  5M3M G;  3LWE A;  4N8X 1;  4A3K B;  1X3F A;  1CKM A;  1QZH A;  3C1F A;  1LTB D;  4JBW A;  1R9T H;  4X65 L;  4B3T L;  3KF6 A;  1IYJ B;  2OXP A;  4I7Z C;  3H3V I;  1HFG A;  4XIG S;  2HCI A;  2VS1 A;  3I4M H;  5DEH A;  2UUB L;  1ESR A;  2L0C A;  2R7F A;  2F0N A;  4NXN L;  2EYL A;  1X65 A;  1A62 A;  3NBI A;  1V43 A;  2WB1 B;  4YY3 L;  5C44 H;  4RWS C;  3I4N H;  1G51 A;  2PYK A;  3K8A A;  2A8V A;  1GUO A;  2F0G A;  4DF7 A;  1LAB A;  1N33 L;  3BDO A;  3P1H A;  4QJF A;  1UUP A;  5EJW A;  4BXX H;  2OWO A;  3ULJ A;  4JI8 L;  2DGY A;  2ID0 A;  4KY6 A;  1KLG D;  4JI4 L;  4TQU S;  4YCW A;  5I2Y A;  3KF6 B;  1I4H A;  4DV3 L;  1I6H B;  2MUY A;  3RZD H;  2LMC B;  1IBL Q;  1WVL A;  4IJL A;  4AYB B;  3CC2 A;  2L12 A;  1IHZ A;  1QWY A;  2WII B;  1A15 A;  1WTV A;  2EYP A;  2E5L L;  4POG A;  2F0J A;  4DN4 M;  2L55 A;  1LTT D;  4TKO B;  3UDG A;  3M3Y B;  1U4R A;  5GQO A;  2VQF Q;  1N8R C;  1G29 1;  3EBE A;  5C4J H;  5JEA G;  4DR2 Q;  3PUX A;  1TWH H;  5IIF A;  2VQE L;  5M5W B;  2VW9 A;  4DV7 Q;  5C0X J;  1PH3 A;  4C3H H;  1GHJ A;  2SDF A;  2NYZ D;  2MP1 A;  4OXP A;  1IBK L;  4BA2 I;  4DU9 A;  4AYB G;  1NNX A;  4G7O C;  4X64 Q;  4U68 A;  4JI6 L;  1I4X A;  4G57 A;  2B2Y C;  2JA8 H;  1BVS A;  2F0F A;  5KYI A;  1K8A C;  4QUC A;  3CW2 C;  2K7V A;  3I72 A;  1Z7T A;  2L15 A;  2XWB B;  1BDO A;  2PMZ E;  2GA4 B;  2NVT H;  2F0K A;  1QE6 A;  1CZG A;  2JA5 H;  4O0A A;  1CSP A;  3EA6 A;  3X3N A;  4C3J H;  3NTH A;  2KHJ A;  1LTG D;  4LUO A;  3TN2 A;  4LUV A;  4JW0 A;  4KN7 C;  5K36 H;  4H0L C;  1STY A;  1PHJ A;  2Y0S G;  1OXV A;  4C3H G;  1A8V A;  4DR3 L;  1VQH A;  5FO7 B;  4YHH Q;  1DOM A;  5EBD A;  3DEO A;  3IRB A;  4JVZ A;  1EYC A;  2KEN A;  5FO8 B;  4S3S A;  3HOW B;  2F3I A;  3A74 A;  2HUG A;  2BE5 D;  1HPC A;  2V1C C;  1LV9 A;  1I4R A;  4AQY Q;  1C48 A;  2XSC A;  5JEA J;  3S1N H;  1U4P A;  2KED A;  5D3I B;  3STB C;  2K28 A;  3VR3 A;  2EY1 A;  2X69 A;  2B2W A;  3MVV A;  5IP9 H;  1XMQ Q;  4IUU A;  1Y1W B;  2SEB D;  5H1S E;  5KND A;  5C4Z A;  1UNS A;  3PIP 3;  1BBX C;  2RSO A;  2KVM A;  4A3D G;  2O2L D;  5K5P A;  4X66 L;  5IGC A;  5IE8 A;  3UE0 A;  1YEZ A;  3K5M A;  1JJ2 A;  1BQQ T;  1H9S A;  1V1O A;  3L9A X;  4UP9 A;  1F2Z A;  3DWP A;  3CF5 A;  4DKA C;  1B44 D;  1LT3 D;  5EKI A;  1WD0 A;  1D8L A;  4BY1 H;  4GOP C;  2I07 B;  2D2C C;  2XGT A;  1TR5 A;  4CBV A;  2R7D A;  4JI3 Q;  5FOB B;  5JJZ A;  1K9M C;  3CRL C;  4KD3 A;  3LNN A;  4KKS A;  4ZCK A;  1SNM A;  3PO2 B;  3AB9 A;  3K81 C;  1KAB A;  2EXZ A;  2B3G A;  2AWO A;  1NR4 A;  1L0X B;  1CZW A;  1Y8O B;  4A3M H;  2UXC Q;  5ELB A;  2AMC B;  3GTG H;  1KDC A;  2VUM B;  2E2J B;  3UE1 A;  4GKK Q;  3GTQ B;  4CDF C;  3Q6S A;  4KD4 A;  1WJJ A;  2Q8R E;  2R92 H;  5ELN A;  2NTT A;  3D6C A;  2K01 A;  5LL6 X;  1EYD A;  2MGS A;  1TQO A;  1GUN A;  5BN5 A;  2R93 H;  2VB2 X;  1I6V C;  4DV4 L;  4ZYS A;  5ELF A;  3G7L A;  1OXU A;  1J8I A;  1STB A;  1JWU D;  3MXU A;  1RD9 D;  3DM1 A;  1K3B C;  3S1Q H;  1CQF A;  3TZU A;  1E7Z A;  4LFC Q;  1V1P A;  2K50 A;  4L8J A;  4OEL B;  1LTA D;  1DJR D;  1Q3L A;  4RGT A;  3NP8 A;  3MC0 B;  3HZX A;  1CK1 A;  3F8T A;  1V1P B;  4B3R L;  4FXD A;  1SYG A;  3I4N G;  1SE3 A;  4APV A;  4IJH A;  3RR5 A;  2JSO A;  4NXM L;  3K7A B;  3LX0 A;  3S1Q B;  4JI5 L;  1A2U A;  1RDP D;  1UAP A;  1N9W A;  2YU9 H;  4LFA L;  2KEE A;  2H1E A;  3TBI B;  3S24 A;  2HQL A;  1T5X D;  1BR9 A;  4PG3 A;  1GD7 A;  4A3G G;  3ONA B;  4A3F H;  4LF6 Q;  2J7Z A;  2JEA I;  3C3L A;  4YCV A;  3HS0 C;  4EQP A;  1HNX L;  4MTK A;  4IUQ A;  1NTG A;  4JI7 L;  4EQN A;  1KDA A;  3K7A H;  3HKS A;  1VQA A;  3I4N B;  1E2Z A;  3SXH A;  1B53 A;  3I4M B;  3S2H B;  4A3D H;  3I4O A;  3KFU A;  4Z9C B;  4QUF A;  3SE0 A;  5GAH C;  1WCM G;  4LFA Q;  4FF3 A;  3A8I E;  2EYJ A;  2EE1 A;  3AFQ A;  3H09 A;  3QJY A;  2N88 A;  4E6I A;  1E1O A;  4N9P A;  2ENB A;  1LM0 A;  1QNK A;  1FL0 A;  4R4C A;  4F87 A;  1Q86 C;  2L5T A;  3RMH A;  3KLW A;  4LNQ A;  1SAP A;  4WJ3 M;  2PI2 E;  1F9R A;  1I6H H;  1PTO B;  3BZD B;  4KTA A;  5M3F B;  1TII D;  5GAD C;  1E2V A;  2R61 A;  2E8G A;  4FHG A;  3O13 A;  4DV6 Q;  1YHA A;  1JOO A;  4LWC A;  5M3F G;  2FXQ A;  3K7U C;  2R6G A;  1C7Y A;  2K6A A;  1J5E Q;  2GVA A;  4RH0 A;  2OCE A;  4RG1 A;  2IT1 A;  5IYD H;  2ICI A;  3P75 A;  1BXT A;  1Q82 C;  3AMU A;  2IPK D;  2TMP A;  1XXG A;  2E75 C;  3EQL C;  4A76 A;  5ELE A;  2KCN A;  3S14 B;  1TS5 A;  5IWA L;  1YNJ D;  2G9D A;  4A4I A;  4JG2 A;  4TRD A;  1F2Y A;  3PO3 B;  3K6O A;  5CGK A;  4DR4 Q;  1V8Q A;  1JOK A;  4A3D B;  1QG7 A;  1E1T A;  4LF7 Q;  1KC8 C;  3KDF B;  2NVT B;  3S9W A;  3J7A 5;  2CCZ A;  1PDQ A;  4PQX A;  4DAP A;  4C1N K;  3LGJ A;  5J39 A;  4NB3 A;  1SMY D;  1VQO A;  1VQF A;  4AYB E;  1DD2 A;  5COR A;  3GV6 A;  1WD1 A;  2JA5 B;  4IFD J;  4DUZ L;  2IL8 A;  2HHH L;  3IAY A;  4DUY L;  1EU4 A;  1VQ9 A;  1TWF B;  4QY7 A;  3IKJ A;  5CV7 A;  2UUA L;  5T1G A;  3GTK B;  3HOV G;  3NBH B;  3PO2 G;  1W6J A;  4JI1 Q;  4NXN Q;  5J3B A;  3QG1 A;  3HOZ B;  4HED A;  2B29 A;  1FJG Q;  3SGI A;  1CHQ D;  2EY6 A;  3D0F A;  4KN4 C;  2C35 B;  3OIP A;  1C0A A;  4FXK C;  4RKB A;  1PYB A;  3MEH A;  4IFD H;  2Q8T A;  2Z8L A;  2J0T D;  1H9S B;  4JI4 Q;  2EOT A;  4DUY Q;  5IYB G;  1GJX A;  4RHS A;  2PZU A;  5DNF A;  4NMZ A;  3BYT B;  1FNW A;  5ISR A;  4H44 C;  1IBL L;  1XNR Q;  2V4D A;  5A35 A;  3J7Z C;  3L7Z C;  1HA5 A;  3T4A C;  5LMN Q;  1WYD A;  1CKN B;  2Z9H A;  3BZC A;  1Y1W H;  1Q7Y C;  1SYE A;  1I5F A;  1F2M A;  2AUJ D;  4R4Q A;  1A0I A;  4WJW A;  4DV1 Q;  2F0W A;  1R4Q B;  4A3M G;  2P5Z X;  3FP9 A;  1JIC A;  1YJ9 A;  4GN5 A;  4NPS A;  4JK1 C;  1I3Q B;  3K0X A;  1QOH A;  5NUC A;  1HNZ Q;  4RHR A;  3H0G H;  4JBK A;  1VQC A;  1CTM A;  3CAM A;  4DV7 L;  3S2D B;  4A3I G;  1J9O A;  2EQS A;  1SJH D;  4NKL A;  2F0S A;  3CD6 A;  4UPA A;  1G2T A;  5IYD G;  1UWV A;  1BO0 A;  3BVM A;  4PZ6 A;  4X62 Q;  3T1H Q;  2OTJ A;  1LT4 D;  4A3J H;  4CDD C;  2J4X A;  4IFD G;  4CHT B;  2MJ8 A;  3GO5 A;  2B63 H;  1JMC A;  3HFZ B;  4R9W A;  1EEF D;  4A3B H;  4MHE A;  5IOC A;  2PW7 A;  4X3K A;  2VZA A;  4FO2 A;  1HNZ L;  3J80 E;  3JC6 6;  2HIX A;  5G3L D;  1X3G A;  2B2V C;  2HQE A;  1Y8N B;  1YI2 A;  1WTP A;  2MFI A;  1QVF A;  3GTG B;  1H9R A;  5CC4 A;  2K4K A;  1YJN A;  1ZXT A;  4MN3 A;  1V1Q A;  5BN4 A;  4KK7 A;  1X3E A;  5G3L F;  1QVC A;  3BDL A;  2ALY B;  4X3S A;  1I94 Q;  3EJI A;  1GUT A;  3HOU H;  5M3M B;  4X65 Q;  1SNO A;  4LF8 Q;  3PIO 3;  1KD1 C;  3PQI A;  2VUM G;  1VF5 C;  2QDL A;  1VQ4 A;  4FVM A;  3KF8 A;  2JA9 A;  1HH2 P;  4NW2 A;  2VB3 X;  2R92 G;  2EYF A;  2TSS A;  2MHV A;  4JI3 L;  1P16 A;  1DYQ A;  1VQB A;  4YCU A;  3T1Y Q;  3NE5 B;  1ASZ A;  3DM3 A;  1ZEQ X;  3ERQ A;  2IHF A;  1U5K A;  1B1Z A;  1D1K A;  2RCF A;  5JAV A;  2L9H A;  2JA7 B;  4P71 A;  4JOI C;  1FVI A;  5M5Y B;  2RSN A;  1TWC H;  1T5E A;  4CDC C;  4GOP B;  1KAA A;  1RF2 D;  3UDI A;  3BVG A;  1Z6H A;  4R1J A;  2RHS B;  2EYO A;  3PUV A;  4B08 A;  2L1B A;  1PFS A;  1O7Y A;  1BKB A;  3NTK A;  5LHY 1;  1LT6 D;  3T1Y L;  3HOU G;  1L1O A;  3OW2 A;  4UAI A;  3F1Z A;  4LFB Q;  4NP5 A;  2N55 A;  5FJ8 G;  1IW7 C;  4A3K H;  3TRZ A;  2EIF A;  4K6D A;  4PV1 C;  3H91 A;  4HIK A;  4DK6 C;  1PFN A;  3KOJ A;  3J81 i;  1ZYR D;  3HP3 A;  1NBW A;  4IUR A;  2QW7 A;  4BS9 A;  5DLQ E;  4DV5 Q;  2LSS A;  5HUR A;  1IBM Q;  1RTO A;  2B39 A;  4QMG A;  1TXY A;  1PTO H;  3N52 A;  2A6H C;  3QWN A;  3JAM i;  5CV4 A;  2RKS A;  3NSW A;  4DA2 A;  4ZKC B;  2Q2T A;  2QEJ C;  1XTC D;  3TSS A;  4JCV E;  4ZKB B;  4AIM A;  1STG A;  4LFB L;  3H94 A;  5C5L A;  1WOC A;  3NK9 A;  1HNX Q;  1PH4 A;  2B63 G;  3J7A V;  1SYC A;  2RVL A;  3OPO A;  3OW7 A;  1NE3 A;  1JWS D;  1VQD A;  1EY8 A;  5BR8 Q;  1HFN A;  3TEH B;  3HOZ H;  4DV4 Q;  3CAN A;  5I6W A;  4DAM A;  1IL2 A;  1SNQ A;  1E24 A;  4M8A A;  1U0L A;  1B50 A;  3CCE A;  3I73 A;  1UEB A;  3NQT A;  4DR1 Q;  5M5X H;  1B3A A;  2EJM A;  5I6Y A;  3BU2 A;  2KJX A;  2A68 C;  2DUD A;  4KJN A;  1B3Q A;  1ILP A;  3GTO B;  2OF1 A;  4NDX A;  2C9O A;  3L3O C;  3CME A;  4R4O A;  2I46 A;  1OXS C;  3I90 A;  5AJ3 L;  1BCP F;  3PV0 A;  2RA4 A;  1YNJ C;  1AZQ A;  3M4Q A;  2ZM6 Q;  2B2T C;  3NHH A;  5JVG 3;  1EWH A;  3CQZ B;  2Z0S A;  1K3R A;  4LF6 L;  3CKI B;  1VQK A;  4K6L A;  1N34 L;  1Y8P B;  2D5D A;  1Z9F A;  2MNA A;  1NY4 A;  1JT8 A;  2KHS A;  3A56 A;  3KLS X;  3NEL A;  1B9M A;  1STN A;  3H15 A;  4DV0 L;  2EYM A;  5IOD A;  4DR7 L;  1QUQ A;  1SN8 A;  5KEE A;  3AQQ A;  5E7N A;  1TY2 A;  3IFD A;  1JWM D;  1AE3 A;  2MPM A;  4A3K G;  4LF5 Q;  1R4P B;  4DNR B;  2VY3 A;  3A5U A;  3C46 A;  3R3O A;  4XT3 B;  2OQ0 A;  1E3P A;  3HKZ G;  4QGU A;  2B8G A;  5KIX A;  2F4V Q;  2JQO A;  4ZUI A;  2UU9 Q;  1UE7 A;  2NVY B;  5E3F A;  2R93 G;  1TU2 B;  1WTO A;  3DEP A;  3S15 H;  1WTR A;  4RKL A;  1RIP A;  2WB1 G;  4A3J G;  4FHF A;  1DOL A;  4RGO S;  3SEB A;  2BDN A;  1KXL A;  4KY5 A;  2SNS A;  4GNX C;  5C0X I;  2PNH A;  4HCE A;  3U4V A;  4QIW B;  3S1M B;  1QNU A;  1Y1V B;  3AFP A;  2XWJ B;  5C0X G;  5HGT A;  3GTL H;  2NB0 A;  1HZC A;  4OHJ A;  4ABN A;  3S15 B;  1XNQ Q;  5C4X B;  2KBN A;  3STB D;  2RF4 A;  4A3E G;  2DY7 A;  2BH2 A;  2CWP A;  2ATW A;  3M4P A;  1EFW A;  4A3J B;  3NWS A;  2ZTE A;  2R92 B;  4L5R C;  2F0L A;  2JXM B;  1QZG A;  3G71 A;  2QF7 A;  1LTI D;  1X3P A;  4P75 A;  3DLL A;  1PYW D;  1VQL A;  2PZT A;  3G48 A;  3KDF A;  3W3A A;  4JI2 L;  4X64 L;  4YY3 Q;  2EY5 A;  2K5Q A;  4C2M H;  3HOY G;  1PLF A;  4IUP A;  3KYH C;  2E2H H;  1C9O A;  4P73 A;  3VR4 A;  1SXT A;  1EQQ A;  1B9N A;  2K03 A;  4B3S L;  1N32 Q;  5I9P A;  2ZTC A;  1TY0 A;  4KI0 A;  1SNP A;  4IPC A;  5C0X H;  1L1O C;  3ND9 A;  1H95 A;  3MFY A;  1SFO H;  4OWT B;  3OTO Q;  1LTS D;  3A7A B;  4OGQ C;  2CH4 A;  2JP1 A;  4JI0 L;  1S3O A;  4PMB A;  3GTQ H;  3F2U A;  3D3R A;  4ZK9 B;  1K8O A;  4FDB A;  4LJZ C;  4RMF A;  2PO4 A;  4IUT A;  4O42 A;  3S2D H;  3AYH B;  3PGZ A;  4PMC A;  1GHK A;  4BY7 B;  4UY8 C;  5IY0 A;  3OHX C;  3DWQ A;  1YBY A;  3VA7 A;  4DR5 Q;  3K80 C;  1N32 L;  2WIN B;  1EQV A;  5J22 A;  4M1U B;  4A3G B;  2UXD L;  2Z1C A;  3AU7 A;  3I56 A;  4HTH A;  3K57 A;  4CJ0 B;  3CXC A;  4TVA B;  3A7L A;  1X3Q A;  2B2Y A;  5FLX L;  1U4L A;  1XNR L;  1TWC B;  2RHQ B;  3D8G A;  1AZP A;  1N33 Q;  3OWF A;  1I94 L;  3SK8 A;  1E0B A;  1IKM A;  5ELD A;  5EQ0 A;  3TME A;  1MHW C;  5JPM C;  3CCV A;  1G6Z A;  2KA7 A;  4OO1 I;  2YTY A;  1YVC A;  1K0R A;  3PO3 G;  5IYB H;  3KF8 B;  1QIL A;  1B70 B;  3BG3 A;  1JJC B;  3P7J A;  1JR0 D;  2UXD Q;  4X6A H;  2Y0S B;  4YWL A;  2K04 A;  4ZUJ A;  1YHB A;  1IKL A;  1IYU A;  3KBG A;  2F0T A;  1RKN A;  2BA1 A;  1Y1W G;  2NZH A;  4H02 A;  3WOF A;  5L37 A;  2A73 B;  5DAU A;  3UI2 A;  1ENA A;  4A3F G;  3SK5 A;  1D6E C;  3SR1 A;  4A3C H;  3MA2 B;  1U4M A;  3GTP H;  3VR5 A;  3TP6 A;  3JAM L;  2RBM A;  3GQB A;  1ML0 D;  1GOZ A;  1VCI A;  2WAQ G;  2EDG A;  3S1R B;  1MI2 A;  3U4Z A;  2WV6 D;  3HOX H;  1DZ1 A;  2D9U A;  4I7A A;  3M4Y A;  1PV4 A;  2F1M A;  4C3H B;  3HOY H;  4DAY B;  1OLT A;  1G91 A;  1SDF A;  5EBC A;  1VMP A;  5BN3 A;  3OSO A;  1WI5 A;  1L1O B;  1NR2 A;  3HOX B;  1IBM L;  4ZAI A;  3GTJ H;  1TWA H;  2IX3 A;  1FR3 A;  4PZ7 A;  2UUC L;  3HOV B;  3M4O B;  1AFP A;  5M5X B;  2O5I C;  2NVX B;  2NVY H;  1WFQ A;  2JA6 G;  4WFN 3;  3CCJ A;  1CUK A;  1S5C D;  4FXG C;  1VQ5 A;  2BCO A;  3ULP A;  4R8I A;  2DNC A;  1N36 Q;  3OOC A;  1PRT B;  5CV9 A;  1VQE A;  4CDE C;  3CMA A;  1L2F A;  3J7A F;  3RNU A;  3CP0 A;  4CKE A;  1PH1 A;  4P2C B;  2D0P A;  4JYA Q;  3FKI H;  2PNR C;  1YNN C;  4MTN A;  4AQY L;  4A3E B;  1LAC A;  3BZK A;  1XJV A;  4BBR H;  4Q0F A;  5KNB A;  3NTI A;  2D62 A;  3VYR A;  4EX5 A;  4XYQ A;  2ZXO A;  3MXP A;  1VDZ A;  5DM6 3;  4IFD I;  3PF5 A;  2MO1 A;  1NSN S;  3PIO A;  1M90 C;  1GVP A;  1VQG A;  2XTI A;  1I50 H;  4A3E H;  1FYC A;  4L5Q A;  5EAY A;  5AJ3 Q;  2PZW A;  4DR6 Q;  2HD3 A;  5JJK A;  1KNA A;  4OIJ A;  4RGM A;  5CV5 A;  3FMC A;  2E2H B;  2BOS A;  2F3W A;  1M4V A;  1RL2 A;  3UDF A;  4FF1 A;  3JAM c;  2RQX A;  2KCT A;  2WB1 E;  1PRT C;  2BE5 C;  2PPB C;  1L0Y B;  3HOV H;  4DV2 Q;  3VR6 A;  4GN4 B;  2N49 A;  2E2I H;  1B4O A;  2PI2 A;  1XWE A;  4KKU A;  4DK0 A;  4YHH L;  1IZ6 A;  3K0Y A;  2OQK A;  4BBR G;  4G7H C;  3ERO A;  4J6H A;  2JA7 H;  2F0D A;  1EUJ A;  1ICW A;  1QJO A;  2K05 A;  1TS4 A;  4A75 A;  4XXE A;  1PFB A;  1LLR D;  1R9T B;  2KUM A;  3M85 A;  1J5E L;  3E0J A;  2LXK A;  2HIV A;  5FLM G;  2G5D A;  1CI3 M;  2FJ2 A;  3MEF A;  3BJU A;  4GLV B;  4G7Z C;  4BBR B;  4JI7 Q;  1K0S A;  1E22 A;  2NVQ H;  1SRU A;  1W3S A;  2E2J H;  4V0B A;  4GLA C;  3A55 A;  4KHP Q;  3FEW X;  1SMY C;  4MZ9 A;  5D65 A;  2JJQ A;  5KRU A;  4IPH A;  2B2T A;  1I3Q H;  1ROD A;  3OWE B;  4XQQ A;  1GUG A;  1S5D D;  1PRT D;  1TS3 A;  2YU9 B;  2KEC A;  2B8F A;  2A68 D;  1A3V A;  4A3I H;  3G4S A;  4AH6 A;  4CKC A;  4RCN A;  1VQ7 A;  2Z6B A;  1PH7 A;  2JA7 G;  4BBS G;  1AEX A;  2F3V A;  3G6E A;  4DV0 Q;  1XX8 A;  4OL7 A;  2HCC A;  4ME3 A;  4HJ7 A;  4JV5 Q;  2DY8 A;  4KHP L;  3FVQ A;  4J1M A;  3I70 A;  1V9P A;  4FHD A;  1WCM H;  4DUZ Q;  4IUV A;  3GD7 A;  3HRZ C;  3OMG A;  2B63 B;  2AWN A;  3I4L A;  3H3V C;  4EVO A;  3S17 H;  2PMZ B;  4A3B B;  3S16 B;  3QOJ A;  5FLM H;  4UHV A;  4JBM A;  1YJW A;  1EFI D;  1STA A;  2NUC A;  4EQO A;  4X3T A;  1PH5 A;  1DOK A;  3QO2 A;  4HSV A;  4FYD A;  4YWK A;  4DXF A;  2LXJ A;  4N9T A;  1EZ6 A;  1XPU A;  1NAP A;  5FK9 C;  5IWA Q;  2VUM H;  3K5O A;  1SJE D;  3W2D A;  4ME5 A;  1IYV A;  4ULL A;  1O7I A;  4K5V A;  3M7N A;  2K5W A;  4JOI A;  4L63 B;  4LAA A;  3V96 A;  3X3M A;  4XQJ A;  3DWA A;  3U58 A;  3RN5 A;  2RDG A;  1H9K A;  2XIW A;  4PNY A;  3RZO H;  3FPU B;  5M9O A;  1CA6 A;  2E2D C;  3U9S A;  2F0P A;  3R2I A;  3MFG A;  2ZXP A;  4IOC A;  5BR8 L;  3S17 B;  4RCO A;  2A6H D;  2C5C A;  1EY7 A;  1QCB D;  2K14 A;  3V2T A;  2BH8 A;  4HIO A;  1HNW Q;  4XYO A;  2MO0 A;  3A8K E;  3M3Y H;  4DAV A;  2VL6 A;  3S14 H;  4LF9 Q;  2A6E C;  2F0H A;  1TWH B;  5IGF A;  4IUN A;  4L6T B;  2IHE A;  2KHI A;  3S1R H;  1KQS A;  2JEB I;  1Y14 B;  3CPF A;  1EU3 A;  3IL8 A;  1HR0 Q;  4JI2 Q;  5C44 G;  1AN8 A;  3FKI B;  4DFA A;  4GOP A;  1EY4 A;  1ZKO A;  4WJ4 A;  5JPN C;  3HOY B;  3IFT A;  2AQ2 B;  1EIG A;  2QEX A;  1HNW L;  3RZD B;  4HAE A;  1BOS A;  5HY6 A;  2FMM A;  1STH A;  2UUB Q;  2OTL A;  4A3C G;  1F2L A;  5KNC A;  3MHB A;  3E5S A;  4K9R A;  1O7Z A;  4K0K Q;  1PH2 A;  5COY A;  3OTO L;  1TWA B;  4JC0 A;  1YNX A;  2PQE A;  3I7F A;  4JPB W;  1Q1B A;  1SMX A;  3T13 A;  1SE4 A;  4XTC S;  1PVO A;  1YHQ A;  2EVB A;  5LMN L;  4JI8 Q;  1PTO D;  2X6G A;  2VXW A;  4ILW A;  2KOL A;  2HHH Q;  2M9V A;  3SHL A;  3K5L A;  4IO9 A;  4HSP A;  1KDB A;  4LF5 L;  1HUN A;  2B2W C;  3OMC A;  1JQY D;  2YTX A;  1NJI C;  4HN7 A;  1PH6 A;  3I3C A;  4IPD A;  1YIJ A;  1C8C A;  1B2T A;  1XMO Q;  2RDH A;  1A2T A;  4GS3 A;  3ULL A;  4A3L G;  1FJG L;  4IPG A;  4GNX B;  2HT1 A;  1IXR A;  4DAY A;  3QB3 A;  3PUW A;  3FHW A;  2Q8I B;  5KYL A;  1EIY B;  3W5O A;  1VMC A;  2O5J C;  2K5D A;  5IT9 L;  5LMU Q;  4OON A;  2VQF L;  3E9I A;  3H0G B;  4C3I G;  3WOE A;  3NPP A;  4B3T Q;  4CKB A;  1B8A A;  3I55 A;  5EPL A;  3CCM A;  3NEM A;  3KBX A;  1JC7 A;  3H0G G;  4J8Q A;  1HR0 W;  5EPJ A;  4R4T A;  5IGG A;  2UUC Q;  1IBK Q;  2IY5 B;  4QQB X;  1GUS A;  1SE2 A;  1RCV D;  5FKA C;  5JOB A;  3J81 L;  1JB7 A;  1VQP A;  2AQ3 B;  4ODG A;  3MXN B;  2JA5 G;  1DGS A;  1SEB D;  1TS2 A;  4H7B A;  2I5H A;  4A93 G;  3OIQ A;  3PSI A;  1YIT A;  1AH9 A;  2N78 A;  1K83 B;  2SOB A;  3PO3 H;  1RJT A;  2F03 A;  2NVX H;  2WFW A;  1CSQ A;  2O4X A;  4GZY C;  3CCR A;  5CV6 A;  5C4X H;  1CKN A;  5ELC A;  1HJP A;  1J6Q A;  2EY2 A;  1VQN A;  1KAW A;  4A93 B;  1S5B D;  3J80 c;  1D1I A;  4POF A;  4O1N A;  3J81 c;  2F0M A;  3CHB D;  3D4R A;  4X62 L;  3T1H L;  2R7Z G;  3J80 i;  2Q2H A;  3TDQ A;  1K83 H;  2LY7 A;  1HZ9 A;  2E2I B;  2Z6K A;  3F2D A;  3TS0 A;  2EZV A;  1H9J A;  4K2K A;  4DR2 L;  1UEA B;  4R4I A;  3U9O A;  3U50 C;  5EGT A;  1VQM A;  2EJG C;  5E4X A;  4EGV A;  4BWG B;  4CJ1 B;  4ALP A;  2NVQ B;  2JA6 B;  2I0Q A;  5C3E B;  5T1I A;  4K5X A;  3R8B A;  2NWG A;  3H3V H;  1C4Q A;  1I4G A;  4BY1 B;  1EY5 A;  1AE2 A;  1Q1E A;  2MQH A;  5KGU A;  4DR5 L;  3RLF A;  4LUZ A;  3S1M H;  1PZJ D;  1CM9 A;  1YNN D;  2LS0 1;  3ERS X;  1PA6 A;  1EYG A;  4PZ8 A;  3TQY A;  4DV5 L;  3PF4 A;  2JN4 A;  2F4I A;  2M2L A;  1MKH A;  4A3L H;  4X66 Q;  4JYA L;  4YWM A;  1SSO A;  3B6Y A;  1XPR A;  1LO5 D;  5FJ8 H;  2UXB Q;  4LF4 Q;  4C2M B;  4OX9 L;  3RLN A;  1HTL D;  1CQV A;  2QIL A;  4L5S A;  5IGE A;  3P20 A;  4J15 A;  2K33 A;  5C3W A;  5EKL A;  3URY A;  1ENF A;  3W1G A;  3BYY B;  3QOL A;  3NWT A;  1RTN A;  2JE6 I;  3HOW G;  5I9O A;  3FKI G;  3VYS A;  3J81 E;  3BVZ A;  1UE1 A;  1Q90 A;  4IN3 A;  3KJP A;  1RHP A;  1MSG A;  3CRK C;  3G6J B;  1CKO A;  1NMG A;  1X9N A;  2BA0 A;  4KHV A;  1PZI D;  5HGQ A;  1PTO C;  4C3I B;  1WTQ A;  3NQI A;  5CMD A;  3NBH A;  5IYC G;  1OXT A;  2UXC L;  5M5Y H;  1VF7 A;  4OX9 Q;  1BCP D;  4KHZ A;  4LK1 C;  2GVB A;  3QIA A;  5EKK A;  3RZO B;  3UDX A;  2UU9 L;  2CFM A;  2Y0S E;  1S40 A;  2WKD A;  1ENC A;  2B2U C;  3VA5 A;  4ZQ3 A;  2LKV A;  4MIU A;  3ER0 A;  2QGQ A;  4KMU C;  1MJE A;  5GAE C;  4Y7N H;  2N8N A;  1UE5 A;  1JJG A;  2K5V A;  2R7Z H;  3GTM B;  5JJI A;  2CW0 D;  3MTS A;  2A69 D;  1JCK B;  1EEI D;  3F2B A;  1X56 A;  3VYT A;  1PXU A;  3EVQ A;  4B3M L;  1UE6 A;  1HHV A;  3PCO B;  4LMQ D;  4LW1 A;  5D3D A;  2JA8 G;  4A3G H;  2AQ1 B;  4RAU C;  4XT1 B;  4QCL A;  1MJC A;  1M1K C;  4EQ5 A;  2JK8 A;  1P8L A;  4I65 A;  2PQA A;  1Q8K A;  4H13 C;  1SE8 A;  3CQZ H;  1PH8 A;  4HID A;  3Q8D A;  1EYA A;  4HJ9 A;  2Z6K C;  4C3J G;  4XQN A;  4OIK A;  2KCC A;  4RGN A;  2FHT A;  1Y1V G;  2WKC A;  3S2H H;  1BCP C;  1MD2 D;  2F0V A;  2Z4I A;  3VR2 A;  1VQI A;  1EL0 A;  1II3 A;  3J81 j;  2WP8 J;  3MXN A;  2ES2 A;  3L0O A;  2F4V L;  3HGB A;  1Q12 A;  1HZB A;  1TT2 A;  3BDC A;  1CFM A;  1TKW B;  1EOV A;  1PYS B;  3K5N A;  3TP5 A;  3CPW A;  4B3S Q;  3GTO H;  1F9S A;  1X6O A;  3HKZ B;  4V19 0;  3EFX D;  1KLU D;  1WTH A;  1EIH A;  4GKJ Q;  2YYZ A;  2QA4 A;  2VQE Q;  2H4O A;  3T56 B;  1EIF A;  5M3F H;  2DN8 A;  1AW7 A;  4LFC L;  1N34 Q;  3D6W A;  1S5E D;  1EWC A;  1PZK D;  3M7G A;  2EXD A;  1K73 C;  3SVM A;  3WWV A;  4GN3 B;  1FGB D;  2NN6 G;  1JE5 A;  2IW3 A;  3CCQ A;  3GP7 A;  2OEO A;  1XNQ L;  1SYB A;  4WRD A;  3PUY A;  2E74 C;  3CU7 A;  3T51 B;  2K75 A;  4NXM Q;  1NCV A;  1PRT F;  4C1N I;  1PH9 A;  4RA8 A;  4K5W A;  4O2D A;  4K14 A;  2PW5 A;  3TZD A;  2CWA A;  1HUM A;  5IYC H;  2CKZ B;  1S72 A;  3TP7 A;  4MNO A;  1OO9 B;  1EOT A;  2ZJQ A;  1QUQ B;  4K0K L;  3I4M G;  2IX1 A;  1DCZ A;  4HJ5 A;  3I8Z A;  2EYH A;  4Y52 H;  4OWX B;  4C56 C;  1LTL A;  4GLX A;  1Y69 U;  4DNT B;  2XRQ D;  1X54 A;  3A8J E;  2JA6 H;  1U9R A;  1ICF B;  4F7X A;  4FHE A;  3RLO A;  1EY9 A;  1GKH A;  3ITP A;  1MGS A;  1STE A;  3GTK H;  2PCF B;  1MIU A;  2AKW B;  1E2W A;  1VQ6 A;  1GO3 E;  3LWU A;  1ASY A;  4OWW B;  2DNE A;  1CHP D;  1KRS A;  4PMW A;  4DR4 L;  3JAM E;  3J7Y W;  1G6P A;  4LF7 L;  2A5H A;  2CHB D;  1SR3 A;  1MSH A;  2L4N A;  2CQA A;  1PFM A;  3PO2 H;  4L5T A;  3Q24 A;  2K5H A;  1ESF A;  1HR0 L;  1EWI A;  3A5Z B;  3R2T A;  5LL6 S;  1HQR D;  2DJF C;  4A93 H;  1W6K A;  2A19 A;  3DMU A;  4KLK A;  1FNU A;  1HCZ A;  5GRO A;  4DV1 L;  2K52 A;  1EY0 A;  2HDM A;  1TWG B;  2R93 B;  3GTL B;  1HQM C;  3MAQ A;  5I4D A;  1MBY A;  3ZJY C;  4ID6 A;  4XDX A;  2E5L Q;  4BBS B;  1D5M C;  4FF4 A;  5IT9 E;  3CCL A;  1O80 A;  1Q81 C;  2WAQ B;  5ELO A;  3MWY W;  2X6L A;  2NN6 I;  4N8F A;  5C5M A;  2LFN A;  3H6M A;  3F2C A;  4FNF A;  1D2B A;  2AHO B;  4HJ8 A;  3CC4 A;  4A3F B;  1YZ6 A;  4QF4 A;  1AP0 A;  5C44 B;  3RUZ A;  4BY7 H;  1BUV T;  3KLR A;  4A3M B;  2B2V A;  4IAL A;  2QCP X;  1T9H A;  4JI0 Q;  2IX0 A;  4DGZ A;  1HXY D;  4BA1 I;  2M00 A;  1VQJ A;  1XTD A;  2JYO A;  5I2X A;  4IOA A;  4JI6 Q;  4B9X A;  3TP8 A; 
#chains in the Genus database with same CATH homology
 2K14 A;  2BH8 A;  3UE0 A;  4HIO A;  5JJL A;  1YEZ A;  1JJ2 A;  5LMU L;  3GTM H;  1HNW Q;  1QZH A;  2MO0 A;  3M3Y H;  3M4Q A;  2ZM6 Q;  4UP9 A;  2VL6 A;  3S14 H;  3CF5 A;  4DKA C;  4LF9 Q;  1N36 L;  1D8L A;  2Z0S A;  1K3R A;  4BY1 G;  1OTC A;  4LF6 L;  1KRT A;  1VQK A;  4GOP C;  4BY1 H;  4A3B G;  5K36 G;  4DV3 Q;  1N34 L;  3E0E A;  2IHE A;  2UUA Q;  2KHI A;  1Z9F A;  2K5N A;  2MNA A;  3S1R H;  2XGT A;  1NY4 A;  1KQS A;  1JT8 A;  3NEL A;  2JEB I;  2I5L X;  1Y14 B;  2R7D A;  3CPF A;  3H15 A;  4JI3 Q;  4DV0 L;  1K9M C;  1HR0 Q;  4JI2 Q;  5C44 G;  4DR7 L;  1QUQ A;  1SN8 A;  2H5X A;  4GOP A;  4WJ4 A;  4C3I H;  3AQQ A;  3K81 C;  5E7N A;  2B3G A;  2AWO A;  2QEX A;  1AE3 A;  4A3M H;  1HNW L;  5C3E H;  4UP8 A;  4A3K G;  4LF5 Q;  5HY6 A;  2UXC Q;  4BY7 G;  4LF9 L;  2AMC B;  3GTG H;  4A3C G;  2UUB Q;  2OTL A;  2VY3 A;  3UE1 A;  3A5U A;  4GKK Q;  4DR3 Q;  5IP9 G;  2OQ0 A;  2R92 H;  1WJJ A;  4K0K Q;  1E3P A;  3HKZ G;  5ELN A;  1PH2 A;  4QGU A;  3OTO L;  3HOX G;  2F4V Q;  4JC0 A;  1YNX A;  2JQO A;  3I7F A;  2UU9 Q;  2R93 H;  1UE7 A;  4DV4 L;  1Q1B A;  1SMX A;  3I2Z A;  3L2P A;  2R93 G;  4JI5 Q;  3S15 H;  1OXU A;  3PUZ A;  4XTC S;  1RIP A;  1YHQ A;  2WB1 G;  4A3J G;  1PVO A;  5LMN L;  2UXB L;  4JI8 Q;  1KXL A;  4LF4 L;  3PIP A;  3EN2 A;  4GNX C;  3S1Q H;  5C0X I;  2HHH Q;  4P72 A;  4DR1 L;  2PNH A;  1E7Z A;  3U4V A;  5C4X G;  4LFC Q;  2K50 A;  4IO9 A;  1FGU A;  2F52 A;  4LF5 L;  2VNU D;  3AFP A;  5C0X G;  2YTX A;  1NJI C;  3F8T A;  1PH6 A;  1GM5 A;  4IPD A;  1YIJ A;  3GTL H;  2YV5 A;  4B3R L;  1XMO Q;  1HZC A;  3I4N G;  1EQR A;  1XNQ Q;  4A3L G;  4GS3 A;  3ULL A;  2KBN A;  1HZA A;  4IPG A;  2RF4 A;  3STB D;  1IXR A;  4IJH A;  4APV A;  2CWP A;  4GNX B;  3W1B A;  1NMF A;  3RR5 A;  4A3E G;  2BH2 A;  3PUW A;  3FHW A;  4NXM L;  1EIY B;  3W5O A;  2ATW A;  3M4P A;  4JI5 L;  5LMU Q;  4OON A;  1EFW A;  2A1A A;  3E9I A;  2VQF L;  1N9W A;  3RN2 A;  2YU9 H;  2ZTE A;  4LFA L;  5IP7 G;  3S24 A;  4L5R C;  2HQL A;  4B3T Q;  2NZO A;  1B8A A;  1GD7 A;  4PG3 A;  3EIV A;  3I55 A;  3G71 A;  3CCM A;  4A3F H;  1QZG A;  3NEM A;  4LF6 Q;  1TWF H;  2JEA I;  3H0G G;  2RCN A;  4YCV A;  3CC7 A;  1HNX L;  4P75 A;  3DLL A;  3KJO A;  1VQL A;  1HR0 W;  1NTG A;  4JI7 L;  4R4T A;  2UUC Q;  2IY5 B;  1IBK Q;  4QQB X;  3G48 A;  3K7A H;  3HKS A;  3KDF A;  3HKZ E;  4JI2 L;  3D31 A;  1VQA A;  4X64 L;  4QIW E;  1KIX A;  3VDY A;  3TRE A;  1JB7 A;  4YY3 Q;  1VQP A;  2Q2I A;  3MXN B;  4C2M H;  2JA5 G;  3E9H A;  3HOY G;  3I4O A;  4A3D H;  1DGS A;  4A93 G;  3KYH C;  2I5H A;  2E2H H;  1C9O A;  4QL5 A;  3PSI A;  1YIT A;  1AH9 A;  4P73 A;  3KFU A;  2N78 A;  1EQQ A;  5GAH C;  1N32 Q;  4B3S L;  3PO3 H;  2NVX H;  1WCM G;  2WFW A;  4LFA Q;  1CSQ A;  3M4O H;  4LF8 L;  4HJA A;  3CCR A;  2ZTC A;  3AFQ A;  4KI0 A;  5C4X H;  4IPC A;  1H95 A;  1L1O C;  2YTV A;  1CKN A;  1SFO H;  4OWT B;  1A63 A;  3OTO Q;  1XMQ L;  1HJP A;  1J6Q A;  1E1O A;  4DV2 L;  4R4C A;  1LM0 A;  1KAW A;  1FL0 A;  1VQN A;  1Q86 C;  4JI0 L;  1S3O A;  3J80 c;  3GTQ H;  2PQA B;  1BBW A;  3KLW A;  4POF A;  3CCS A;  4LNQ A;  1KHI A;  2PI2 E;  3J81 c;  1I6H H;  4WJ3 M;  4FDB A;  4RMF A;  4X62 L;  3T1H L;  2R7Z G;  3J80 i;  2Q2H A;  4JV5 L;  1D7Q A;  3HOZ G;  1K83 H;  5GAD C;  3S2D H;  3AYH B;  3PGZ A;  1HZ9 A;  2Z6K A;  4UP7 A;  2E8G A;  1VQ8 A;  3F2D A;  4DV6 Q;  1YHA A;  4LWC A;  3TS0 A;  4UY8 C;  5IY0 A;  2ZTD A;  4DR5 Q;  1YBY A;  5M3F G;  2FXQ A;  3K7U C;  2R6G A;  3K80 C;  1C7Y A;  2ZM6 L;  1N32 L;  5C3E G;  4DR2 L;  1J5E Q;  4R4I A;  1B7Y B;  2UXD L;  2GVA A;  3U50 C;  2Q2U A;  3I56 A;  1VQM A;  4B3R Q;  1KL9 A;  2CQO A;  2OCE A;  2HT1 A;  3CXC A;  4TVA B;  4RG1 A;  3GDE A;  2IT1 A;  4ALP A;  1OXX K;  5IYD H;  4DPG A;  4DR6 L;  2I0Q A;  1XNR L;  2RHQ B;  1Q82 C;  1N33 Q;  4A76 A;  2D0O A;  1I94 L;  1BBU A;  3H3V H;  2ZJP A;  2ZJR A;  5IWA L;  3CCV A;  4GKJ L;  1AE2 A;  4A4I A;  4OO1 I;  1Q1E A;  2YTY A;  4JG2 A;  1YVC A;  1K0R A;  2MQH A;  4B3M Q;  3PO3 G;  1VS0 A;  4DR5 L;  3RLF A;  3KF8 B;  3A0J A;  4LUZ A;  5IYB H;  3S1M H;  3ERS X;  1B70 B;  1L0W A;  1JJC B;  2UXD Q;  1PA6 A;  4X6A H;  1QVG A;  4GKK L;  4YWL A;  4JI1 L;  4PZ8 A;  3TQY A;  1SLJ A;  4DV5 L;  1EYG A;  4DR4 Q;  1W2B A;  3PF4 A;  1YHB A;  1E1T A;  4LF7 Q;  1MKH A;  1KC8 C;  3KDF B;  4A3L H;  2KCM A;  4X66 Q;  3J7A 5;  2CCZ A;  4JYA L;  2BA1 A;  4YWM A;  3B6Y A;  2NZH A;  1Y1W G;  4H02 A;  3LGJ A;  4BXX G;  1XPR A;  4GNX A;  1LUZ A;  4NB3 A;  5FJ8 H;  1Q46 A;  4HIM A;  2UXB Q;  1VQO A;  1VQF A;  4AYB E;  4LF4 Q;  2I5M X;  5IT9 c;  4A3F G;  4OX9 L;  3RLN A;  4IFD J;  5IP7 H;  4DUZ L;  2HHH L;  4A3C H;  4DUY L;  4L5S A;  1VQ9 A;  3GTP H;  1SRO A;  4QY7 A;  2UUA L;  2GN5 A;  4J15 A;  2WAQ E;  3HOV G;  1VCI A;  2WAQ G;  4DK3 C;  3W1G A;  4DNI A;  3NBH B;  3U4Z A;  1XPO A;  3PO2 G;  3HOW G;  2JE6 I;  4JI1 Q;  4NXN Q;  3HOX H;  3FKI G;  5J3B A;  3HOW H;  2B29 A;  1UE1 A;  4BBS H;  4DR7 Q;  1FJG Q;  3SGI A;  1PV4 A;  3KJP A;  3D0F A;  5M3M H;  2C35 B;  1CKO A;  1NMG A;  1X9N A;  2BA0 A;  5HGQ A;  5FLX c;  4DV6 L;  2ASB A;  5LMN W;  3HOY H;  4DAY B;  1OLT A;  1Y1V H;  5IYC G;  1C0A A;  1OXT A;  1PYB A;  2UXC L;  1WI5 A;  5M5Y H;  4OX9 Q;  4JI4 Q;  4DUY Q;  5IYB G;  1L1O B;  4KHZ A;  3CCU A;  1IBM L;  2GVB A;  3GTJ H;  1TWA H;  3UDX A;  2UU9 L;  2CFM A;  2Y0S E;  1S40 A;  3S16 H;  1IBL L;  1XNR Q;  4PZ7 A;  5GAG C;  2UUC L;  3ER0 A;  2QGQ A;  3J7Z C;  4JBJ A;  1MJE A;  1K8G A;  3L7Z C;  5GAE C;  4Y7N H;  2N8N A;  2NVY H;  1UE5 A;  5LMN Q;  1JJG A;  1WYD A;  2K5V A;  1CKN B;  1WFQ A;  3M9B A;  3NEN A;  2R7Z H;  3BZC A;  2JA6 G;  1Y1W H;  1Q7Y C;  5JJI A;  1I5F A;  3CCJ A;  1CUK A;  4R4Q A;  1A0I A;  4DV1 Q;  4A3M G;  1VQ5 A;  3F2B A;  1X56 A;  3ULP A;  1LYL A;  1UE6 A;  3FP9 A;  4B3M L;  1YJ9 A;  3PCO B;  4GN5 A;  4LW1 A;  4NPS A;  2JA8 G;  4A3G H;  3K0X A;  3TS2 A;  1N36 Q;  1HNZ Q;  1Z47 A;  3OYY A;  1MJC A;  4OO1 G;  3H0G H;  4JBK A;  3ICE A;  1X55 A;  4P74 A;  1VQC A;  3CAM A;  1XMO L;  1VQE A;  2N3S A;  3CMA A;  1L2F A;  4DV7 L;  4A3I G;  1M1K C;  4EQ5 A;  2JK8 A;  3RNU A;  1P8L A;  3CP0 A;  2EQS A;  1PH1 A;  2D0P A;  1Q8K A;  2PQA A;  5M5W H;  1TWG H;  4JYA Q;  3FKI H;  3AEV A;  5M3M G;  3CD6 A;  1SE8 A;  4UPA A;  5IYD G;  1UWV A;  3CQZ H;  4MTN A;  4AQY L;  1PH8 A;  1X3F A;  1CKM A;  3Q8D A;  3BZK A;  4PZ6 A;  4X62 Q;  4HID A;  3T1H Q;  4BBR H;  4JBW A;  1R9T H;  1XJV A;  2OTJ A;  4A3J H;  4HJ9 A;  2Z6K C;  4X65 L;  4IFD G;  4B3T L;  3KF6 A;  1IYJ B;  2D62 A;  3H3V I;  1Y1V G;  3GO5 A;  4EX5 A;  2B63 H;  1JMC A;  3HFZ B;  3S2H H;  4XIG S;  4A3B H;  2VS1 A;  3I4M H;  4IFD I;  3PF5 A;  2VZA A;  2MO1 A;  2UUB L;  1VQI A;  2R7F A;  1HNZ L;  3PIO A;  1M90 C;  1GVP A;  1VQG A;  2HIX A;  2WP8 J;  3JC6 6;  4NXN L;  3J81 j;  1X3G A;  1X65 A;  1I50 H;  2XTI A;  2ES2 A;  3L0O A;  4A3E H;  1YI2 A;  1A62 A;  2MFI A;  1V43 A;  4L5Q A;  5EAY A;  2F4V L;  4YY3 L;  5C44 H;  1QVF A;  5AJ3 Q;  3I4N H;  1G51 A;  1Q12 A;  1HZB A;  3K8A A;  2A8V A;  2K4K A;  1YJN A;  4DR6 Q;  1V1Q A;  1EOV A;  1PYS B;  1X3E A;  5JJK A;  4A3G G;  1N33 L;  4QJF A;  1QVC A;  3CPW A;  1I94 Q;  2ALY B;  4BXX H;  2OWO A;  4B3S Q;  1X6O A;  3ULJ A;  4JI8 L;  3GTO H;  3HOU H;  1RL2 A;  3UDF A;  2DGY A;  4X65 Q;  2ID0 A;  1KD1 C;  4LF8 Q;  2YYZ A;  3JAM c;  2QA4 A;  2VQE Q;  4GKJ Q;  4JI4 L;  2VUM G;  4TQU S;  4YCW A;  1VQ4 A;  1EIF A;  5M3F H;  2KCT A;  2WB1 E;  3KF6 B;  4DV3 L;  4LFC L;  1N34 Q;  3HOV H;  4DV2 Q;  3RZD H;  2EXD A;  1K73 C;  4GN4 B;  2JA9 A;  1HH2 P;  2N49 A;  2PI2 A;  3WWV A;  2E2I H;  1IBL Q;  2R92 G;  4GN3 B;  2NN6 G;  4YHH L;  4IJL A;  4JI3 L;  1IZ6 A;  1JE5 A;  3CC2 A;  3CCQ A;  1P16 A;  2OQK A;  1XNQ L;  1VQB A;  2E5L L;  4YCU A;  3PUY A;  3T1Y Q;  4BBR G;  4POG A;  1ASZ A;  2K75 A;  3DM3 A;  4NXM Q;  2JA7 H;  1EUJ A;  3UDG A;  1PH9 A;  4O2D A;  4A75 A;  5GQO A;  2VQF Q;  2IHF A;  1U5K A;  2CWA A;  1G29 1;  3M85 A;  3EBE A;  5C4J H;  5JEA G;  4DR2 Q;  5IYC H;  1N8R C;  1J5E L;  3PUX A;  4P71 A;  4JOI C;  1TWH H;  2CKZ B;  1FVI A;  1S72 A;  2LXK A;  2VQE L;  1TWC H;  4MNO A;  2HIV A;  4GOP B;  2ZJQ A;  1QUQ B;  4K0K L;  3UDI A;  3I4M G;  2IX1 A;  2VW9 A;  4HJ5 A;  4DV7 Q;  5C0X J;  1PH3 A;  4C3H H;  5FLM G;  4R1J A;  3MEF A;  3BJU A;  4GLV B;  4Y52 H;  2RHS B;  4OWX B;  1LTL A;  4GLX A;  4JI7 Q;  4OXP A;  1IBK L;  1E22 A;  2NVQ H;  1SRU A;  1W3S A;  4BA2 I;  2E2J H;  1X54 A;  3PUV A;  4AYB G;  4X64 Q;  4GLA C;  1PFS A;  2JA6 H;  4JI6 L;  4KHP Q;  1BKB A;  3RLO A;  1GKH A;  3T1Y L;  3HOU G;  1L1O A;  4MZ9 A;  3OW2 A;  4LFB Q;  3F1Z A;  2JJQ A;  5FJ8 G;  4A3K H;  3TRZ A;  4IPH A;  2EIF A;  2JA8 H;  3GTK H;  1MIU A;  2AKW B;  1BVS A;  4DK6 C;  4HIK A;  1VQ6 A;  1K8A C;  1GO3 E;  1I3Q H;  3KOJ A;  3J81 i;  1ASY A;  4OWW B;  1NBW A;  1KRS A;  3CW2 C;  5DLQ E;  4PMW A;  4DV5 Q;  4DR4 L;  4A3I H;  1G6P A;  2LSS A;  4LF7 L;  3G4S A;  1IBM Q;  1SR3 A;  4AH6 A;  2L15 A;  3PO2 H;  2PMZ E;  2NVT H;  1TXY A;  2JA5 H;  4L5T A;  1VQ7 A;  1PH7 A;  2K5H A;  3JAM i;  2JA7 G;  4BBS G;  4O0A A;  1CSP A;  2Q2T A;  3G6E A;  4DV0 Q;  1HR0 L;  4C3J H;  1EWI A;  4ME3 A;  4HJ7 A;  4JCV E;  2KHJ A;  3A5Z B;  4JV5 Q;  4KHP L;  4A93 H;  4LUO A;  1V9P A;  4AIM A;  1WCM H;  4LFB L;  2A19 A;  4KLK A;  5GRO A;  4DUZ Q;  4DV1 L;  3GD7 A;  4LUV A;  2K52 A;  2AWN A;  1WOC A;  3S17 H;  1PHJ A;  1HNX Q;  1PH4 A;  2B63 G;  2Y0S G;  1OXV A;  5FLM H;  4JBM A;  1A8V A;  1YJW A;  1NE3 A;  4DR3 L;  1VQH A;  4YHH Q;  3IRB A;  1VQD A;  3ZJY C;  1PH5 A;  2KEN A;  2E5L Q;  5BR8 Q;  3TEH B;  3HOZ H;  2F3I A;  3A74 A;  4YWK A;  4DV4 Q;  1Q81 C;  3CCL A;  2V1C C;  5ELO A;  4DAM A;  1IL2 A;  4AQY Q;  2NN6 I;  2LXJ A;  5JEA J;  3S1N H;  1E24 A;  3F2C A;  1XPU A;  5IWA Q;  2AHO B;  4HJ8 A;  2VUM H;  1U0L A;  3CC4 A;  3STB C;  3CCE A;  1O7I A;  1UEB A;  1YZ6 A;  4DR1 Q;  3M7N A;  4JOI A;  5M5X H;  5IP9 H;  4BY7 H;  1XMQ Q;  3BU2 A;  3U58 A;  1FJG L;  3RN5 A;  2DUD A;  3RZO H;  1T9H A;  4JI0 Q;  2IX0 A;  5H1S E;  4BA1 I;  1VQJ A;  3CME A;  1XTD A;  4R4O A;  4IOA A;  4A3D G;  4IOC A;  1OXS C;  5BR8 L;  4JI6 Q;  5AJ3 L;  4X66 L;  5IE8 A;  3PV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...